Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR038C58056930250.0
YBR068C (BAP2)60957719740.0
Scas_569.559358219700.0
YDR046C (BAP3)60456819490.0
Scas_718.4259555019220.0
CAGL0L07546g63459218600.0
Kwal_27.1053860254918530.0
CAGL0H08393g61253717740.0
CAGL0B01012g62360416240.0
Kwal_33.1320460755115960.0
AGR039C58654215800.0
YDR508C (GNP1)66359915630.0
AFR698C60956515490.0
AGR040C57357115220.0
CAGL0K05753g66056615300.0
YCL025C (AGP1)59553814760.0
KLLA0C01606g62057814620.0
Kwal_33.1321559857714460.0
Scas_517.267960514100.0
YBR069C (TAT1)61952113241e-177
Sklu_2029.259851413111e-175
Scas_718.4161454413101e-175
ADL272W56451312631e-169
Sklu_2390.160557112051e-159
YKR039W (GAP1)60254311951e-158
Kwal_27.1268159355811871e-157
CAGL0L03267g59753911761e-155
KLLA0A06886g58755311631e-153
AFR230C60454711401e-149
Kwal_33.1540758752811361e-149
KLLA0F01012g55653011281e-148
Kwal_33.1427659654111271e-148
YGR191W (HIP1)60351711041e-144
AGR319W62655610921e-142
CAGL0B03773g60549810881e-142
KLLA0A11770g58154710781e-140
Scas_607.459955410781e-140
Scas_479.159556510771e-140
Scas_507.159250010641e-138
KLLA0A06930g58753610611e-138
CAGL0D02178g57758510441e-135
YOL020W (TAT2)59254110301e-133
AEL030W73953610351e-132
KLLA0A10813g5845369551e-122
Kwal_34.162544814828881e-113
Kwal_56.229515965748791e-110
KLLA0B06776g5885658611e-108
YLL061W (MMP1)5835798361e-104
Scas_536.13723548141e-104
YPL274W (SAM3)5875728111e-100
CAGL0J08162g5975048023e-99
Scas_706.36d6075057902e-97
YEL063C (CAN1)5905427866e-97
Kwal_33.134015595167802e-96
AFR667C5635257775e-96
Kwal_33.134115605187776e-96
AER405C4975017692e-95
Scas_706.375445307634e-94
KLLA0C02365g5795357647e-94
YNL268W (LYP1)6115317624e-93
CAGL0J08184g5725677524e-92
KLLA0C02343g5815247412e-90
Scas_377.24904937098e-87
YNL270C (ALP1)5735237151e-86
CAGL0A01199g6135457066e-85
KLLA0E16335g6055186971e-83
AFR668W5564696886e-83
YOR348C (PUT4)6276036832e-81
Scas_520.2*3723556623e-81
YPL265W (DIP5)6085416682e-79
Scas_486.25975386638e-79
Kwal_33.155455765206356e-75
CAGL0E05632g5985536253e-73
Kwal_26.69405705346102e-71
ACL135W5885786024e-70
Kwal_26.96125435015986e-70
Kwal_23.28175805375981e-69
CAGL0M00154g5505445952e-69
YFL055W (AGP3)5585225911e-68
KLLA0B14685g5715265867e-68
Sklu_2438.145585205779e-67
AFR156W5585145752e-66
Scas_552.35585175709e-66
Scas_84.12132085412e-65
KLLA0F27093g5634785682e-65
KLLA0F23419g5735385613e-64
Kwal_8.5906295415345e-60
Kwal_26.80975445364893e-54
Kwal_23.40265345104762e-52
Sklu_2365.98055734483e-47
Scas_460.35845464282e-45
Scas_377.11481363912e-44
YBR132C (AGP2)5965034222e-44
KLLA0D16830g8325844192e-43
Scas_682.308456244166e-43
YDR160W (SSY1)8525914149e-43
AGL171W8515654113e-42
KLLA0B09922g7976404051e-41
Kwal_23.38475794653991e-41
CAGL0C00539g5724663912e-40
CAGL0E01089g8535893972e-40
AAR038W5665403867e-40
KLLA0C15873g5684613851e-39
Kwal_27.119007264993686e-37
Kwal_53.194615655743593e-36
Scas_619.2*4714723535e-36
Scas_485.4*2371973132e-32
Scas_476.42371973122e-32
Scas_642.222371973043e-31
CAGL0B02838g592372940.003
AFL081W542110890.009
Scas_720.18569102860.023
CAGL0H03399g556111850.028
YGL077C (HNM1)563119830.049
ABL003C561363820.069
YGR055W (MUP1)574376800.12
Sklu_2305.6541124790.17
CAGL0K04367g582373760.38
Scas_670.14585391750.53
YHL036W (MUP3)546462740.70
Sklu_2218.2180128691.4
YLR166C (SEC10)871147711.6
KLLA0B13233g578365702.2
YPL085W (SEC16)219596692.8
Kwal_33.13806549331692.9
AAL103W66936683.4
CAGL0E01353g43393674.0
Sklu_2147.4568291665.3
Scas_689.19612198665.7
KLLA0A06666g56098658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR038C
         (569 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...  1169   0.0  
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   764   0.0  
Scas_569.5                                                            763   0.0  
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   755   0.0  
Scas_718.42                                                           744   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   721   0.0  
Kwal_27.10538                                                         718   0.0  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   687   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   630   0.0  
Kwal_33.13204                                                         619   0.0  
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   613   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   606   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   601   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   590   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   593   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   573   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   567   0.0  
Kwal_33.13215                                                         561   0.0  
Scas_517.2                                                            547   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   514   e-177
Sklu_2029.2 , Contig c2029 2095-3891                                  509   e-175
Scas_718.41                                                           509   e-175
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   491   e-169
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        468   e-159
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   464   e-158
Kwal_27.12681                                                         461   e-157
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   457   e-155
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   452   e-153
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   443   e-149
Kwal_33.15407                                                         442   e-149
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   439   e-148
Kwal_33.14276                                                         438   e-148
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   429   e-144
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   425   e-142
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   423   e-142
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   419   e-140
Scas_607.4                                                            419   e-140
Scas_479.1                                                            419   e-140
Scas_507.1                                                            414   e-138
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   413   e-138
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   406   e-135
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   401   e-133
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   403   e-132
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   372   e-122
Kwal_34.16254                                                         346   e-113
Kwal_56.22951                                                         343   e-110
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   336   e-108
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   326   e-104
Scas_536.1                                                            318   e-104
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   317   e-100
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   313   3e-99
Scas_706.36d                                                          308   2e-97
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   307   6e-97
Kwal_33.13401                                                         305   2e-96
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   303   5e-96
Kwal_33.13411                                                         303   6e-96
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   300   2e-95
Scas_706.37                                                           298   4e-94
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   298   7e-94
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   298   4e-93
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   294   4e-92
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   290   2e-90
Scas_377.2                                                            277   8e-87
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   280   1e-86
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   276   6e-85
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   273   1e-83
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   269   6e-83
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   267   2e-81
Scas_520.2*                                                           259   3e-81
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   261   2e-79
Scas_486.2                                                            259   8e-79
Kwal_33.15545                                                         249   6e-75
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   245   3e-73
Kwal_26.6940                                                          239   2e-71
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   236   4e-70
Kwal_26.9612                                                          234   6e-70
Kwal_23.2817                                                          234   1e-69
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   233   2e-69
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   232   1e-68
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   230   7e-68
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        226   9e-67
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   226   2e-66
Scas_552.3                                                            224   9e-66
Scas_84.1                                                             213   2e-65
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   223   2e-65
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   220   3e-64
Kwal_8.590                                                            210   5e-60
Kwal_26.8097                                                          192   3e-54
Kwal_23.4026                                                          187   2e-52
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         177   3e-47
Scas_460.3                                                            169   2e-45
Scas_377.1                                                            155   2e-44
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   167   2e-44
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   166   2e-43
Scas_682.30                                                           164   6e-43
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   164   9e-43
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   162   3e-42
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   160   1e-41
Kwal_23.3847                                                          158   1e-41
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   155   2e-40
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   157   2e-40
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   153   7e-40
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   152   1e-39
Kwal_27.11900                                                         146   6e-37
Kwal_53.19461                                                         142   3e-36
Scas_619.2*                                                           140   5e-36
Scas_485.4*                                                           125   2e-32
Scas_476.4                                                            124   2e-32
Scas_642.22                                                           121   3e-31
CAGL0B02838g complement(274984..276762) highly similar to sp|P50...    41   0.003
AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH] complement(...    39   0.009
Scas_720.18                                                            38   0.023
CAGL0H03399g complement(316110..317780) highly similar to sp|P19...    37   0.028
YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline pe...    37   0.049
ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH] (390867..392...    36   0.069
YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity methio...    35   0.12 
Sklu_2305.6 YGL077C, Contig c2305 10656-12281                          35   0.17 
CAGL0K04367g 412204..413952 highly similar to sp|P50276 Saccharo...    34   0.38 
Scas_670.14                                                            33   0.53 
YHL036W (MUP3) [2250] chr8 (26239..27879) Low affinity methionin...    33   0.70 
Sklu_2218.2 YGR055W, Contig c2218 1631-2173                            31   1.4  
YLR166C (SEC10) [3572] chr12 complement(495431..498046) Componen...    32   1.6  
KLLA0B13233g complement(1159097..1160833) highly similar to sp|P...    32   2.2  
YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protei...    31   2.8  
Kwal_33.13806                                                          31   2.9  
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    31   3.4  
CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces c...    30   4.0  
Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement         30   5.3  
Scas_689.19                                                            30   5.7  
KLLA0A06666g complement(603169..604851) similar to sp|P36029 Sac...    30   8.8  

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/569 (100%), Positives = 569/569 (100%)

Query: 1   MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDT 60
           MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDT
Sbjct: 1   MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDT 60

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
           TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG
Sbjct: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180
           EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN
Sbjct: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180

Query: 181 ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIG 240
           ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIG
Sbjct: 181 ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIG 240

Query: 241 DRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKG 300
           DRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKG
Sbjct: 241 DRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKG 300

Query: 301 VYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVIL 360
           VYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVIL
Sbjct: 301 VYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVIL 360

Query: 361 ISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASD 420
           ISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASD
Sbjct: 361 ISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASD 420

Query: 421 NQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAV 480
           NQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAV
Sbjct: 421 NQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAV 480

Query: 481 FFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDK 540
           FFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDK
Sbjct: 481 FFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDK 540

Query: 541 MDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
           MDLDTHRRVYDVEVLKQEEYEFKERMRNS
Sbjct: 541 MDLDTHRRVYDVEVLKQEEYEFKERMRNS 569

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/577 (61%), Positives = 450/577 (77%), Gaps = 13/577 (2%)

Query: 5   SVNKFNEKTVVQTAYSPSYASPESTGP---FRRFVDSFRREDTS---------RSGDLED 52
           S+  F+     Q++ S    S + +G      RF DSF+R + S          + DLED
Sbjct: 21  SIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLED 80

Query: 53  GEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVS 112
           G  + T  +KL++ M++RHVVMMSLGTGIGTGLLVANA  LHYGGPA L+IGY+LVS  +
Sbjct: 81  GVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFET 140

Query: 113 YIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVI 172
           Y M+ AAGEMAV YPTLP NFNAYSSIFISK FGFATVWL+C QWLTV PLELITA++ I
Sbjct: 141 YFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTI 200

Query: 173 KYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232
           ++    +N +++++IFY+F++ IHFFG + YGETEFIFN CK+LMI GF+I+ I+IN G 
Sbjct: 201 QFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGG 260

Query: 233 IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292
            G+ GYIG  YW NPG+F   T + + K   Y+LVTAYFSFGGMEL+ALSV E  NP+ +
Sbjct: 261 AGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320

Query: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352
            P A K+ +YRI+++YLLTMI+IGF VP++ D+LMG+G +  H SPYVLA  +HGVK++P
Sbjct: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVP 380

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
           HI+NAVILISV+SV NS++Y+ PRL+C+LAQQGYAPK LDY+DREGRPL +LI+C +FG+
Sbjct: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGV 440

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472
           IAF AAS  +E +F WLAAIAGLSELFTWTSI LSH RFRQAMK+QGRSL+ LGY+A TG
Sbjct: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500

Query: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAK-KKVDVLSFFQNYMAFPLWLIMFLGYMVYSRN 531
            WGS+Y VFFN+LVF+AQFWVAL P+    K D  SFFQNY+AFP+WL  + GYMVY+R+
Sbjct: 501 IWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRD 560

Query: 532 WTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           +TLLNPLDK+DLD HRR+YD E+++QE+ E KE++RN
Sbjct: 561 FTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRN 597

>Scas_569.5
          Length = 593

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/582 (62%), Positives = 457/582 (78%), Gaps = 13/582 (2%)

Query: 1   MSADSVNKFNEKTV--VQTAY------SPSY---ASPES-TGPFRRFVDSFRREDTSRSG 48
           M  + +    EKTV    T Y      SPS+   A+ ES +G   RFVDSF+R   S   
Sbjct: 1   MPRNVIQPNKEKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTEN 60

Query: 49  DLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLV 108
           DLEDG     D + L++ M++RHV+MM +GTGIGTGLLVANA+ L YGGP  L+IGY+LV
Sbjct: 61  DLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLV 120

Query: 109 SIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITA 168
           S V+Y M+ AAGEMAVAYPTLPGNFN+Y+S+FISKPFGFATVWLF +QWLTVFPLELITA
Sbjct: 121 SFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITA 180

Query: 169 TIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILI 228
           ++ IKYW   +NA+VF+VIFY+F++ IHFFG + YGE EFIFN CKVLMI GF+I+ I+I
Sbjct: 181 SLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVI 240

Query: 229 NVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPN 288
           N G  G  GYIG +YWR+PGSF  G  ++K KG  Y+LVTAYFS+GG EL++LSVNE  N
Sbjct: 241 NCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQEN 300

Query: 289 PKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGV 348
           P+ + P A K+ +YRIL++YLLTMI+IGF VPH++D+LMGSG +  H SPYVLA  +HGV
Sbjct: 301 PRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGV 360

Query: 349 KVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCA 408
           KV+PH +NAVILISVISV NSA+Y++PRL+C+LA+QGYAPK LDY+DREGRPL +LILCA
Sbjct: 361 KVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCA 420

Query: 409 IFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYR 468
           +FG+I F +AS  +E++F WLAAIAGLSELFTW+ I LSH RFRQ MKL GRS E +G+R
Sbjct: 421 VFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFR 480

Query: 469 AITGQWGSLYAVFFNLLVFIAQFWVALVPIA-KKKVDVLSFFQNYMAFPLWLIMFLGYMV 527
           A+TG WGS+Y + FN+LVFIAQFWVAL P +   KVD  SFFQ+Y+A P+WL  + GYM+
Sbjct: 481 AVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYML 540

Query: 528 YSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
           Y R++T L PLDK+DL+ HRR+YD E+++QE+ E KE+++NS
Sbjct: 541 YKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNS 582

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/568 (61%), Positives = 443/568 (77%), Gaps = 5/568 (0%)

Query: 7   NKFNEKTVVQTAYSPSYASPES-TGPFRRFVDSFRREDTSR---SGDLEDGEINSTDTTK 62
           N FN  T           S ES  G   RFVDSFRR ++ R     DLEDG  +      
Sbjct: 26  NNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNH 85

Query: 63  LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEM 122
           L++ M++RHVVMMSLGTGIGTGLLVANA  L   GP  L+IGY++VS V+Y M+ AAGEM
Sbjct: 86  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEM 145

Query: 123 AVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNAN 182
            V YPTLPGNFNAY+SIFISK FGFAT WLFC+QWLTV PLELIT+++ +KYW  ++NA+
Sbjct: 146 GVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINAD 205

Query: 183 VFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDR 242
           VF+VIFY+F++ IHFFG + YGETEFIFN CK+LM+ GF+I+ ++IN G  G  GYIG +
Sbjct: 206 VFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGK 265

Query: 243 YWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVY 302
           YWR+PGSF  G+   + KG  Y+LV+AYFSFGG+EL+ LS+NE  NP+ + P A K+ VY
Sbjct: 266 YWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVY 325

Query: 303 RILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILIS 362
           RIL++YLLTMI+IGF VPH++D+LMGSG +  H SPYVLA  +H V+V+PHI+NAVILIS
Sbjct: 326 RILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILIS 385

Query: 363 VISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQ 422
           VISV NSA+Y+APRL+C+LAQQGYAPK L+YIDREGRPL +L++C++ G++ F A S  +
Sbjct: 386 VISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQE 445

Query: 423 EKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFF 482
           E+ F WLAAIAGLSELFTW+ I LSH RFR+AMK+QGRSL+ +GY+A TG WGS Y VFF
Sbjct: 446 EQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFF 505

Query: 483 NLLVFIAQFWVALVPIAK-KKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKM 541
           N+LVF+AQFWVAL PI    K D  +FF++Y+A PLW+ M++GYMVY R++T LNPLDK+
Sbjct: 506 NMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKI 565

Query: 542 DLDTHRRVYDVEVLKQEEYEFKERMRNS 569
           DLD HRRVYD E+++QE+ E KER++NS
Sbjct: 566 DLDFHRRVYDPEIMRQEDEENKERLKNS 593

>Scas_718.42
          Length = 595

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/550 (63%), Positives = 437/550 (79%), Gaps = 2/550 (0%)

Query: 21  PSYASPESTGPFRRFVDSFRREDTSRSG-DLEDGEINSTDTTKLQQRMRTRHVVMMSLGT 79
           P   + +    F RFVDSF+R + + +G DLEDG  +      L++ M++RHV+MMSLGT
Sbjct: 34  PDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGT 93

Query: 80  GIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSI 139
           GIGTGLLVANA  L+  GPA L+IGY +VS ++Y ++ AAGEMAV YPTLPG FN Y+SI
Sbjct: 94  GIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASI 153

Query: 140 FISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFG 199
           F+SKPFGFATVWLFC+QWLTV PLELITA++ IKYW   +NA+VFVVI Y+F++ IHFFG
Sbjct: 154 FVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFG 213

Query: 200 ARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKL 259
            R YGE EFIFN CK+LMI GFVI+ I++N G  G  GYIG +YWR+PG+F S     + 
Sbjct: 214 VRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRF 273

Query: 260 KGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLV 319
           KG A+VLVTAYFS+GG+EL+ALSVNE  NP+ + P+A K+ +YRIL++YLLTMI+IGF V
Sbjct: 274 KGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNV 333

Query: 320 PHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLC 379
           PH+SD+LMG+G +  H SPYVLA+ +HGVKV+PHI+NAVILISV SV NSA+Y++PRLL 
Sbjct: 334 PHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393

Query: 380 ALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELF 439
           +LA+QGYAPK  +Y+DREGRPL +LILC+IFG+IAF A SD +E IF WLAAIAGLSELF
Sbjct: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453

Query: 440 TWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIA 499
           TW+SI LSH RFR AMK QG+SL  LGY +ITG WGSLY  FFN+LVFIAQFWVAL P  
Sbjct: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513

Query: 500 KKKV-DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQE 558
            K V    +FF++Y+AFP+WL  +LGYM+YSR++T L  L K+DLD HRR+YD E+L+QE
Sbjct: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573

Query: 559 EYEFKERMRN 568
           + E KER+RN
Sbjct: 574 DEETKERIRN 583

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/592 (58%), Positives = 440/592 (74%), Gaps = 30/592 (5%)

Query: 3   ADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSG-------------- 48
           A + N ++++    T    S  S   T    RFVDSF+R     +G              
Sbjct: 35  AGNSNDYSQRDSDNT----SIESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKT 90

Query: 49  ---------DLEDGEINSTDT-TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGP 98
                    DLE  + +S  T T L++ M++RHV+MMSLGTGIGTGLLVANA  LH+GGP
Sbjct: 91  KGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGP 150

Query: 99  AGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWL 158
           A L+IGY+LVS V+Y M+ AAGEMAV YPTLPGNFNAYSSIF+S  FGFATVW+FC+QWL
Sbjct: 151 AALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWL 210

Query: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGAR-GYGETEFIFNMCKVLM 217
           TV PLELITA++ IKYW   +NA+VF+VIFY+F++CIH FG    YGETEF+FN+CK+LM
Sbjct: 211 TVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILM 270

Query: 218 IVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGME 277
           ++GF+I+ I+IN G  G+  YIG ++W +PG+F   T   + KG  YVLV+ YFS+GG E
Sbjct: 271 VIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTE 330

Query: 278 LYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPS 337
           L+ALSVNE  NP+ + P A K  +YRIL++YLLTMI+IGF VP+DSD LMGSG +  H S
Sbjct: 331 LFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHAS 390

Query: 338 PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDRE 397
           PYVLA  ++GVK+ PH +NAVILISVISV NS++Y+APRL+C+LAQQGYAPK LDY+DR+
Sbjct: 391 PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQ 450

Query: 398 GRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKL 457
           GRPL++LI C + G+I F AAS  +E++F WLAAIAGLSELFTW+SI LSH RFR AMKL
Sbjct: 451 GRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKL 510

Query: 458 QGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNYMAFP 516
           Q RSLE LGY+A TG +GS+Y V FNLLVF AQFW AL P     K +  SFF NY+A P
Sbjct: 511 QNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMP 570

Query: 517 LWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           +WL+ + GYM+++R++ LL PLDK+DLD HRR+YD E+++QE+ E KER+RN
Sbjct: 571 IWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRN 622

>Kwal_27.10538
          Length = 602

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/549 (62%), Positives = 433/549 (78%), Gaps = 6/549 (1%)

Query: 27  ESTGPFRRFVDSFRRED---TSRSGDLEDGEINS-TDTTKLQQRMRTRHVVMMSLGTGIG 82
           E+   + RFV+SF+R +   T  +GDLE    +S   ++ L++ ++ RHV MMS+ TGIG
Sbjct: 43  ENRNAWGRFVNSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIG 102

Query: 83  TGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFIS 142
           TGLLVAN  SL +GGPAGL+IGY  VS+V+YIMM AAGEMAVAYP+LPGNFNAYSS  IS
Sbjct: 103 TGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLIS 162

Query: 143 KPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARG 202
           +PFGFATVWL+C+QWLTV PLELITA++ IKYW  S+NA+VF+ IFY+FI+ IHFFG+RG
Sbjct: 163 RPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRG 222

Query: 203 YGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGT 262
           YGE+EFIF +CKVLMI+GFVI+ I+IN G  GD  YIG +YW +PG+F  G+   K KG 
Sbjct: 223 YGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGV 282

Query: 263 AYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHD 322
           AYVLVT YFS+GG ELYA++VNE  NP+ AI S  K+ +YRILL+Y+LTMI+IGFLVPH 
Sbjct: 283 AYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHT 342

Query: 323 SDRLMG-SGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCAL 381
           S  LMG SG +  H SPYVLA+ +HGVK++PHI+NAVILI+VISVGNSAMYS PR+L  L
Sbjct: 343 SSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTL 402

Query: 382 AQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTW 441
           A+QGYAP+ L Y+DR GRPL++LI C++FGL+AF AASD +E +F WLAAIAGLSELFTW
Sbjct: 403 AEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTW 462

Query: 442 TSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK 501
           ++I LSH RFRQAM+   R L  LGY+A TG  GS+  + FN+LVFIAQFWV++ P  K 
Sbjct: 463 SAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKD 522

Query: 502 -KVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEY 560
            K+DVLSFFQ+Y+AFPLW+++F GYM+  RNW ++ PL  +DLD +R +YD + L QE+ 
Sbjct: 523 GKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDL 582

Query: 561 EFKERMRNS 569
           E K  ++NS
Sbjct: 583 EHKILIQNS 591

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/537 (59%), Positives = 414/537 (77%), Gaps = 4/537 (0%)

Query: 35  FVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLH 94
           F+DSF+R D S   D  D E  +T   + ++ M++RHV+MMSLGTGIGTGLLV+N   L 
Sbjct: 67  FIDSFKRADDSP--DHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLS 124

Query: 95  YGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFC 154
             GPA L+I Y LVS V+Y M+ AAGEMAV YPTLPG+FNAY+S FISKPFGFAT WLFC
Sbjct: 125 LAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFC 184

Query: 155 LQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214
           +QWLTV PLELITA + IKYW  S++ +VFV+IFY+F++ IHFFG + YGETEFIFN CK
Sbjct: 185 IQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACK 244

Query: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFG 274
           +LMI GF+I  I++N G  G  GYIG +YW +PG+F S     + KG  Y LV AYFS+G
Sbjct: 245 ILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVNAYFSYG 304

Query: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMG-SGSND 333
           G EL+ LSVN+  NP+ + P+A K  VYRI+++YLLTMI+IGF+VPH+S  L+G SG N 
Sbjct: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNG 364

Query: 334 VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDY 393
           +H SPYVLA  +HG+KV+PHI+NAVILI++ISV NS++Y+ PRLL +LAQQGYAP+ L Y
Sbjct: 365 LHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSY 424

Query: 394 IDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQ 453
           +DR GRPL +L+L A+ G+I F+A S  +E++F WLAAI+GLSELFTWTSI  SH RFR+
Sbjct: 425 VDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRR 484

Query: 454 AMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNY 512
           AMKLQ +SL+TLGY+A TG WGS + V FN+LVF AQFWVAL P  +  K D  SFF +Y
Sbjct: 485 AMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASY 544

Query: 513 MAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
           +A P+WL+ + GYM + +++T+L  L+++DLD HR+VYD E L+QE+ E KER+RNS
Sbjct: 545 LAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNS 601

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/604 (48%), Positives = 418/604 (69%), Gaps = 37/604 (6%)

Query: 2   SADSVNKFNEKTVV-----QTAYSP-SYASPESTGP--FRRFVDSFRREDTSRSGDL--- 50
           SAD  +K ++K V      + + +P + A+P +  P  FRRFVDSF+R +   + ++   
Sbjct: 8   SADFNDKVSDKEVEYMSPREVSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEITSA 67

Query: 51  -----------EDG---------------EINSTDTTKLQQRMRTRHVVMMSLGTGIGTG 84
                      +DG               E ++    +L+Q ++ RHV+++SLGTGIGTG
Sbjct: 68  ASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTG 127

Query: 85  LLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKP 144
           LLV NA +LH  GPAGLLIGY ++    Y ++ AAGE+AV+Y +L G FN Y S  +   
Sbjct: 128 LLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPA 187

Query: 145 FGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYG 204
           FGF+  W++C+QWL V PLEL+TA++ IKYW  +VNA++FV IFY+ II I+ FGARGY 
Sbjct: 188 FGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYA 247

Query: 205 ETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAY 264
           E EF FN CK+LM++GF I+GI+IN G  G+ GYIGDRYW  PG+F    P+D  KG   
Sbjct: 248 EAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMA 307

Query: 265 VLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSD 324
            +VTA F+FG  E  AL+  E  NP+ AIPSA KK +YRIL ++L ++ ++GFLVP+DSD
Sbjct: 308 TMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSD 367

Query: 325 RLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQ 384
           +LMGSG +    SPYVLA+  HGVKV+PH +NAVIL+SV+SVGNSA YS+ RLL +LAQQ
Sbjct: 368 QLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQ 427

Query: 385 GYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSI 444
           G APK  DY+DREGRP  +++   +F +I+F AAS  +E++F WL AI+GLS++FTW +I
Sbjct: 428 GNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAI 487

Query: 445 CLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVD 504
           CLSH RFR+AM +Q RSL  +G++A TG WGS Y  F  +++ IAQFWVA+ PI + K+D
Sbjct: 488 CLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLD 547

Query: 505 VLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKE 564
              FF+NY+A P+ ++ ++GY ++ ++W+L    + +DLD HR+++D E+LKQE+ E++E
Sbjct: 548 AQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYRE 607

Query: 565 RMRN 568
           +++N
Sbjct: 608 KLKN 611

>Kwal_33.13204
          Length = 607

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/551 (53%), Positives = 397/551 (72%), Gaps = 5/551 (0%)

Query: 23  YASPESTGPFRRFVDSFRREDTSRSG----DLEDG-EINSTDTTKLQQRMRTRHVVMMSL 77
           +   +S   FRRF  +F R D    G    D+E G E+     TKL+Q +  RHV MMSL
Sbjct: 45  FHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSL 104

Query: 78  GTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYS 137
           GTGIGTG+LV N  +LH GGPAGL+IGY ++    Y ++ AAGE+AV+Y +L GNFNAY 
Sbjct: 105 GTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYP 164

Query: 138 SIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHF 197
           S+ I + FGF+  W++CLQWL V PLEL+TA+I IKYW  SVN ++FV IFY+ II ++ 
Sbjct: 165 SMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNM 224

Query: 198 FGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLD 257
           FGARGY E EF FN CKVLMI+GF I+GI++N G  G+ GYIG RYW NPG+F    P+ 
Sbjct: 225 FGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIH 284

Query: 258 KLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGF 317
             KG    +VTA F+FG  E  AL+  E  NP+ AIPSA KK VYRILL++L  +++IGF
Sbjct: 285 HFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGF 344

Query: 318 LVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRL 377
           LVPH+S  LMGSGS+  H SPYV+A+  HGV+V+PH +NAVIL+SV+SVGNSA YS+ RL
Sbjct: 345 LVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRL 404

Query: 378 LCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSE 437
           L ALA Q YAP  L +IDR GRP+ ++++  +FGLI+F AAS  +E +F WL AI+GLS+
Sbjct: 405 LLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQ 464

Query: 438 LFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVP 497
           LFTW SIC+SH RFR+A+ +QG+ +  LGY++ TG  GS YA F    + I QFWVA+ P
Sbjct: 465 LFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAP 524

Query: 498 IAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQ 557
           +   K+D  SFF+NY+A PL+++++ G+ ++ R+W L  PL+++DLD+HR+ +D E+LKQ
Sbjct: 525 MGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQ 584

Query: 558 EEYEFKERMRN 568
           E+ E++E +RN
Sbjct: 585 EDAEYEENIRN 595

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/542 (53%), Positives = 403/542 (74%), Gaps = 8/542 (1%)

Query: 34  RFVDSFRREDTSRSGDLE----DGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89
           RF DSF+R     + DLE    D  +N T  T L+  ++TRH+ M+SLGTGIGTGLLVA+
Sbjct: 36  RFTDSFKRAQVDTAVDLEGKDADNGLNKTQQT-LKHNIKTRHLTMISLGTGIGTGLLVAS 94

Query: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149
             +LH+GGPAGL+IGY+  S + Y ++ A  E+ VAY TLPGN+NAY +  + K FGFA 
Sbjct: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154

Query: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209
             ++ LQW TV PLEL+TA++ +KYW  SVN +VFV IFY+F++ IHFFG+RGY E EFI
Sbjct: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214

Query: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTA 269
           FN  KVL++ GF+I+ I +  GA  + GYIG +YW +PG+F     +D+ KG   V V A
Sbjct: 215 FNSLKVLLMAGFIIMAISLTAGA-SEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQA 273

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            F++GG E  AL+  E  NP+ ++P A K+ +YR+++V+LL +I+IGFLVPH+SD+L+ +
Sbjct: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSA 333

Query: 330 -GSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388
            G +    SP+V+A  +HGV+V+PHI+N +IL SVISVGNSAMYSAPR+L +LA+ G  P
Sbjct: 334 EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393

Query: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448
           K   Y+DR+GRPL++LI  ++FGLIAF AAS+ +E +F WL+AIAGLS+LFTWT+I +SH
Sbjct: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453

Query: 449 FRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK-KVDVLS 507
            RFR+AM++QGRSL  LGYRA TG  GS YA+FFN++V IAQFW+A+ PI K  ++DV  
Sbjct: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEF 513

Query: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMR 567
           FFQNY+AFP+ ++ +LGY ++ R++ L+ P  ++DL +HR+++D EVL QEE E KER+R
Sbjct: 514 FFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLR 573

Query: 568 NS 569
           NS
Sbjct: 574 NS 575

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/599 (48%), Positives = 397/599 (66%), Gaps = 38/599 (6%)

Query: 8   KFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLE---------------- 51
           ++ EKTV +T  +  Y         RRF+DSFRR + S +   +                
Sbjct: 53  EYFEKTVEKTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSS 112

Query: 52  ---DGEINSTDT------------------TKLQQRMRTRHVVMMSLGTGIGTGLLVANA 90
              D E+N   +                    L++ ++ RH VMMSLGTGIGTGLLV N+
Sbjct: 113 SQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNS 172

Query: 91  ASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV 150
             L+  GP GL+IGY ++    Y ++ A GE+AV Y  L G FN Y    +    GF+  
Sbjct: 173 KVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVA 232

Query: 151 WLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIF 210
           WLFCLQWL V PLEL+TA++ IKYW  SVN +VFVVIFY+ I+ I+ FGA+GY E +F F
Sbjct: 233 WLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFF 292

Query: 211 NMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAY 270
           N CK+LMIVGF I+ I+I+ G  G  GYIG +YWR+PG+F   TP+ + KG     VTA 
Sbjct: 293 NCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAA 352

Query: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG 330
           F+FG  E  A++ +E  NP+ AIPSA KK +YRIL V+L ++ ++GFLVP+ SD+L+G+ 
Sbjct: 353 FAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAA 412

Query: 331 SNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQ 390
            +    SPYV+A+  HGV+V+PH +NAVIL+SV+SV N A Y++ R+L +LA+QG APK 
Sbjct: 413 GSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKC 472

Query: 391 LDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFR 450
            DYIDREGRP  ++++ A+FG+IAF A+S  +E +F WL AI+GLS+LFTW +ICLSH R
Sbjct: 473 FDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIR 532

Query: 451 FRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFF 509
           FR+AMK+QGRSL  +GY++  G WGS YAV   +L  IAQFWVA+ PI    K+   SFF
Sbjct: 533 FRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFF 592

Query: 510 QNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           +NY+A P+W+ +++ Y V+ ++W+L  P DK+DL +HR ++D E+LKQE+ E+KER+RN
Sbjct: 593 ENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRN 651

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/565 (51%), Positives = 398/565 (70%), Gaps = 4/565 (0%)

Query: 7   NKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQR 66
            +F EKT  Q +    Y   + T  F+RF+ SF+R   S   D E G   +     L+Q 
Sbjct: 36  TEFFEKTSAQKS-DFEYLEGDDT-RFKRFLSSFKRAHGSGGTDTEGGGGQNAKHENLKQT 93

Query: 67  MRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAY 126
           +++RH++M+SLGTGIGTGLLV +  +LH GGPAG  IG+L++ +  Y ++ AAGE+AV Y
Sbjct: 94  IKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCY 153

Query: 127 PTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW--KVSVNANVF 184
            +L G FNAY S  I    GFAT W++CLQWL VFPLEL+TA+I IK+W    SVN +++
Sbjct: 154 TSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIY 213

Query: 185 VVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYW 244
           V IFY+ II I+FFGARGY E EF FN CKVLM++GF IVGILIN GA+G +GYIG +YW
Sbjct: 214 VAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYW 273

Query: 245 RNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRI 304
           R+PGS    T  D  KG    LV A FS G  E  AL+  E  NP+ +IP+A KK +Y+I
Sbjct: 274 RDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKI 333

Query: 305 LLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVI 364
            +V+L ++I+IGFLVP DS  LMGS  +D+H SPYV+A+ MHGV V+P  +NAVIL+SV+
Sbjct: 334 FVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSFINAVILLSVL 393

Query: 365 SVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEK 424
           SVGNSA YS+ RLL +LA+Q YAPK   YIDR GRPL+++I+  +FG I F AAS  +E+
Sbjct: 394 SVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEE 453

Query: 425 IFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNL 484
           +F WL AI+GLS+LFTW++ICLSH RFR+A+ +QG S + LG++A TG  GS  +    +
Sbjct: 454 VFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMV 513

Query: 485 LVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLD 544
           L  I QFWV+LVP+   + D  SFF  Y+A P++L+ + GY +++++W L    D++DL 
Sbjct: 514 LALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLV 573

Query: 545 THRRVYDVEVLKQEEYEFKERMRNS 569
           +HRR++D +VLKQE+ E++ ++RNS
Sbjct: 574 SHRRIFDADVLKQEDIEYRAKLRNS 598

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/571 (49%), Positives = 400/571 (70%), Gaps = 17/571 (2%)

Query: 2   SADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRRE---DTSRSGDLEDGEINST 58
           S+ S +K +E  V  +  +        TG  R F+DSFRR    D     D EDG     
Sbjct: 6   SSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGT---- 61

Query: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
            T K+++ ++TRH++M++LGTGIGTGLLV N ++L   GPAGL++GY++ S + Y+++ A
Sbjct: 62  -TAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEA 120

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178
           AGE+ + Y  + GN+ AYSS+ +    GF+  W++C+QW+TVFPL+L+TA ++I+YW   
Sbjct: 121 AGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYW-TD 179

Query: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY 238
           +N ++FV I Y  I+ I+ FGA+GY E EF FN+CKVLMI+GFVI+G++IN G  G +GY
Sbjct: 180 INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGY 239

Query: 239 IGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACK 298
           IGD+YW  P  F++G      KG  +V   A F++GG+E+  LS +E  NP+ +I SACK
Sbjct: 240 IGDKYWHEPRPFMNG-----FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACK 294

Query: 299 KGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAV 358
           K +YRI+L+YLLT +++ FLVP D   L   GS     SP V+A+  HGVK++PHI+NAV
Sbjct: 295 KVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS---RASPLVIAVSFHGVKIVPHIINAV 351

Query: 359 ILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAA 418
           ILI+V+SVGNS++YSAPRLL +LA+QGYAPK   YIDR+GRPL +  +  +FGL+AF AA
Sbjct: 352 ILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAA 411

Query: 419 SDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLY 478
           S  Q+ +F WL AI+GLS++F W SIC+SH RFR AMK QGRS+  +GY+A TG WGS  
Sbjct: 412 SPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWI 471

Query: 479 AVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPL 538
           AV    L+ IAQFWVA+ P+  K VD  SFFQ+Y+AFP+ L+ + GY +Y ++W +  P 
Sbjct: 472 AVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPA 531

Query: 539 DKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
            ++DL +HR+V+D + LKQE+ E+K ++++S
Sbjct: 532 SEVDLISHRQVFDEDELKQEDLEWKLKLKSS 562

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/566 (50%), Positives = 387/566 (68%), Gaps = 27/566 (4%)

Query: 30  GPFRRFVDSFRR------EDTSRSGDLEDG-----EINSTDTTK---------------L 63
           G  RRF+DSF+R      +  + + DLE+       +NS D  +               L
Sbjct: 83  GNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEAL 142

Query: 64  QQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMA 123
           ++ ++ RHVVM+SLGTGIGTGLLV NA +LH  GPAGL+IGY ++    Y ++ AAGEMA
Sbjct: 143 KKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMA 202

Query: 124 VAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANV 183
           V Y  L G FN Y S+ +   FGFA  W++CLQWL V PLEL+T ++ IKYW  +VN + 
Sbjct: 203 VVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDA 262

Query: 184 FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRY 243
           FVVIFY+ II I  FGARGY E EF FN CK+LMI+GF I+GI+IN G  G+ GY+G +Y
Sbjct: 263 FVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKY 322

Query: 244 WRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYR 303
           W +PG+F     + + KG     V+A F+FG  E  AL+  E  NP+ AIPSA KK +YR
Sbjct: 323 WHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYR 382

Query: 304 ILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISV 363
           ++ +++ T+ ++GFLVP DSD+LMG+G +    SPYVLAI +HGV+V+PH +NAVILISV
Sbjct: 383 VICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISV 442

Query: 364 ISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQE 423
            SV NSA YS+ RLL  LAQQGYAPK  DY+DR+GRP  ++   A+FG+IAF AAS  ++
Sbjct: 443 FSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKED 502

Query: 424 KIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFN 483
           ++F WL AI+GLS+LFTW +IC+SH RFR+AM +QGRSL  +G++A  G +GS YA    
Sbjct: 503 QVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMM 562

Query: 484 LLVFIAQFWVALVPIAKK-KVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMD 542
           +L  IAQFWVA+ PI     +D   FF+NY+A P+ +  + GY ++ R+W L      +D
Sbjct: 563 VLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDID 622

Query: 543 LDTHRRVYDVEVLKQEEYEFKERMRN 568
           LD++R+V+D E+LKQE+ E+KE+++N
Sbjct: 623 LDSYRQVFDEELLKQEDEEYKEKLKN 648

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/538 (49%), Positives = 373/538 (69%), Gaps = 29/538 (5%)

Query: 27  ESTGPFRRFVDSFRREDTSRSGDLEDGEIN--------------------STD------- 59
            +T   RRF DSF+R D     ++E  ++N                    S+D       
Sbjct: 51  HNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTG 110

Query: 60  --TTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMH 117
             +  L++ ++ RHV+M++LGTGIGTGLLV N  +L + GPAGLLIGY ++  + Y ++ 
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 118 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKV 177
           A GEMA+ Y  L G +NAY S  +   FGFA  W++CLQWL V PLEL+TA++ IKYW  
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 178 SVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTG 237
           SVN +VFV+IFY+ +I I+ FGARGY E EF FN CK+LM+ GF I+GI+I+VG  G+ G
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 238 YIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSAC 297
           +IG +YW +PG+F     +D+ KG A  LVTA F+FGG E  A++  E  NP+ AIP A 
Sbjct: 291 FIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 298 KKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNA 357
           K+ +YRIL ++L T+I++GFLVP++SD+L+GS       SPYV+A+  HGV+V+PH +NA
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINA 410

Query: 358 VILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSA 417
           VIL+SV+S+ NS+ YS+ RL   L++QGYAPK   YIDR GRPLI++ + A+F +IAF A
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCA 470

Query: 418 ASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSL 477
           AS  +E++F WL AI+GLS+LFTWT+ICLSH RFR+AMK+QGRSL  LG+++ TG WGS 
Sbjct: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSA 530

Query: 478 YAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLL 535
           YA    +L+ IAQFWVA+ PI + K+D  +FF+NY+A P+ + +++GY V+ ++W L 
Sbjct: 531 YACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLF 588

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/578 (49%), Positives = 399/578 (69%), Gaps = 15/578 (2%)

Query: 2   SADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRRED---TSRSGDLEDGEINST 58
           S +   ++ EKT  Q+     YA+  S   + RF DSF+R D   T+  G+ E  E+N +
Sbjct: 37  SIEGEAEYYEKTFSQS--DEEYAAKSSV--WHRFKDSFKRADHINTNIHGNAEL-ELNPS 91

Query: 59  DT------TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVS 112
            +        L++ ++ RHVVMMSL TGIGTGLLV N  +L  GGPAGL IGY ++    
Sbjct: 92  QSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCL 151

Query: 113 YIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVI 172
           Y ++ AAGE+AVAYPTL GNFN Y S  +     FAT  L+C+QWL VFPLE+I+A I I
Sbjct: 152 YSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITI 211

Query: 173 KYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232
           KYW  S+N NV+ VIFY+ II I+  G+ GY E +F FN CK+LM  GF I+GI+IN G 
Sbjct: 212 KYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGG 271

Query: 233 IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292
            GD+ YIG +YW +PG+F   T + + K     LVTA F+FG  E  AL+ +E  NP+ A
Sbjct: 272 AGDSVYIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKA 331

Query: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352
           IPSA K+ +YRI+ +YL ++I++GFLVP++S  LMGSGS+ VH SPYV+A+  HGVKV+P
Sbjct: 332 IPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVP 391

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
             +NAVILISV+SVGN + YS+ R+L  L++ GYAPK   Y+DR+GRPL ++I+ A+ G 
Sbjct: 392 SFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGC 451

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472
           I F +AS  +E +F WL A++GLS+LFTWT+IC+SH RFR+AM++Q RS+  LG+R+  G
Sbjct: 452 ICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVG 511

Query: 473 QWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRN 531
            WGS Y +F  +LVFI QFWVAL P+      D  +FF NY+A P++L ++ G+ ++ ++
Sbjct: 512 VWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKD 571

Query: 532 WTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
           W L  P  ++DL +HR+++D E+LKQE+ E+K +M+++
Sbjct: 572 WRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHA 609

>Kwal_33.13215
          Length = 598

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/577 (49%), Positives = 401/577 (69%), Gaps = 17/577 (2%)

Query: 2   SADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDG-------- 53
           S DSV    E+       SP   S  S G FRRF DSFRR +    G  +          
Sbjct: 19  SFDSVEVLKEE-------SPRSDS-RSDGLFRRFADSFRRHEAHNGGGGDGDDEDHEGLT 70

Query: 54  EINSTDTTK-LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVS 112
            I S    K L+Q +R RHV+M+SL TGIGTG+LV N  SLH GGPA L+IGY +VS + 
Sbjct: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130

Query: 113 YIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVI 172
           Y ++ +A E+A+ Y +L G FNAY S+ + K FGF+  W++CLQWL V PLEL+TA++ I
Sbjct: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190

Query: 173 KYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232
           KYW  ++N + FV IFY+ ++ I+F GA GY E EF FN CKVLMI+GF I+GI+IN G 
Sbjct: 191 KYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGG 250

Query: 233 IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292
            G+ GY+G RYW +PG+F     +++ KG   VLV A F++GG E   L+  E  NP+ +
Sbjct: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310

Query: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352
           I SA KK VYRIL +Y++T I++GFLVP +SD L+GSG +  H SP+V+A+  HGV+V+P
Sbjct: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
           H +NAVIL+SV+SV NSA+YS+ R+L +L++QG+AP+ L+Y+DR GRP++ L++  +FGL
Sbjct: 371 HFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472
           ++F AAS  +E +F WL AI+GLSELFTW SI LSH R R+AM +QGRS + LGY A TG
Sbjct: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490

Query: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW 532
            WG+ YA+   + + + QFWVA+ P+   K+D  +FF+NY+A P+ + ++LGY +++R+W
Sbjct: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550

Query: 533 TLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569
            LL P  ++DL  HR+++D EVL+ E+ E KE++R++
Sbjct: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHA 587

>Scas_517.2
          Length = 679

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/605 (46%), Positives = 397/605 (65%), Gaps = 43/605 (7%)

Query: 6   VNKFNEKTVVQTAYSP---SYAS-----PESTGP--FRRFVDSFRRED----------TS 45
           +  F EK+   T+ SP    Y S       +T P   R F+DSF+R +           +
Sbjct: 62  IEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTKPSRIRNFMDSFKRAEQHPTNVNNNGAN 121

Query: 46  RSGDLE------------------DGEIN-STDTTKLQQRMRTRHVVMMSLGTGIGTGLL 86
              DLE                  D +IN ++ + +L++ ++ RHV+M+SLGTGIGTGLL
Sbjct: 122 SESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLL 181

Query: 87  VANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFG 146
           V   +SL   GPAGL+IG+ ++    Y ++ A GE+AVAY  L G FNAY S  + + F 
Sbjct: 182 VGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFC 241

Query: 147 FATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFG-ARGYGE 205
           FA  WL+ +QWL V PLEL+TA++ IKYW   V+ ++FV+IFY+ II I+  G A GY E
Sbjct: 242 FAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAE 301

Query: 206 TEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYV 265
            EFIFN CK++M++GF I+GI +  G  G  GYIG +YW +PG+    T + + KG    
Sbjct: 302 AEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGALRGDTSIQRFKGCMAT 361

Query: 266 LVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDR 325
           LV A F+FG  E   ++ +E  NP+ AIPSA KK +YRIL ++L ++ ++GFLVP++SD+
Sbjct: 362 LVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQ 421

Query: 326 LMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
           L+GS  + V  SPYVLAI  HGV+V+PH +NAVILISV+SV NSA YS+ R+L +LA+QG
Sbjct: 422 LLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQG 481

Query: 386 YAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSIC 445
           YAPK   YIDREGRPL+ +   AIFG+IAF A S  ++++F+WL AI+GLS+LFTW +IC
Sbjct: 482 YAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAIC 541

Query: 446 LSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK---K 502
           +SH RFR+AM +QGRS+  LG+R+  G +GS YA     ++ IAQFWVALVPI      K
Sbjct: 542 ISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIK 601

Query: 503 VDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEF 562
           +D  +FF+NY+A P+ L  + GY ++ ++W L      +DL +HR ++D E++KQEE E+
Sbjct: 602 LDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEY 661

Query: 563 KERMR 567
           +ER+R
Sbjct: 662 RERLR 666

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  514 bits (1324), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/521 (49%), Positives = 357/521 (68%), Gaps = 14/521 (2%)

Query: 33  RRFVDSFRRE-DTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAA 91
           + F DSF+R+    R+ +LE  E N+     L + +++RH+VM+SLGTGIGTGLLV N  
Sbjct: 64  KEFFDSFKRQLPPDRNSELESQEKNN-----LTKSIKSRHLVMISLGTGIGTGLLVGNGQ 118

Query: 92  SLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVW 151
            L   GPAGL++GY + SI+ Y ++ AAGE+ + Y  L GN+  Y SI +    GFA   
Sbjct: 119 VLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSV 178

Query: 152 LFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFN 211
           ++ +QWLTV PL+L+TA + +KYW  SVNA++FV + ++F+I I+ FG+RGY E EFIFN
Sbjct: 179 VYTIQWLTVLPLQLVTAAMTVKYW-TSVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFN 237

Query: 212 MCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYF 271
            CK+LM++GFVI+ I+IN G  GD  YIG  YW NPG F  G      KG   V   A F
Sbjct: 238 SCKILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFAHG-----FKGVCTVFCYAAF 292

Query: 272 SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGS 331
           S+GG+E+  LS  E  NP  +IP+ACKK VYRILL+Y+LT I++ FLVP++SD L+GS  
Sbjct: 293 SYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSD 352

Query: 332 NDVHPS-PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQ 390
           +    + P+V+A+  HGVKV+PH +NAVILISVISV NS++YS PRLL +LA+QG  PK 
Sbjct: 353 SSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKC 412

Query: 391 LDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFR 450
           L Y+DR GRPL+   +  +FG I F A SD +E++F WL AI+ LS+LF W S+ LSH R
Sbjct: 413 LAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIR 472

Query: 451 FRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK-KVDVLSFF 509
           FR AM  QGRS+  +GY+A TG WGS  AV   +   + QFWVA+ P+ +  K++V  FF
Sbjct: 473 FRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFF 532

Query: 510 QNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVY 550
           QNY+A P+ L  + G+ +Y ++W+   P +K+DLD+HR ++
Sbjct: 533 QNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIF 573

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  509 bits (1311), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 246/514 (47%), Positives = 344/514 (66%), Gaps = 7/514 (1%)

Query: 43  DTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLL 102
           + S +G  E G   S +  KL+Q ++  HV M+++ TGIGTGLLV N  S+   G  G L
Sbjct: 51  NDSTTGKTEKGHTGS-ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTL 109

Query: 103 IGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFP 162
           +GY ++  +    M + GE+ VA+P+L G FN+Y   F+   FGF   WLFCLQW  V P
Sbjct: 110 VGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLP 169

Query: 163 LELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFV 222
           LEL+TA++ IKYW  S+N ++FV IFY  I+ I FFGARGY + EF+FN+ KVLMI GF+
Sbjct: 170 LELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFI 229

Query: 223 IVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALS 282
           I+GI+I+ GA G +GYIG +Y + PG+F      +  K     LV A FS GG+E  ALS
Sbjct: 230 ILGIIISFGAAGTSGYIGIKYLKTPGAF---NTRNTFKSICSTLVNACFSCGGVEFLALS 286

Query: 283 VNELP--NPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYV 340
             E    N   +I  AC + + R+ + Y+L++ +IG LVP++S  LMGS S  +H SPYV
Sbjct: 287 AAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYV 346

Query: 341 LAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRP 400
           +A+  HGVKV+PH++NAVILI+V+SV NSAMYS+ R L ALA+QG+AP     +D +GRP
Sbjct: 347 IAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRP 406

Query: 401 LISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGR 460
              L++  +FGL++F A   +QE +F+WL +I+GLS +FTWT IC++H RFR AMK Q  
Sbjct: 407 FRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNH 466

Query: 461 SLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNYMAFPLWL 519
           SLE LG+RA +G +GS Y +  N L  + QFWV+L P+    + D ++FFQNYMA P  L
Sbjct: 467 SLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFAL 526

Query: 520 IMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVE 553
            +++G+ +Y+R+W  + P DK+D+DT R +Y VE
Sbjct: 527 CLYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVE 560

>Scas_718.41
          Length = 614

 Score =  509 bits (1310), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 270/544 (49%), Positives = 372/544 (68%), Gaps = 13/544 (2%)

Query: 8   KFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRM 67
           + +EK +     + S +   +   F+ F  SF+R+D+    D+E         T+L + +
Sbjct: 52  EVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVE------AQDTQLSKTI 105

Query: 68  RTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYP 127
           ++RH++M+SLGTGI TGLLV N   L   GPAGL+IGY + SI+ Y ++HAAGE+ + Y 
Sbjct: 106 KSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYR 165

Query: 128 TLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVI 187
            L GNF  Y SI I    GFA   L+ LQWLTV PL+L+TA I I +W   VN ++FV+ 
Sbjct: 166 GLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDIFVLC 224

Query: 188 FYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNP 247
            ++ +I ++ FGARGY ETEF  N CK+LMI GF+I+ I+I  G  G  GYIG +YW +P
Sbjct: 225 VFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHP 284

Query: 248 GSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLV 307
           G F  G      KG   V   A FS+GG+E+  LS++E  +P +A+P+ACKK VYRILL+
Sbjct: 285 GPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKVVYRILLI 339

Query: 308 YLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVG 367
           YLLT I++ FLVP+DS  L+GS  +  H SP+V+AIE HGVKV+PH +NAVILISVISV 
Sbjct: 340 YLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHGVKVVPHFINAVILISVISVA 399

Query: 368 NSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFI 427
           NS++YS+ RLL +L++QG  P+ L++ID  GRP+   I+  +FG+I F AASD +E +F 
Sbjct: 400 NSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFT 459

Query: 428 WLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVF 487
           WL AI+GLS+LF W S+ LSH R R AMK QG+SL+ +GY+A TG WGS  AVF      
Sbjct: 460 WLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSL 519

Query: 488 IAQFWVALVPIAKK-KVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTH 546
           + QFWVA+ P+ K  ++DV++FFQNY+AFP+ L+ +LG+ +Y +NW L  P DK+DLD+H
Sbjct: 520 VTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSH 579

Query: 547 RRVY 550
           RR+Y
Sbjct: 580 RRIY 583

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 240/513 (46%), Positives = 347/513 (67%), Gaps = 8/513 (1%)

Query: 41  REDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAG 100
           +ED S   D E      ++   L+Q ++ RHV M+S+ TGIGTGLLV N  S+   G  G
Sbjct: 6   KEDCS---DAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGG 62

Query: 101 LLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTV 160
            LIGYL++ ++    M + GE+ VA+P+L G FN+Y   FI    GF   WLFCLQW+ V
Sbjct: 63  TLIGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVV 122

Query: 161 FPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVG 220
            PLEL+TA++ IKYW  +++ ++FV  FY+ I  ++FFG+ GY E EFIFN  KV+++  
Sbjct: 123 LPLELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLAS 182

Query: 221 FVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYA 280
           F+++GI+I  G +G++G IG +Y + PG+F   T  +  K TA  LV A FS GG+E  A
Sbjct: 183 FIVLGIVIITGGLGNSGPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLA 240

Query: 281 LSVNEL--PNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSP 338
           LS  E    N   +I  AC++   R+ + YLL++ ++G LVP+DS  LMGSGS+  H SP
Sbjct: 241 LSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSP 300

Query: 339 YVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREG 398
           YV AI +HGV+++PHI+NAVILI+V+SV NSAMYS+ R L +LA+Q +AP+    +++ G
Sbjct: 301 YVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHG 360

Query: 399 RPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ 458
           +P+  L++ AI GLI+F A   +QE +F+WL +I+GLS +FTWT+IC++H RFR A+KLQ
Sbjct: 361 QPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQ 420

Query: 459 GRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK-KVDVLSFFQNYMAFPL 517
           G+SL+TLGYR+ TG  GS  A   N++V I QFWV+L P+    K D + FFQNYMA P+
Sbjct: 421 GQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPV 480

Query: 518 WLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVY 550
            ++++LG+ +Y+ +WT       +D++T R VY
Sbjct: 481 AVLLYLGHKLYTNDWTPWIRTHCVDINTDRDVY 513

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/571 (41%), Positives = 355/571 (62%), Gaps = 8/571 (1%)

Query: 3   ADSVNKFNEK--TVVQTAYSPSYASP--ESTGPFRRFVDSFR--REDTSRSGDLEDGEIN 56
           A S N F+++  T V   + P  A    E T       DS    + D     D E+   +
Sbjct: 22  ASSKNPFSKQYWTEVVDGFKPGNAVEYGEHTSLKSSSFDSKENIKSDVPHVSDFENNVYD 81

Query: 57  STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMM 116
           + + +KL + +  RH++ +++G  IGTGL V + ASL+ GGPA L++ +++VS   + ++
Sbjct: 82  TANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIV 141

Query: 117 HAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK 176
           +A GE+A  +P + G FN Y + F+   FGFA    +  QW  + PLEL+ A+I I+YW 
Sbjct: 142 NALGELAAVFPVV-GGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWN 200

Query: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
            ++N++ +V IFY  I   +    + +GETEF+ +M K+L I+GF I+GI++  G     
Sbjct: 201 NTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSG 260

Query: 237 GYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSA 296
            YIG RYW +PG+FV  TP  + KG   V VTA FS+ G EL A+S  E  NP+  +P A
Sbjct: 261 EYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKA 320

Query: 297 CKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPHIV 355
            K+  + I L Y+  + +IG LVP++ +RL+ G+ S D   SP V+AIE  G+K LP ++
Sbjct: 321 SKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLM 380

Query: 356 NAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAF 415
           NA+ILI+++SV NSA+Y+  R + A+A+ G  PK+L+YID+ GRPL ++    IFGL++F
Sbjct: 381 NAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSF 440

Query: 416 SAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWG 475
            AASD QE++F WL+A++GLS LF W SI LSH RFRQAMK Q RSL  L + +ITG +G
Sbjct: 441 IAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYG 500

Query: 476 SLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLL 535
           S Y      LV IA FW +L P+     D  SFF+ Y++ P++++ +LG+ VY ++W L 
Sbjct: 501 SWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLY 560

Query: 536 NPLDKMDLDTHRRVYDVEVLKQEEYEFKERM 566
                MDLDT RR  D+++LKQE    +E+M
Sbjct: 561 VKTKDMDLDTGRREIDLDILKQEIRLEREQM 591

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  464 bits (1195), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 240/543 (44%), Positives = 359/543 (66%), Gaps = 6/543 (1%)

Query: 28  STGPFRRFVDSFRR-EDTSRSGDLEDGEINS--TDTTKLQQRMRTRHVVMMSLGTGIGTG 84
           S   ++ F DSF+R +      +L + E  +  T  T L+  ++ RH+ M+++G  IGTG
Sbjct: 48  SGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTG 107

Query: 85  LLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKP 144
           LLV +  +L  GGPA LLIG+     + Y M+ A GE+AV +P + G F  Y++ FI + 
Sbjct: 108 LLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDES 166

Query: 145 FGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFVVIFYLFIICIHFFGARGY 203
           FG+A  + + LQWL V PLE+++A+I + +W       + FV +F+L I+ I+ FG +GY
Sbjct: 167 FGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGY 226

Query: 204 GETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTA 263
           GE EF+F+  KV+ +VGF+I+GI++N G     GYIG +YW +PG+F   TP  K KG  
Sbjct: 227 GEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVC 286

Query: 264 YVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDS 323
            V VTA FSF G EL  L+ +E   P+ ++P A K+  +RI L Y+L+++MIG LVP++ 
Sbjct: 287 SVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYND 346

Query: 324 DRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQ 383
             L+G+ S D   SP+V+AI+ HG+K LP +VN VILI+V+SVGNSA+Y+  R + ALA+
Sbjct: 347 KSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAE 406

Query: 384 QGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTS 443
           Q + P+   Y+DR+GRPL+ + + + FGLIAF AAS  + ++F WL A++GLS LFTW  
Sbjct: 407 QRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGG 466

Query: 444 ICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKV 503
           IC+ H RFR+A+  QGR L+ L +++ TG WGS + +F  +++FIAQF+VA+ P+     
Sbjct: 467 ICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSP- 525

Query: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563
               FF+ Y++FPL ++M++G+ +Y RNW L  P +KMD+DT RR  D+++LKQE  E K
Sbjct: 526 SAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

Query: 564 ERM 566
             M
Sbjct: 586 AIM 588

>Kwal_27.12681
          Length = 593

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 239/558 (42%), Positives = 353/558 (63%), Gaps = 19/558 (3%)

Query: 16  QTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTK---------LQQR 66
           +T  SP   +  S   ++ F D F+R +      LE+ + N T+  K         LQ+ 
Sbjct: 28  ETGSSPG-QTQASKSRWQDFKDGFKRVE------LEELDPNLTEAEKIAIITAQSPLQRH 80

Query: 67  MRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAY 126
           ++ RH+ M+++G  IGTGL V +  +L  GGPAG+LIG+ L+ ++ Y ++ + GE+AV +
Sbjct: 81  LKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTF 140

Query: 127 PTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFV 185
           P + G F  Y++ F+ + FGFA  + + LQWL V PLE++ A+I + +W       + FV
Sbjct: 141 P-VSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFV 199

Query: 186 VIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWR 245
            +FY+ I+ I+FFG RGYGE EF+F+  KV+ ++GF+I+GI++  G     GYIG +YW 
Sbjct: 200 ALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWH 259

Query: 246 NPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRIL 305
           NPG+F       + KG   V VTA FSF G EL  L+  E  NP+ A+P A K+  +RIL
Sbjct: 260 NPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRIL 319

Query: 306 LVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVIS 365
           L Y++++ +IG LVPH S+RL+G+ S D   SP+VLAI+ HG+K LP ++N VILISV+S
Sbjct: 320 LFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVILISVLS 379

Query: 366 VGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKI 425
           VGNSA+Y+  R + ALA+QG  P    YIDR+GRPL+++I   +FGL++F A S+ +  +
Sbjct: 380 VGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDV 439

Query: 426 FIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLL 485
           F WL A++GLS LF+W +IC+ H RFR+A+  QGRS + L + +  G  GS + V   LL
Sbjct: 440 FNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLL 499

Query: 486 VFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDT 545
           V IAQFWVA+ PI     +   FF  Y++FP+ L  ++ + ++ RNW L      +D+DT
Sbjct: 500 VLIAQFWVAVWPIGGSP-NAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDT 558

Query: 546 HRRVYDVEVLKQEEYEFK 563
            RR  D E L+QE  E K
Sbjct: 559 GRREMDTEALRQEIAEEK 576

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  457 bits (1176), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 354/539 (65%), Gaps = 6/539 (1%)

Query: 32  FRRFVDSFRREDTSR-SGDLEDGE--INSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVA 88
           +R+F DSF+  D +  + D+ D E   + T    L+  ++ RH+ M+++G  IGTGL V 
Sbjct: 47  WRKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVG 106

Query: 89  NAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFA 148
           +  +L   GPAG+LIG+ L   + Y M+ A GE++V +P + G F  Y++ FI + FGFA
Sbjct: 107 SGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFA 165

Query: 149 TVWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFVVIFYLFIICIHFFGARGYGETE 207
             + + LQWL V PLE++ A+I + YW       + FV +F++ I+ I+ FG +GYGE E
Sbjct: 166 NNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAE 225

Query: 208 FIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLV 267
           F+F++ KVL ++GF+I+GI++N G   + GYIG +Y+ +PG+FV  T   + +G   V V
Sbjct: 226 FVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFV 285

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327
           TA FSF G EL  ++  E   P+ ++P A K+  +RI L Y+L+++M+G LVP+  +RL+
Sbjct: 286 TAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLI 345

Query: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387
           G+ S D   SP+V+AI  HG++ LP +VN VILI+V+SVGNSA+Y   R LCALAQQ + 
Sbjct: 346 GASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFL 405

Query: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           PK   YIDR GRPL  +   + FGL+AF A S  + ++F WL A++GLS LFTW  IC  
Sbjct: 406 PKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFC 465

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507
           H RFR A+  QGRS + L ++A  G +GS++ +F  +L+F+AQF+VAL P   K      
Sbjct: 466 HIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKP-SAEV 524

Query: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERM 566
           FFQ+Y++FP+ L  + G+ +Y+RNW LL PL K+D+DT RR  D++VL+QE  E K+ M
Sbjct: 525 FFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMM 583

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  452 bits (1163), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 242/553 (43%), Positives = 352/553 (63%), Gaps = 12/553 (2%)

Query: 16  QTAY-SPSYASPESTGPFRRFVDSFRREDTSR-SGDLEDGEINS--TDTTKLQQRMRTRH 71
           Q +Y S S ASP     + RF DSF+R DT     +L D E  +  T    L++ +++RH
Sbjct: 25  QNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRH 84

Query: 72  VVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPG 131
           + M+++G  IGTGL V +  +L   GPAG+LIG+ L   + Y M+ A GE+AV +P + G
Sbjct: 85  LQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAG 143

Query: 132 NFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFVVIFYL 190
            F  Y+S F+ + FGFA   ++ LQWL V PLE++ A+I + YW       + FV +FY+
Sbjct: 144 GFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYV 203

Query: 191 FIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF 250
            I+ I+FFG +GYGE EFIF+  KV+ ++G++I+G+++  G     GYIG R W NPG+F
Sbjct: 204 VIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAF 263

Query: 251 VSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLL 310
            +G      KG   V VTA FSF G EL  L+  E  NP+ ++PSA K+  +RI L Y+L
Sbjct: 264 ANG-----FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYIL 318

Query: 311 TMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSA 370
            ++M+G LVP+ SDRL+G  S D   SP+V++I+  G+K LP ++N VILI+V+SVGNSA
Sbjct: 319 ALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSA 378

Query: 371 MYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLA 430
           +++  R + ALA QG  PK   YIDR GRPL+ +I+  +FGL++F AAS  + ++F WL 
Sbjct: 379 VFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLL 438

Query: 431 AIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQ 490
           A++GLS LFTW  I L H R R+A+  Q R+   L + A TG WGS+Y     +L+ +AQ
Sbjct: 439 ALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQ 498

Query: 491 FWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVY 550
           FW+AL PI  K     +FF+ Y++FP+ +  ++G+ ++ +NW L      +D+DT RR  
Sbjct: 499 FWIALFPIGDKP-SASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRET 557

Query: 551 DVEVLKQEEYEFK 563
           D+E LKQE  E K
Sbjct: 558 DIEALKQEIAEEK 570

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 223/547 (40%), Positives = 342/547 (62%), Gaps = 9/547 (1%)

Query: 20  SPSYASPESTGPFRRFVDSFRREDTSR-SGDLEDGEINS--TDTTKLQQRMRTRHVVMMS 76
            P    PE    +  FVD+FRR +      +L + E  +  T    L +R++ RH+ M++
Sbjct: 37  EPISVQPEPRKGWNGFVDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIA 96

Query: 77  LGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAY 136
           +G  IG GL V +  +L   GPAG+LIG+ L + +  IM  + GE+AV +P + G +  Y
Sbjct: 97  IGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITY 155

Query: 137 SSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANV-FVVIFYLFIICI 195
           ++ FI + +GFA  + + +Q + V PLE++ A++ + YW       + FV +F++ I+ I
Sbjct: 156 AARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSI 215

Query: 196 HFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTP 255
           + FG RG+GE E IF++ KV+ I+GF+I+G+++  G   D   IG +YW +PG FV   P
Sbjct: 216 NLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAP 275

Query: 256 LDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMI 315
            DK KG   V VTA FSF G EL  L+  E   P+ +IP A K+  +RI L Y+L+++++
Sbjct: 276 SDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIV 335

Query: 316 GFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAP 375
           G LVP +++ L+     D   SP+V+A++MH ++VLP I+N VIL +VISVGNS++YS+ 
Sbjct: 336 GLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSS 395

Query: 376 RLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGL 435
           R +CALA+ G+ PK   YIDR+GRPL ++   ++FGL+ F A +  + +IF WL AI+GL
Sbjct: 396 RTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGL 455

Query: 436 SELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVAL 495
           S  FTW +I L+H RFR A+K QGR+   L + + TG  GS YAV    +V +AQFWVAL
Sbjct: 456 SSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVAL 515

Query: 496 VPIA----KKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYD 551
            P +      K   + FF+ Y++F + ++M+L + ++SRNW       +MD+DT RR  D
Sbjct: 516 YPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELD 575

Query: 552 VEVLKQE 558
           +E+ K+E
Sbjct: 576 LELFKEE 582

>Kwal_33.15407
          Length = 587

 Score =  442 bits (1136), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 217/528 (41%), Positives = 335/528 (63%), Gaps = 10/528 (1%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           E TS + D ED   N        + +  RH++ +++G  IGTGL V + ++L  GGP  L
Sbjct: 57  ESTSGTSDAEDSRYN--------KDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSL 108

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           +I ++++S   + +++A GE++  +P + G FN Y S F+   FGFA    +  QW  + 
Sbjct: 109 VIDWVIISTCLFTIVNALGELSSTFPVV-GGFNVYISRFVEPSFGFAVNLNYLAQWAVLL 167

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
           PLEL+ A++ I+YW  ++N++ +V IFY  I   +    + +GETEF+ +M K+L I+GF
Sbjct: 168 PLELVAASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGF 227

Query: 222 VIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYAL 281
            I+GI++  G   + GYIG +YW NPG+FV  T   +  G   V VTA FS+ G EL A+
Sbjct: 228 TILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAV 287

Query: 282 SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYV 340
           S  E  NP+  +P ACK+  + I + Y++ + ++G LVP D  RL+ GS S DV  SP V
Sbjct: 288 SAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLV 347

Query: 341 LAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRP 400
           +AIE  G+K LP ++NA+ILI+V+SV NSA+Y+  R + ++A+ G  PK   Y+DR+GRP
Sbjct: 348 IAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRP 407

Query: 401 LISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGR 460
           L +++   IFGL++F AAS+ QE +F WL+A++GLS LF W +I +SH RFR  MK +GR
Sbjct: 408 LYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGR 467

Query: 461 SLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLI 520
           SL+ L + ++TG WGS Y      +V +  FW AL P  +      SFF+ Y++FP+ L+
Sbjct: 468 SLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLV 527

Query: 521 MFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
            ++G+ +Y+++W LL P  ++D+D+ RR  D+EVLK E+   ++ MR 
Sbjct: 528 CYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMRE 575

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  439 bits (1128), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/530 (40%), Positives = 335/530 (63%), Gaps = 5/530 (0%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
            D +R+  ++     +    +L+Q ++  HV MMS  TGIGTGLLV N  S+   G  G 
Sbjct: 16  SDPTRTNSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGT 75

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           L+GYL++ I+    M   GE+ VA+P++PG F +Y   FI    GF   WLF L W  V 
Sbjct: 76  LVGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVL 135

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
           PLE+  A++ I +W  ++N ++ V + Y  +  ++FFGAR Y + + IFN  KVLMI+GF
Sbjct: 136 PLEICVASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGF 195

Query: 222 VIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYAL 281
           +I+GI +N G +G +GY+G +Y+ +PG F +   L   K  A  L+TA FS GG E  AL
Sbjct: 196 IILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVAL 253

Query: 282 SVNE--LPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPY 339
           S  E    +   +I  A  + V RI +++ +++++IG LVP +S  LMGSGS   H SPY
Sbjct: 254 SCAEQNTEDMPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPY 313

Query: 340 VLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGR 399
           V+A+  +GV+++PHIVNA+IL+S+ISV N+AMYS+ R L +LA+QG+A K    +D  G+
Sbjct: 314 VVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGK 373

Query: 400 PLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQG 459
           P   L + A  GL +F A   +QE +F+WL +I+GLS +FTW+  C+SH RFR+AMK Q 
Sbjct: 374 PFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQD 433

Query: 460 RSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNYMAFPLW 518
           ++L+ LGY++  G +GS  ++F   ++ I QFWV+L P+ +  +++V+SF QNYMA P+ 
Sbjct: 434 QALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPIT 493

Query: 519 LIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           ++++LG+  Y+ NW       ++D+ T R +Y V+ +  ++  F E + +
Sbjct: 494 IVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIYCVDEVTGKKSVFVELLDS 543

>Kwal_33.14276
          Length = 596

 Score =  438 bits (1127), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 224/541 (41%), Positives = 344/541 (63%), Gaps = 12/541 (2%)

Query: 33  RRFVDSFRR---EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89
             FVD FR    +D   +    +    +T  + L++ ++ RH+ M+++G  IGTGL V +
Sbjct: 51  HNFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGS 110

Query: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149
             +L  GGPA +++ ++L   + Y ++ A GE+ VA P + G++ +Y S FI   FGFA 
Sbjct: 111 GKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDPSFGFAI 169

Query: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFVVIFYLFIICIHFFGARGYGETEF 208
            + + +  L   PLE++ A+I + YW V    A+ FV +FY+ ++ I+F G +GYGE EF
Sbjct: 170 AYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEF 229

Query: 209 IFNMCKVLMIVGFVIVGI-LINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLV 267
           +F++ KVL IVGF+I+GI L+  G   +TGYIG +YW NPG F  G      KG A + V
Sbjct: 230 VFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG-----FKGFAAIFV 284

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327
           T+ FSF G E++AL   E  NP+  +P A K+  +RI L YL+++ +IG LVP+ +  L 
Sbjct: 285 TSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLF 344

Query: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387
            S S D   SP+V+AI+  G+  LP ++N VIL++V+SVGN+ ++++ R   +LA  GY 
Sbjct: 345 ASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYL 404

Query: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           PK+  Y+DR+GRPL  LIL  +FGL++F ++S ++  +F W+ A++GL   FTW SIC+ 
Sbjct: 405 PKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVC 464

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507
           H RFRQ ++ QGRS + L ++A TG WGS+Y +    +V   QFWVAL P++K       
Sbjct: 465 HLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSP-SAYH 523

Query: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMR 567
           FF+ Y++ P+ ++ ++G+ VYSRNW L+ P  ++DLDT RR  D+E+LKQE  E  E +R
Sbjct: 524 FFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIR 583

Query: 568 N 568
           +
Sbjct: 584 S 584

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  429 bits (1104), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 220/517 (42%), Positives = 330/517 (63%), Gaps = 10/517 (1%)

Query: 37  DSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYG 96
           D FRR +     D E  +IN+T+   L + +  RH++ +++G  IGTGL V   A+L  G
Sbjct: 68  DRFRRNE-----DTEQEDINNTN---LSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTG 119

Query: 97  GPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQ 156
           GPA L+I ++++S   + ++++ GE++ A+P + G FN YS  FI   F FA    +  Q
Sbjct: 120 GPASLVIDWVIISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFAFAVNLNYLAQ 178

Query: 157 WLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVL 216
           WL + PLEL+ A+I IKYW   +N++ +V IFY  I   +    + +GETEF+ +M K+L
Sbjct: 179 WLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKIL 238

Query: 217 MIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGM 276
            I+GF I+GI+++ G     GYIG +YW +PG+FV  +   + KG   V VTA FS+ G+
Sbjct: 239 SIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGI 298

Query: 277 ELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVH 335
           E+ A+S  E  NP+  IP A K+  + I   Y+  + +IG LVP +  RL+ GS S D  
Sbjct: 299 EMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAA 358

Query: 336 PSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYID 395
            SP V+AIE  G+K LP ++NA+ILI+V+SV NSA+Y+  R + A+A  G  PK L+ +D
Sbjct: 359 SSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVD 418

Query: 396 REGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAM 455
           + GRP+ +++L   FGL++F AASD Q ++F WL+A++GLS +F W +I LSH RFRQAM
Sbjct: 419 KRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAM 478

Query: 456 KLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAF 515
           K+Q RSL+ L + + TG  GS Y      LV IA FW +L P+        SFF+ Y++F
Sbjct: 479 KVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSF 538

Query: 516 PLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDV 552
           P+ ++ ++G+ +Y+RNWTL+  L+ MDLDT R+  D+
Sbjct: 539 PILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDL 575

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  425 bits (1092), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 221/556 (39%), Positives = 340/556 (61%), Gaps = 22/556 (3%)

Query: 25  SPESTGPFRRFVDSFRRED---TSRSGDLEDGEIN-----------------STDTTKLQ 64
           SP+    + R ++ F+R D   T+RS    D E++                 + ++++L 
Sbjct: 51  SPQKDVWYTRLLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLS 110

Query: 65  QRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAV 124
           + +  RH++ +++G  IGTGL V + ASL+ GGP  +LI + L+S   + ++++ GE+A 
Sbjct: 111 KNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELAS 170

Query: 125 AYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVF 184
           A+P + G FN Y + F+   FGFA    +  QW  + PLEL  A+I IKYW   +N++ +
Sbjct: 171 AFPVV-GGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAW 229

Query: 185 VVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYW 244
           V IFY+ I   +    + +GETEF+ +M K+L I GF I+G ++  G     G+IG +YW
Sbjct: 230 VAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYW 289

Query: 245 RNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRI 304
            +PG+FV  TP  + KG   V VTA FS+ G EL  +S  E  NP+  IP A K+  + I
Sbjct: 290 HDPGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLI 349

Query: 305 LLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISV 363
              YLL + + G LVP +  RL+ G  S DV  SP V+AIE  G++ +P ++NA+ILI++
Sbjct: 350 TSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAI 409

Query: 364 ISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQE 423
           ISV NS++Y+  R + ++AQ G  PK  +YIDR+GRPL++++   +FGL++F AASD QE
Sbjct: 410 ISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQE 469

Query: 424 KIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFN 483
            IF WL+A++GLS LF W +I +SH RFR+AM  Q RSL+ L Y ++TG  GS Y     
Sbjct: 470 AIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVL 529

Query: 484 LLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDL 543
           L V +  FW +L P         SFF+ Y++FP++LI ++ + +Y R+W L  P  ++D+
Sbjct: 530 LFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDV 589

Query: 544 DTHRRVYDVEVLKQEE 559
           D+ RR  D+E LK+++
Sbjct: 590 DSGRRALDIEELKEQK 605

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  423 bits (1088), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 213/498 (42%), Positives = 320/498 (64%), Gaps = 2/498 (0%)

Query: 55  INSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYI 114
           +   + T L + +  RH++ +++G  IGTGL V + ASL  GGPA L+IG+++VS   + 
Sbjct: 80  VEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFT 139

Query: 115 MMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKY 174
           ++++ GE+A A+P + G FN Y + FI   F FA    +  QWL + PLEL+ A+I I+Y
Sbjct: 140 VINSLGELAAAFPVV-GGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRY 198

Query: 175 WKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIG 234
           W   +N++ +V IFY  I   +    + +GETEFI +M K+L I+GF I+GI++  G   
Sbjct: 199 WNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGP 258

Query: 235 DTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIP 294
             GYIG +YW NPG+FV  +   + KG   V VTA FS+ G+E+ A+S  E  NPK  IP
Sbjct: 259 HGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIP 318

Query: 295 SACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPH 353
            A K+  + I + Y+  + +IG LVP++  RL+ GS S D   SP V+AIE  G+K LP 
Sbjct: 319 KAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPS 378

Query: 354 IVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLI 413
           ++NA+ILI+++SV NSA+Y+  R + ++A  G  PK L  +D+ GRPL +++L   FGL+
Sbjct: 379 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLL 438

Query: 414 AFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQ 473
           +F AASD QE++F WL+A++GLS +F W +I LS  RFR AMK QGRSL+ + + + +G 
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGT 498

Query: 474 WGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWT 533
           WG+ Y V    LV +A FW +L P+        SFF+ Y++ P+ +  ++G+ ++ R+W 
Sbjct: 499 WGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWR 558

Query: 534 LLNPLDKMDLDTHRRVYD 551
           LL PL +MDLD+ RRV D
Sbjct: 559 LLVPLMEMDLDSGRRVLD 576

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 211/547 (38%), Positives = 340/547 (62%), Gaps = 3/547 (0%)

Query: 22  SYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGI 81
           S+A  E+    ++       +D +   D+E    N+ D+ KL + +  RH++ +++G  I
Sbjct: 24  SFAKEETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDS-KLNKDLSIRHLLTLAVGGAI 82

Query: 82  GTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFI 141
           GTGL V +  SL  GGPA L+I + ++S   + ++++ GE++  +P + G FN Y + F+
Sbjct: 83  GTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVV-GGFNVYVTRFV 141

Query: 142 SKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGAR 201
              FGFA  + +  QW  + PLEL  A+I I+YW  S+N + +V IFY+ I   +    +
Sbjct: 142 EPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVK 201

Query: 202 GYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKG 261
            +GETEF+ +M K+L I+GF I+GI++  G     G+IG +YW +PG+FV  TP  + KG
Sbjct: 202 SFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKG 261

Query: 262 TAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPH 321
            + V +TA FS+ G+EL  +S  E  NP+  +P A K+  + I + YL+ + +IG LVP 
Sbjct: 262 LSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPS 321

Query: 322 DSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCA 380
           +   L+ G+ S D   SP V+AI+  G+K LP ++NA+ILI+++SV NSA+Y+  R + +
Sbjct: 322 NDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIIS 381

Query: 381 LAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFT 440
           +A+ G  P+ L ++D++GRPL ++ +  + GL++F AAS+ ++++F WL+A++GLS LF 
Sbjct: 382 MAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFC 441

Query: 441 WTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAK 500
           W +I L+H RFR AMK Q RSLE L Y ++TG+WGS Y      LV IA FW +L P   
Sbjct: 442 WFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGG 501

Query: 501 KKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEY 560
              D  SFF++Y++ P+++  +LG+ ++ RN  L   L ++D+D+ R   D   LKQE+ 
Sbjct: 502 NGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKE 561

Query: 561 EFKERMR 567
              E M+
Sbjct: 562 AEAELMK 568

>Scas_607.4
          Length = 599

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/554 (40%), Positives = 340/554 (61%), Gaps = 30/554 (5%)

Query: 23  YASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIG 82
           Y  P +   F+R +DSF+           DG   S DT  L++ ++ RH++M+++G  IG
Sbjct: 58  YQPPRNI--FQRCIDSFKPP--------LDG---SFDTNNLKRSLKARHLIMIAIGGSIG 104

Query: 83  TGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFIS 142
           TGL V +  ++  GGP  ++IG+ +        +H  GE+ V +P + G F  YS+ F+ 
Sbjct: 105 TGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYSTRFLD 163

Query: 143 KPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARG 202
               F    ++ +QW  V PLE+I++ + ++YW  S++  V+V IFY  I+ I+ FGARG
Sbjct: 164 PSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARG 223

Query: 203 YGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGT 262
           +GE EF+F+  KVL I GF+I+ I++  G   D  ++G +YW +PG    G P     G 
Sbjct: 224 FGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLAHGFP-----GV 278

Query: 263 AYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHD 322
             VLV A +S GG E+  L+  E  +PK  +PSA K+  +RIL  +L+++ +IGFLVP+ 
Sbjct: 279 LSVLVVASYSLGGTEMVCLASGE-TDPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVPYT 336

Query: 323 SDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALA 382
           ++ L+G  S  V+ SP+V+AI++H +KVLP IVNAVILIS++SVGNS ++++ R LC++A
Sbjct: 337 NENLLGGSS--VNNSPFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMA 394

Query: 383 QQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWT 442
            QG  P+   YIDR GRPL  +I  ++FGL+AF   S +  ++F WL AIAGL+    W 
Sbjct: 395 HQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWL 454

Query: 443 SICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIA--- 499
           SI +SH RFR AMK QGRSL+ L + +  G WGS Y+   N L+ +AQF+ AL PI    
Sbjct: 455 SINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWE 514

Query: 500 KKKVDVLSFFQNYMAFPLWLIMFLGYMVYSR----NWTLLNPLDKMDLDTHRRVYDVEVL 555
              +    FFQ+Y+   + +++F+G+ ++ R     W  + PL+K+DL+T R+  D+E+L
Sbjct: 515 NSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEIL 574

Query: 556 KQEEYEFKERMRNS 569
           KQE  E    +R S
Sbjct: 575 KQEIAERNRHLRAS 588

>Scas_479.1
          Length = 595

 Score =  419 bits (1077), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/565 (39%), Positives = 340/565 (60%), Gaps = 21/565 (3%)

Query: 14  VVQTAYSPSYASPESTGPFRRFVDSFRRE------DTSRSGDLEDG-------EINSTDT 60
           V+    +P     E  G     V SF         + S+   +ED         +   D 
Sbjct: 15  VIDGFRAPDEEGEEGIGRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQSSVTKEDI 74

Query: 61  TK-LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAA 119
            K L + +  RH++ +++G  IG GL V + A+L  GGPA L+I ++++S   + ++++ 
Sbjct: 75  NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSL 134

Query: 120 GEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSV 179
           GE+A A+P + G FN Y + F+   F FA    +  QWL + PLEL+ A+I IKYW  ++
Sbjct: 135 GELAAAFPVV-GGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTI 193

Query: 180 NANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYI 239
           N++ +V IFY  I   +    + +GETEF+ +M K+L I+GF I+GI+++ G     GY+
Sbjct: 194 NSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYL 253

Query: 240 GDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKK 299
           G +YW NPG+FV  T   K KG   V VTA FS+ G+E+ A+S  E  +P+  IP A K+
Sbjct: 254 GGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKR 313

Query: 300 GVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAV 358
             + I   Y+  + ++G LVP+D  RLM G+ S D   SP V+AIE  G+K L  ++NA+
Sbjct: 314 TFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAI 373

Query: 359 ILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAA 418
           ILIS+ISV NSA+Y+  R + ++A  G  PK+L  +D+ GRP+ + ++   FGL++F AA
Sbjct: 374 ILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAA 433

Query: 419 SDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLY 478
           SD Q ++F WL+A++GLS +F W +I +SH RFRQAM  Q RSL+ + Y + TG WGSLY
Sbjct: 434 SDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLY 493

Query: 479 AVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPL 538
            V    LV +A FW +L P+     DV SFF+ Y++ P+ ++ ++G+ +Y +NW+ +  L
Sbjct: 494 GVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTL 553

Query: 539 DKMDLDTHRRVYD-----VEVLKQE 558
           ++MDLDT R+  D      EVL +E
Sbjct: 554 EEMDLDTGRKALDPHLHRAEVLAEE 578

>Scas_507.1
          Length = 592

 Score =  414 bits (1064), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/500 (42%), Positives = 312/500 (62%), Gaps = 2/500 (0%)

Query: 56  NSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIM 115
           +  +   L + +  RH++ +++G  IG GL V + A+L  GGPA L+I ++++S   + +
Sbjct: 68  DDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTV 127

Query: 116 MHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW 175
           ++A GEMA A+P + G FN Y + FI    GFA    +  QWL + PLEL+ A++ IKYW
Sbjct: 128 INALGEMAAAFPVV-GGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW 186

Query: 176 KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGD 235
             ++N++ +V IFY  I   +    + +GETEF+ +M K+L I+GF I+GI++  G    
Sbjct: 187 NETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPH 246

Query: 236 TGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPS 295
            G+IG +YW +PGSFV      K KG   V VTA FS+ G+E+ A+S  E  +P+T IP 
Sbjct: 247 GGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPK 306

Query: 296 ACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGVKVLPHI 354
           A K+  + I   Y+  + +IG LVP+D  RL+ G+ S D   SP V+AIE  G+K LP +
Sbjct: 307 AAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSL 366

Query: 355 VNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIA 414
           +NA+ILIS+ISV NSA+Y+  R + A+A  G  P+ L+ +D +GRP+ ++I    FGL++
Sbjct: 367 MNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLS 426

Query: 415 FSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQW 474
           F AASD Q  +F WL+A++GLS +F W +I LSH RFRQ+M  Q RSL+ L + + TG W
Sbjct: 427 FVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVW 486

Query: 475 GSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTL 534
           GS Y      LV +A FW +L P+     D  SFF+ Y++FP+ L  + G+ +Y R    
Sbjct: 487 GSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREF 546

Query: 535 LNPLDKMDLDTHRRVYDVEV 554
           +  L  MDLDT RR  D++V
Sbjct: 547 MVGLADMDLDTGRRQVDLDV 566

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  413 bits (1061), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/536 (42%), Positives = 338/536 (63%), Gaps = 11/536 (2%)

Query: 32  FRRFVDSFRREDT-SRSGDLEDGEINS--TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVA 88
           + RF DSFR  +T      L   E  +  T    L++ +++RH+ M+ +G  IGTGL V 
Sbjct: 42  WERFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVG 101

Query: 89  NAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFA 148
           +  SL   GPAG+LIG+ L   + Y M+ A GE+AV +P + G +  Y+S F+ + FGFA
Sbjct: 102 SGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGGYTTYASRFVDESFGFA 160

Query: 149 TVWLFCLQWLTVFPLELITATIVIKYWKVSVN-ANVFVVIFYLFIICIHFFGARGYGETE 207
              ++ + WL   PLE++ A+I + YW       + FV +FY+ I+ I+ FG +GYGE E
Sbjct: 161 FNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAE 220

Query: 208 FIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLV 267
           FIF+  KV+ ++GF+I+G+++  G     GYIG R W NPG+F +G      KG   V V
Sbjct: 221 FIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-----FKGVCSVFV 275

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327
           TA FSF G EL  L+  E  NP+ +IPSA K+  +RI L Y+L ++M+G LVP+ SDRL+
Sbjct: 276 TAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLI 335

Query: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387
           G  S D   SP+V++I+  G+K LP ++N VILI+V+SVGN A++   R + ALA QG  
Sbjct: 336 GQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSL 395

Query: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           PK   YIDR GRPL+ +++  +FGL++F AAS  + ++F WL A++GLS LFTW  I L 
Sbjct: 396 PKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLC 455

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507
           H R R+A+  Q R+   L + A T  WGS+Y++   +L+ IAQFW+AL PI  K     +
Sbjct: 456 HIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKP-SAAA 514

Query: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563
           FF+ Y++FP++++ ++G+ ++ +NW L      +D+D+ RR  D+E LKQE  E K
Sbjct: 515 FFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEK 570

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  406 bits (1044), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/585 (38%), Positives = 344/585 (58%), Gaps = 42/585 (7%)

Query: 5   SVNKFNEKTVVQTA-------YSPSYASPESTGP-------FRRFVDSFRREDTSRSGDL 50
           S  +F E+    T+         P Y+S ES  P       F+R VDSF+          
Sbjct: 2   STKEFKEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQRCVDSFKPP-------- 53

Query: 51  EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110
            DG   S DT+ L++ +++RH++M+++G  IGTGL + +  +L  GGP  ++IG+ +   
Sbjct: 54  VDG---SFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGS 110

Query: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170
                +H  GE+ V +P + G F  YS+ F+     F    ++ +QW  V PLE+I + I
Sbjct: 111 QIVGTIHGLGEITVRFPVV-GAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAI 169

Query: 171 VIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230
            I+YW  S++  V+V IFY  I+ I+ FGARG+GE EF+F+  K + I GF+I+ I++  
Sbjct: 170 TIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLIC 229

Query: 231 GAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPK 290
           G   D  +IG +YW +PG+   G P     G   VLV A +S GG E+  L+  E  +PK
Sbjct: 230 GGGPDHEFIGAKYWHDPGALAHGFP-----GVLSVLVVASYSLGGTEMTCLASGE-TDPK 283

Query: 291 TAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKV 350
             +PSA K+  +RIL  +L ++ ++GFLVP+ ++ L+G  S D   SP+V+AI++H +K 
Sbjct: 284 E-LPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVD--NSPFVIAIKLHHIKA 340

Query: 351 LPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIF 410
           LP IVNAVILIS++SVGNS ++++ R LC++A QG  P+   YIDR GRPL  ++  ++F
Sbjct: 341 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLF 400

Query: 411 GLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAI 470
           GL+AF   S +  ++F WL AIAGL+    W SI LSH RFR AMK Q ++L+ L + + 
Sbjct: 401 GLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSA 460

Query: 471 TGQWGSLYAVFFNLLVFIAQFWVALVPIA---KKKVDVLSFFQNYMAFPLWLIMFLGYMV 527
            G WGS Y+   N+L+ IAQF+++L PI            FFQ+Y+   + L++F  + V
Sbjct: 461 VGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKV 520

Query: 528 YSR----NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           Y R     W  + PL  +DL+T R+  D++V+K E  E K  ++ 
Sbjct: 521 YYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  401 bits (1030), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 215/541 (39%), Positives = 329/541 (60%), Gaps = 32/541 (5%)

Query: 32  FRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAA 91
           F+R VDSF+           DG   S DT+ L++ ++ RH++M+++G  IGTGL V +  
Sbjct: 58  FQRCVDSFKSP--------LDG---SFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGK 106

Query: 92  SLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVW 151
           ++  GGP G++IG+ +        +H  GE+ V +P + G F  Y + F+     F    
Sbjct: 107 AIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPSISFVVST 165

Query: 152 LFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFN 211
           ++ LQW  V PLE+I A + ++YW  S++  ++V IFY  I+ I+ FG RG+GE EF F+
Sbjct: 166 IYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFS 225

Query: 212 MCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYF 271
             K + + GF+I+ +++  G   D  +IG +YW +PG   +G P     G   VLV A +
Sbjct: 226 TIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANGFP-----GVLSVLVVASY 280

Query: 272 SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGS 331
           S GG+E+  L+  E  +PK  +PSA K+  +RIL  +L+++ ++GFLVP+ +  L+G  S
Sbjct: 281 SLGGIEMTCLASGE-TDPK-GLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS 338

Query: 332 NDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQL 391
            D   SP+V+AI++H +K LP IVNAVILISV+SVGNS ++++ R LC++A QG  P   
Sbjct: 339 VD--NSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWF 396

Query: 392 DYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRF 451
            YIDR GRPL+ ++  ++FGL+AF   S +  ++F WL AIAGL+    W SI LSH RF
Sbjct: 397 GYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRF 456

Query: 452 RQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-----AKKKVDVL 506
           R AMK QG+SL+ L + +  G WGS Y+   N L+ IAQF+ +L PI      K++  + 
Sbjct: 457 RLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKI- 515

Query: 507 SFFQNYMAFPLWLIMFLGYMVYSR----NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEF 562
            FFQNY+   + L +F+ + +Y +     W  +  L  +DL+T R+  D+E++KQE  E 
Sbjct: 516 -FFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEK 574

Query: 563 K 563
           K
Sbjct: 575 K 575

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  403 bits (1035), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/536 (39%), Positives = 337/536 (62%), Gaps = 28/536 (5%)

Query: 30  GPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89
           G  RR +DSF+           DG   S D   L++ +++RH++M+++G  IGTGL + +
Sbjct: 203 GLVRRCIDSFKPP--------VDG---SFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGS 251

Query: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149
             +L  GGP  +LIG+ L        +H  GE+ V +P + G F  YS+ F+     F  
Sbjct: 252 GKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVV-GAFANYSTRFLDPSVSFVV 310

Query: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209
             ++ LQW  V PLE+I + I +++W  SV+  V+V +FY  II I+ FG R +G+ +F+
Sbjct: 311 SSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFV 370

Query: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTA 269
           F++ K++ I GF+I+ +++ +G      +IG RYW +PG+  +G      KG A V+VTA
Sbjct: 371 FSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALANG-----FKGVAAVMVTA 425

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            +S GG E+  L+  E  +PK  IP A K+  +RI+  +L+++ ++GFLVP+ +D+L+G 
Sbjct: 426 SYSLGGSEMTCLASGET-DPK-EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG- 482

Query: 330 GSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPK 389
           GSN V+ SP+V+AI+MH ++VLPHI+N VIL+S++SVGNS ++++ R LC++A QG  P+
Sbjct: 483 GSN-VNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPR 541

Query: 390 QLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHF 449
              Y+DR GRPL  ++  ++FGL+AF   S +   +F WL A+AGL+    W SI +SH 
Sbjct: 542 IFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHI 601

Query: 450 RFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI---AKKKVDVL 506
           RFR AMK QG+SL+ L + +  G WGS+Y+   N++V +AQF+V+L PI      +    
Sbjct: 602 RFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTE 661

Query: 507 SFFQNYMAFPLWLIMFLGYMVYSRN----WTLLNPLDKMDLDTHRRVYDVEVLKQE 558
           +FFQNY+   + L MF+ + +Y R+    W  + PL ++DL++ R+  D+EV+K E
Sbjct: 662 AFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHE 717

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  372 bits (955), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 200/536 (37%), Positives = 332/536 (61%), Gaps = 28/536 (5%)

Query: 33  RRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAAS 92
           RR +DSF+           DG  +S +   L++++++RH++M+++G  IGTGL V +  +
Sbjct: 51  RRMIDSFKPP--------LDGSYHSDN---LKRKLKSRHLIMIAIGGSIGTGLFVGSGKA 99

Query: 93  LHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWL 152
           L  GGP  ++IG+ +        +H  GE+ + +P + G F  YS+  +     F    +
Sbjct: 100 LATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVV-GAFANYSTRLLDPSISFMVSSI 158

Query: 153 FCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNM 212
           +  QW  V P+ELI + + +++W   V+  V+V IFY+ ++ ++ FG + +GE EF F++
Sbjct: 159 YICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSL 218

Query: 213 CKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFS 272
            KV+ I+GF+I+ I++  G   D  +IG  YW +PG+  +G      KG A V VTA +S
Sbjct: 219 VKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG-----FKGVASVFVTASYS 273

Query: 273 FGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSN 332
            GG E+  L   E  +PK  +P A K+  +RI+  +L+++ ++GFLVP+ ++ L+G  S 
Sbjct: 274 LGGSEMVCLCSAE-TDPKE-LPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS- 330

Query: 333 DVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLD 392
            V+ SP+V+AI++ G++VLP I+NAVILIS++SVGNS ++++ R LC++A QG  P+   
Sbjct: 331 -VNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFG 389

Query: 393 YIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFR 452
           Y+DR GRPL+ +I+ ++FGL+AF   S +   +F WL AIAGL+    W SI +SH RFR
Sbjct: 390 YVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFR 449

Query: 453 QAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIA---KKKVDVLSFF 509
            AMK Q RSL+ L +++  G +GS+Y+   N+L+ IAQF+++L P+      +    SFF
Sbjct: 450 LAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFF 509

Query: 510 QNYMAFPLWLIMFLGYMVYSR----NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYE 561
           +NY+   + + +F+ + +Y +     W    PL ++DL+T R+  D+E++KQE  E
Sbjct: 510 KNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVRE 565

>Kwal_34.16254
          Length = 481

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/482 (39%), Positives = 285/482 (59%), Gaps = 41/482 (8%)

Query: 7   NKFNEKTVVQTAYSPSYASPESTGPFRR---------FVDSFRREDTSRSGDLEDGEINS 57
           + F+EKT           +PE+ G  RR          VDSF+          EDG  +S
Sbjct: 30  SDFSEKT-----------TPENDGVRRRSTNRNVLQRMVDSFKPP--------EDGSFHS 70

Query: 58  TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMH 117
            +   L++ ++ RH+VM+++G  IGTGL + +  +L  GGP  L+IG+ +        +H
Sbjct: 71  DN---LKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIH 127

Query: 118 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKV 177
             GE+ V +P + G F  Y + F+     F  V ++ LQW  V PLE+I A + ++YW  
Sbjct: 128 GLGEITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDT 186

Query: 178 SVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTG 237
           SV+  V+V IFY  I  I+  G RG+GE EF+F++ KV+ IVGF+I+ I++  G      
Sbjct: 187 SVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKE 246

Query: 238 YIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSAC 297
           ++G +YW +PG   +G      KG A VLV A +S GG E+  L+  E  +PK  +PSA 
Sbjct: 247 FVGAKYWHDPGPLANG-----FKGVAGVLVIASYSLGGTEMACLASGE-TDPKE-LPSAI 299

Query: 298 KKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNA 357
           K+  +RI+  +L+++ ++GFLVP+ +  LMG  S D   SP+V+AI +HG+  LP IVNA
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVD--NSPFVIAIRLHGINALPSIVNA 357

Query: 358 VILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSA 417
           VIL+S++SVGNS ++++ R LC++A QG  P+   YIDR GRPL  ++   +FGL+AF  
Sbjct: 358 VILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLV 417

Query: 418 ASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSL 477
            S +   +F WL AIAGL+    W SI +SH RFR AMK QG  LE L + +  G +GS+
Sbjct: 418 KSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSV 477

Query: 478 YA 479
           Y+
Sbjct: 478 YS 479

>Kwal_56.22951
          Length = 596

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/574 (35%), Positives = 332/574 (57%), Gaps = 27/574 (4%)

Query: 2   SADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVD-SFRREDTSRSGDLEDGEINSTDT 60
           S   +N+F +K+  Q  +  +++      P    VD S   E+  R+ +L +        
Sbjct: 27  SGSLINRFKQKSRRQI-HDIAHSFQRQEAPNSEGVDLSLLSEEQRRNYELAN-------- 77

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
              ++ +  RH++M+S+G  +GTGL +    SL   GP  LLIG+L+V ++ + ++ +A 
Sbjct: 78  QPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLA-SGPGSLLIGFLIVGLMMFCVVQSAA 136

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180
           EMA  YP + G+F+ + S F+    GF     + L WL  FP ELI   I ++YW  SVN
Sbjct: 137 EMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYWS-SVN 194

Query: 181 ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA-IGDTGYI 239
             V+V IFY+FI+ ++ FG RGYGE EF  ++ KV+ IV F+I+GI++  G     +GYI
Sbjct: 195 GAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYI 254

Query: 240 GDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKK 299
           G +YW NPGSF    P+   KG     ++A FSFGG EL  L+ +E    ++ +  A K 
Sbjct: 255 GTKYWHNPGSFAK--PV--FKGLCNTFISAAFSFGGAELVVLTASESKKVES-VSRAAKG 309

Query: 300 GVYRILLVYLLTMIMIGFLVPHDSDRLMGSGS-NDVHPSPYVLAIEMHGV--KVLPHIVN 356
             +RI + Y+ T+++IG LVP+  DRL+G  +  D+  SP+V+A+   G     + H +N
Sbjct: 310 TFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVSHFMN 369

Query: 357 AVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFS 416
           AVILI+V+SV NS +Y++ R++ AL   G  P+   YID++GRPL+ + +C +FGL+ F 
Sbjct: 370 AVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFL 429

Query: 417 AASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGS 476
            A D Q+ +F WL A+  +S  FTW  IC+S  RFR A++ QGRS + + ++++ G +G 
Sbjct: 430 VACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGG 489

Query: 477 LYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW---- 532
           +     N+L+   + +V++ P+         FFQ  M+ P+ ++++  +  Y        
Sbjct: 490 ILGGVLNILLIAGEIYVSIFPLGGSP-SAEQFFQYCMSIPIMIVVYALHKTYKATRRDAK 548

Query: 533 TLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERM 566
            +L PL ++DLD+ RR+ D+E+ K E  E K R+
Sbjct: 549 RILVPLSEIDLDSGRRIQDIELFKHELEEDKARI 582

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  336 bits (861), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/565 (34%), Positives = 327/565 (57%), Gaps = 24/565 (4%)

Query: 10  NEKTVVQTAYSPSYASPE--STGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKL---- 63
            + T V   ++ S  + E  S   F R  DSF+R++   +  ++    + TD  +     
Sbjct: 10  KDPTQVSENFTQSLYTDEDGSRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRTNYLL 69

Query: 64  -----QQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
                Q+ +  RH+ M+++G  +GTGL +    SL   GP  LLIG+LL  +  + ++  
Sbjct: 70  AKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFLLTGLAIFCVVQC 128

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178
           A E++  YP + G+F ++ S F+   +GF     +CL W   FP ELI   + I YW  S
Sbjct: 129 AAELSCQYP-VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSS 187

Query: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGI-LINVGAIGDTG 237
           VN  V+V+IF+LFI+ ++ FG RG+ ETE++ ++ K+L I+ F+I+G+ LI  G     G
Sbjct: 188 VNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNG 247

Query: 238 YIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSAC 297
           YIG +YW +PGSF +  P+   K      V+A FSFGG EL  L+  E      +I  A 
Sbjct: 248 YIGTKYWHDPGSFKA--PV--FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISRAA 302

Query: 298 KKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG-SNDVHPSPYVLAIEMHGV--KVLPHI 354
           K   +R+++ Y+ T+++IG LVP+  +RL+G   S D+  SP+V+A+   G   + + + 
Sbjct: 303 KGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNF 362

Query: 355 VNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIA 414
           +NAVILI+V+SV NS +Y+A R++ +L   G  P    Y+DR+GRPL  +++  +FG + 
Sbjct: 363 MNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLP 422

Query: 415 FSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQW 474
           F  AS+   ++F WL A+  +S +F W SIC S+ R+R A+K Q RS + + Y+++ G W
Sbjct: 423 FIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIW 482

Query: 475 GSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW-T 533
           G+   +  + L+ + + +V+L P+ +      +FF+  ++ P+ + +++G+  Y+ NW +
Sbjct: 483 GAYLGLLLSALLIVGEIYVSLFPLGESP-SAEAFFKYCLSIPIMIAVYIGHKSYTGNWKS 541

Query: 534 LLNPLDKMDLDTHRRVYDVEVLKQE 558
            + PL  +DLDT     DVE++K E
Sbjct: 542 FVIPLSGIDLDTGLSHSDVEIMKHE 566

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/579 (34%), Positives = 326/579 (56%), Gaps = 32/579 (5%)

Query: 6   VNKFNEKTVVQTAYSPS-YASPESTGP--FRRFVDSFRREDTSRSGDLEDGEINS--TDT 60
           +++F    + +  +S S  ++P + G     RF +SF+R D   S  +++G + S  ++ 
Sbjct: 1   MDEFESTKLSKVQFSTSVLSTPSNEGNNLIHRFKNSFKRND---SPAIQEGLLYSELSEE 57

Query: 61  TKLQ---------QRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIV 111
            K+Q         + +  RH+ M+++G  +GTGL +    SL   GPA LLIG+LLV   
Sbjct: 58  EKIQWDLANQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGAS 116

Query: 112 SYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIV 171
              ++    E++  YP + G++  ++S FI    GF+    + L WL  +P EL+  ++ 
Sbjct: 117 MLCVVQCGAELSCQYP-VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLT 175

Query: 172 IKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVG 231
           I YW  SVN   +V I ++  + ++ FGARG+ E+EF  ++ K++ +  F+I+GI++  G
Sbjct: 176 ISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAG 235

Query: 232 AIGD-TGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPK 290
              D TGYIG +YW +PGSF    P+   K      V+A +SF G E+  L+  E     
Sbjct: 236 GGPDSTGYIGTKYWHDPGSF--AVPV--FKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSV 290

Query: 291 TAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGV- 348
           +++  A K   +RI++ Y++T+I+IG LVP++  RL+ GS S D+  SP+V+A+   G  
Sbjct: 291 SSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAM 350

Query: 349 -KVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILC 407
              + H +NAVILI+V SV NS +Y++ RL+  LA  G  PK   Y+DR GRPL+ + +C
Sbjct: 351 GTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAIC 410

Query: 408 AIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGY 467
             FGL+ F   S NQ  +F WL A+  +S   TW  IC    RFR AMK QGRS + + Y
Sbjct: 411 GAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIY 470

Query: 468 RAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMV 527
           R+  G +G ++    N+L+ I + +V+  P+        +FF+  M+ P+ + +++G+ +
Sbjct: 471 RSTLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRI 529

Query: 528 YSRNWT--LLNPLDKMDLDTHRRVYDVEVLKQEEYEFKE 564
           Y R+W    +  +D +DLD+   + D E  K E  E K+
Sbjct: 530 YRRDWRHWYIKRMD-IDLDSGHSLEDFEATKLERDEDKK 567

>Scas_536.1
          Length = 372

 Score =  318 bits (814), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 166/354 (46%), Positives = 236/354 (66%), Gaps = 1/354 (0%)

Query: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTA 269
           F++ KV  ++GF+I+GI++  G     G++G +YW +PG+FV      + KG   V VTA
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 62

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            FSF G EL  ++  E  NP+ +IP A K+ V+RI+L Y+ T+ MIG LVP++  RL+G+
Sbjct: 63  AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 122

Query: 330 GSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPK 389
            S D   SP+V+AI  HG+K LP ++N VILI+V+SVGNSA+++  R + AL+ QG+ PK
Sbjct: 123 SSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPK 182

Query: 390 QLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHF 449
              YIDR GRPL+ + + + FGL+AF AAS  + ++F WL A++GLS LFTW  ICL H 
Sbjct: 183 VFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHI 242

Query: 450 RFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFF 509
           RFR A+K QGR    L + +  G  GS + +F  +L+FIAQF+VAL P   K  D   FF
Sbjct: 243 RFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKP-DAEVFF 301

Query: 510 QNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563
           Q+Y++FP+ +  + G+ +Y RNW L  PL+ MD+DT RR  D+E+LKQE  E K
Sbjct: 302 QSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEK 355

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/572 (35%), Positives = 326/572 (56%), Gaps = 27/572 (4%)

Query: 7   NKFNEKTVVQTAYSPSYASPESTGPF-RRFVDSFRREDTSR-SGDLEDGEINSTDTTKLQ 64
           N+ ++ T ++T  +      + +G   RR  DSF++ +      DLE+ E   T+  K+Q
Sbjct: 8   NESDKFTKIETESTTIPNDSDRSGSLIRRMKDSFKQSNLHVIPEDLENSE--QTEQEKIQ 65

Query: 65  QRMRT---------RHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIM 115
            ++ +         RH+ M+++G  +GTGL +    SL   GPA LLIG+LLV    + +
Sbjct: 66  WKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLLVGTSMFCV 124

Query: 116 MHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW 175
           + +A E++  +P + G++  + S FI +  GF     + L WL  FP ELI   + I YW
Sbjct: 125 VQSAAELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYW 183

Query: 176 KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA-IG 234
             +VN  V+V IFY+FI+ ++ FG RG+ ETEF  ++ KV+ I  F+I+GI++  G    
Sbjct: 184 NQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPN 243

Query: 235 DTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIP 294
            TGYIG +YW +PG+F    P+   K      V+A FSFGG EL  L+  E  N  +AI 
Sbjct: 244 STGYIGAKYWHDPGAFAK--PV--FKNLCNTFVSAAFSFGGSELVLLTSTESKN-ISAIS 298

Query: 295 SACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM-GSGSNDVHPSPYVLAIEMHGV--KVL 351
            A K   +RI + Y+ T+++IG LVP++  RL+ GS S DV  SP+V+A+   G     +
Sbjct: 299 RAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKV 358

Query: 352 PHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFG 411
            + +N VIL++V+SV NS +Y++ RL+ AL   G  P    Y+DR+GRPL+ + +   FG
Sbjct: 359 SNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFG 418

Query: 412 LIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAIT 471
           L+ F  AS  ++++F WL A+  +S  FTW  IC+S  RFR A+K QGRS + + Y++I 
Sbjct: 419 LLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSIL 478

Query: 472 GQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRN 531
           G +G +     N L+   + +V+  P+        +FF+  ++ P+ ++++  +  Y R+
Sbjct: 479 GVYGGILGCVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVVYFAHRFYRRD 537

Query: 532 WT-LLNPLDKMDLDTHRRVYDVEVLK-QEEYE 561
           W        ++DLDT   V ++E+ K Q+E E
Sbjct: 538 WKHFYIKRSEIDLDTGCSVENLELFKAQKEAE 569

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  313 bits (802), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 182/504 (36%), Positives = 281/504 (55%), Gaps = 13/504 (2%)

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
           T++++ ++ RH+ M++LG  IGTGL V  +  L   GP G LI Y+ +  + Y +  + G
Sbjct: 89  TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLG 148

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180
           EMA   P +  +   +S  F+S  FG A  +++   W   + +E+     VI+YW   V 
Sbjct: 149 EMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVP 207

Query: 181 ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIG 240
              ++ IF++ I  ++FF  + YGE EF     KV+ IVG++I  ++I  G     G IG
Sbjct: 208 LAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGG-SHQGPIG 266

Query: 241 DRYWRNPGSFVSGTPLDKLKGTAYV-----LVTAYFSFGGMELYALSVNELPNPKTAIPS 295
            RYWRNPG+  +G     L    ++     L+ A F++ G EL  ++  E  NP+ ++P 
Sbjct: 267 FRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 326

Query: 296 ACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIV 355
           A  K V+RI+L Y++++  +G LVP++  RL  S +     SP+V++I+  G KVLP I 
Sbjct: 327 AINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIAS-SPFVISIQNAGTKVLPDIF 385

Query: 356 NAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAF 415
           NAV+L++VIS  NS +Y   R+L ALAQ G APKQ  Y+ R G P + +I  A+ GL+AF
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 416 SAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWG 475
              + N    F WL  I+ L+ L  W  I L+H RF QA+K +G S + L ++A    WG
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 476 SLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLL 535
           + YA FF  ++   Q + A  P    K DV  FF  Y++  L +++F G  +Y R    L
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRC-RFL 560

Query: 536 NPLDKMDLDTHRRVYDVEVLKQEE 559
             L+ +D+D+ RR  D  V + +E
Sbjct: 561 WKLEDIDIDSDRREIDAIVWEDDE 584

>Scas_706.36d
          Length = 607

 Score =  308 bits (790), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/505 (35%), Positives = 279/505 (55%), Gaps = 15/505 (2%)

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
           T++++ ++ RH+ M++LG  IGTGL V  +  L   GP G LI YL +  + Y +  + G
Sbjct: 99  TEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLG 158

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVN 180
           EMA   P +  +   +S  F+S  FG A  +++   W   + +E+     VI+YW   V 
Sbjct: 159 EMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVP 217

Query: 181 ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIG 240
              ++ IF++F+  ++FF  + YGE EF     KVL I G+++  ++I  G     G IG
Sbjct: 218 LAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGG-SSQGPIG 276

Query: 241 DRYWRNPGSFVSGTPLDKLKGTAYVL------VTAYFSFGGMELYALSVNELPNPKTAIP 294
            RYWRNPG + +G  + K K T+  L      + A F++ G EL  ++  E  NP+ ++P
Sbjct: 277 FRYWRNPGPWGAGI-ISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 335

Query: 295 SACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHI 354
            A  K V+RI L Y++++  IG LVP+D  RL    +     SP+V++I+  G K+LP I
Sbjct: 336 RAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVAS-SPFVISIQNAGTKILPDI 394

Query: 355 VNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIA 414
            NA+++I+VIS  NS +Y   R+L ALAQ G APKQ  Y+ R G P + ++  A  GL+A
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 415 FSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQW 474
           F   ++N    F WL  I+ L+ L  W  I +SH RF QA+K +G S + L ++A    W
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 475 GSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTL 534
            + YA FF  ++   Q + A  P      DV +FF  Y++  +  ++F+G  +Y R    
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC-RF 569

Query: 535 LNPLDKMDLDTHRRVYDVEVLKQEE 559
              L+ +D+DT RR  +  + + +E
Sbjct: 570 FWKLEDIDIDTDRREIEEVIWEDDE 594

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  307 bits (786), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 191/542 (35%), Positives = 296/542 (54%), Gaps = 22/542 (4%)

Query: 31  PFRRFVDSFRREDT----SRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLL 86
           P R F      EDT       GD ++GE+ + +   +++ ++ RH+ M++LG  IGTGL 
Sbjct: 51  PLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAE---VKRELKQRHIGMIALGGTIGTGLF 107

Query: 87  VANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFG 146
           +  +  L   GP G LI YL +  ++Y +  + GEMA   P +  +F  +S  F+S  FG
Sbjct: 108 IGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFG 166

Query: 147 FATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGET 206
            A  +++   W   F LEL     VI++W   V    ++ IF++ I  ++ F  + YGE 
Sbjct: 167 AANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEF 226

Query: 207 EFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT--- 262
           EF     KVL I+GF+I    +  GA G TG +G RYWRNPG++  G    DK +G    
Sbjct: 227 EFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLG 285

Query: 263 -AYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPH 321
               L+ A F+F G EL  ++  E  NP+ ++P A KK V+RIL  Y+ +++ IG LVP+
Sbjct: 286 WVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPY 345

Query: 322 DSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCAL 381
           +  +L  S S  V  SP+++AIE  G KVLPHI NAVIL ++IS  NS +Y   R+L  L
Sbjct: 346 NDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGL 404

Query: 382 AQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTW 441
           ++   APK L    + G P I++ + A FG +A+   S   +K+F WL  I G++  F W
Sbjct: 405 SKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAW 464

Query: 442 TSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK 501
             I +SH RF QA+K +G S + L ++A      + YA  F  ++ I Q + A  P    
Sbjct: 465 LFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP---- 520

Query: 502 KVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYE 561
           K + +SF   Y++  L+L +++ +    R    +  +  +D+D+ RR  D+E +  E++E
Sbjct: 521 KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHE 577

Query: 562 FK 563
            K
Sbjct: 578 PK 579

>Kwal_33.13401
          Length = 559

 Score =  305 bits (780), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 172/516 (33%), Positives = 285/516 (55%), Gaps = 15/516 (2%)

Query: 51  EDGEINSTDTTK--LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLV 108
           +D ++ S+   +  +Q++++ RHV M++LG  IGTGL +   + L   GP G LI YL +
Sbjct: 39  QDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFM 98

Query: 109 SIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITA 168
             ++Y +  + GEMA   P +  +F  ++  F+S P G A  +++C  W   + LEL   
Sbjct: 99  GSIAYCVTQSLGEMATFIP-VTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIV 157

Query: 169 TIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILI 228
             +I+YW  +V    ++ IF++ I   +    + YGE +F   + KV+ I+GF++  + +
Sbjct: 158 GQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCM 217

Query: 229 NVGAIGDTGYIGDRYWRNPGSFVSGT-----PLDKLKGTAYVLVTAYFSFGGMELYALSV 283
             GA G TG +G RYWRNPG +  G         +  G    LV A F++ G EL  +S 
Sbjct: 218 VCGA-GKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISA 276

Query: 284 NELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAI 343
            E  NP+  +P A  K  +RILL Y+ ++  IG LVP + ++L  S S     SP+++AI
Sbjct: 277 GESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAG-SPFIIAI 335

Query: 344 EMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLIS 403
           +  G K+LP I NAVIL ++IS  NS +Y   R+L  LA++  AP+     +R G P ++
Sbjct: 336 QNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVA 395

Query: 404 LILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLE 463
           ++  A FG + + + S+   K F WL  I  ++  F+W  I L H RF QA+KLQG S +
Sbjct: 396 VLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRD 455

Query: 464 TLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFL 523
            L ++A    WG+ Y+ FF  L+ I Q + +L P      +V +FF  Y++  ++L+++ 
Sbjct: 456 DLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAP----TFNVSNFFAAYISVFMFLVIWA 511

Query: 524 GYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
            +  + R   +++ ++ +D+D+ RR  D +     E
Sbjct: 512 VFQCWYRT-RIIHRIEHVDIDSDRREVDAQQWDNTE 546

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  303 bits (777), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 178/525 (33%), Positives = 284/525 (54%), Gaps = 23/525 (4%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           ED +  GD ++        T++++ ++ RH+ M++LG  IGTGL +  A+ L   GP G 
Sbjct: 42  EDHTEEGDYQE--------TEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGS 93

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           L+ Y+ +  V Y +  + GEMA   P +  +   +S  F+S  FG A  +++   W   F
Sbjct: 94  LLAYIFIGTVVYSITQSLGEMATFIP-VTSSVTVFSKRFLSPAFGVANGYMYWFNWAITF 152

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
            +EL     +I+YW   V    ++VIF++ +  ++FF  R YGE EF     KVL IVG+
Sbjct: 153 AVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGY 212

Query: 222 VIVGILI-----NVGAIG--DTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFG 274
           +I   +I       G IG   TG I  R  R   S  +        G    L+ A F++ 
Sbjct: 213 LIYAFIIVCGGSKQGPIGLPATGGIPARGAR--ASSRTTRKRHGFLGWVSSLIKAAFTYQ 270

Query: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDV 334
           G EL  ++  E  NP+  +P A  K  +RIL  Y+ +++ +G LVP+D  RL    S DV
Sbjct: 271 GTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDV 330

Query: 335 HPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYI 394
           + SP+V++I+  G K+LP I NAV+LI+VIS  NS +Y   R+  +LA  G APKQL ++
Sbjct: 331 NASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFV 390

Query: 395 DREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQA 454
            ++G P   +++ ++ GL++F   + N    F WL  I+ L+ L  W  I L+H RF Q 
Sbjct: 391 TKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQC 450

Query: 455 MKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMA 514
           +K +G S + L ++A    W + YA FF  ++   Q + A  P    K DV +FF +Y++
Sbjct: 451 LKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYIS 506

Query: 515 FPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
             L L++F+G  +Y +    L  ++ +D+D+ RR  D  V +++E
Sbjct: 507 LFLMLLVFIGCQIYYKC-RFLWAVEDIDIDSDRREIDAIVWEEDE 550

>Kwal_33.13411
          Length = 560

 Score =  303 bits (777), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 177/518 (34%), Positives = 282/518 (54%), Gaps = 21/518 (4%)

Query: 47  SGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYL 106
            GDL++G++        ++ ++ RHV M++LG  IGTGL V  A+ L   GP G LI Y+
Sbjct: 46  EGDLQEGQV--------KRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYI 97

Query: 107 LVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELI 166
            +  + Y +  + GEMA   P +  +   +S+ F+S  FG A  +++   W   + +E+ 
Sbjct: 98  FMGSIVYFVTQSMGEMATFIP-VTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEIS 156

Query: 167 TATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGI 226
               VI+YW  +V    ++ IF++ I   +FF  R YGE EF     KV+ IVG+++  +
Sbjct: 157 VIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYAL 216

Query: 227 LINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AYVLVTAYFSFGGMELYAL 281
           +I  G     G IG RYWRNPG +  G    DK KG        L+ A F++ G EL  +
Sbjct: 217 IIVCGG-SKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGI 275

Query: 282 SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVL 341
           +  E  NP+  +P A  K  +RIL  Y+L++  +G LVP++   L    ++ +  SP+V+
Sbjct: 276 TAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVI 334

Query: 342 AIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPL 401
           +I+  G ++LP I NAV+L+++IS  NS +Y   R+L +LA  G APKQ  Y+  +G P 
Sbjct: 335 SIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPY 394

Query: 402 ISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRS 461
           + +I  A+ GL+AF    DN  + F WL  I+ L+ L  W  I +SH RF Q +K +G S
Sbjct: 395 LGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGIS 454

Query: 462 LETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIM 521
            + L +++    +G+ YA F+  ++   Q + A  P    K  V  FF  Y++  L  ++
Sbjct: 455 RDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVV 510

Query: 522 FLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
           F    +Y R     N L+ +D+D+ RR  D  + ++EE
Sbjct: 511 FCLAQLYYRC-RFFNRLEDIDIDSDRREIDALIWEEEE 547

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  300 bits (769), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 180/501 (35%), Positives = 290/501 (57%), Gaps = 20/501 (3%)

Query: 74  MMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
           M+S+G  +GTGL +    SL   GP  LLIG+L+V +  + ++ +A E++  YP + G+F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSF 58

Query: 134 NAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFII 193
           +++ S FI    GF     + L WL  FP EL+   + I YW   +   V+V+I YL +I
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 194 CIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT--GYIGDRYWRNPGSFV 251
            ++ F  RG+ E+EF  ++ KVL I+ F+I+GI+I  G   +   GY+G +YW +PG+F 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAF- 177

Query: 252 SGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLT 311
              P           V+A F+FGG EL  L+ NE      +I  A K   +RI + Y+ T
Sbjct: 178 -RPPF--FSSLCQTFVSAAFTFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYIST 233

Query: 312 MIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGV--KVLPHIVNAVILISVISVGNS 369
           +I+IG LVP+ S  L G     +  SP+V+A+   G     + H +NAVI+ +V+SV NS
Sbjct: 234 VIVIGCLVPYTSPALDG---ESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 370 AMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWL 429
            +Y+A R++ +L   G  P+   YID++GRPL+ + +CA+FGL+AF   +   + +F WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 430 AAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIA 489
            A+  ++  F W  IC+S  R+R+A+K+QG   E + Y+++ G+W  +     N L+   
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 490 QFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW-TLLNPLDKMDLDTHRR 548
           + +V++     K  DV +FFQN M+ PL +I +  + +Y R+W T L P   +DL+T R+
Sbjct: 411 EIYVSV-----KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRK 465

Query: 549 VYDVEVLKQEEYEFKERMRNS 569
             D+E++K E    + R+ +S
Sbjct: 466 PEDLEMMKHELIVSRARIASS 486

>Scas_706.37
          Length = 544

 Score =  298 bits (763), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 180/530 (33%), Positives = 289/530 (54%), Gaps = 17/530 (3%)

Query: 36  VDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHY 95
           V SF+ +       +   + +      +++ ++ RH+ M++LG  IGTGL +  A  L  
Sbjct: 8   VHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLII 67

Query: 96  GGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCL 155
            GP G LI YL +  V + +  + GEM    P +  +F  ++  F+S  FG A  +++  
Sbjct: 68  AGPIGALIAYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWF 126

Query: 156 QWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKV 215
            W   F LEL     +I++W ++V    ++ I ++ +   + F  R YGE EF     KV
Sbjct: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186

Query: 216 LMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLK-----GTAYVLVTAY 270
           L I+GF+I GI I  GA G TG +G RYW+NPG +  G     +      G    L+ A 
Sbjct: 187 LAILGFIIYGICIICGA-GVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245

Query: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG 330
           F+F G EL  ++  E  NP+  +P A KK V+RIL+ Y+ ++++IG LVP++  +L    
Sbjct: 246 FTFQGTELVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ--- 302

Query: 331 SND--VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388
           SND  V  SP+++ I+  G K+LPHI NAVILI++IS GNS +Y   R+L  LA+   AP
Sbjct: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362

Query: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448
           K      + G P ++++  ++FG +A+   +   +K F WL  I G++  F W  I  SH
Sbjct: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422

Query: 449 FRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSF 508
            RF +A+K +G S   L Y+A+   W + YAVFF +++ + Q + +  P    K  V +F
Sbjct: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANF 478

Query: 509 FQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQE 558
           F  Y++  L++I ++ + ++ +   L+  L  +DLDT RR  + EV   +
Sbjct: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDD 527

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  298 bits (764), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 190/535 (35%), Positives = 299/535 (55%), Gaps = 22/535 (4%)

Query: 37  DSFRREDTSRSGDL------EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANA 90
           DS    D   S +L      E+GE      T++++ ++ RHV M++LG  IGTGL V  A
Sbjct: 42  DSIELSDVQVSSELYDHAESEEGE-GDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIA 100

Query: 91  ASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV 150
             L   GP G LI Y+ +  V Y +  + GEMA   P +  +   +S  F+S  FG A  
Sbjct: 101 KPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAFGVANG 159

Query: 151 WLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIF 210
           +++   W   + +EL     +I YW  +V    ++ IF++ +   +FF  + YGE EF  
Sbjct: 160 YMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCV 219

Query: 211 NMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT---PLDKLKGTAYV-- 265
              KV+ IVG+++  ++I  G     G IG RYWRNPG + +GT    ++K +   +V  
Sbjct: 220 ASIKVIAIVGYLLYALIIVCGG-SSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGS 278

Query: 266 LVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDR 325
           LV A F++ G EL  ++  E  NP+  +P A  K  +RIL+ Y+ ++  +G LVP++S +
Sbjct: 279 LVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQ 338

Query: 326 LMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
           L  S S  +  SP+V++I+  G KVLP I NAV+L++++S GNS +Y   R+L +LA  G
Sbjct: 339 LE-SNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSG 397

Query: 386 YAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSIC 445
            APKQ  Y+ ++G P + +I  A+ GL+AF A ++N    F WL  I+ L+ L  W  I 
Sbjct: 398 NAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFIS 457

Query: 446 LSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFF-NLLVFIAQFWVALVPIAKKKVD 504
           ++H RF Q +KL+G S ++L ++A    WG+ YA FF  L+VFI  F  A  P    + D
Sbjct: 458 VAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGF-TAFAP----RFD 512

Query: 505 VLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
           V  FF  Y++  L +++F+   +Y R    L  ++ +D+D+ RR  D  + + +E
Sbjct: 513 VSEFFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDAIIWEDDE 566

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  298 bits (762), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 180/531 (33%), Positives = 289/531 (54%), Gaps = 17/531 (3%)

Query: 40  RREDTSRSGDL-EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGP 98
           R +  S   D+ ED E    +   +++ ++ RH+ M++LG  IGTGL V  +  L   GP
Sbjct: 82  RLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGP 141

Query: 99  AGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWL 158
            G LI Y+ +  + Y +  + GEMA   P +  +   +S  F+S  FG +  +++   W 
Sbjct: 142 VGSLIAYIFMGTIVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAFGVSNGYMYWFNWA 200

Query: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218
             + +E+     VI+YW   V    ++ IF++ I  ++FF  + YGE EF     KVL I
Sbjct: 201 ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAI 260

Query: 219 VGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AYVLVTAYFSF 273
           +G++I  ++I  G     G IG RYWRNPG++  G    DK +G        L+ A F++
Sbjct: 261 MGYLIYALIIVCGG-SHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTY 319

Query: 274 GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSND 333
            G EL  ++  E  NP+  +P A  K V+RI+L Y++++  IG LVP++  RL  S +  
Sbjct: 320 QGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVI 379

Query: 334 VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDY 393
              SP+V++I+  G   LP I NAV+LI+V+S  NS +Y   R+L +LA+ G APKQ  Y
Sbjct: 380 AS-SPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGY 438

Query: 394 IDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQ 453
           + R+G P + ++  A  GL+AF   ++N    F WL  I+ L+ L  W  I L+H RF Q
Sbjct: 439 VTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQ 498

Query: 454 AMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYM 513
           A+K +G S + L ++A    +G+ YA FF  ++   Q + A  P       V  FF +Y+
Sbjct: 499 ALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPF-----KVSEFFTSYI 553

Query: 514 AFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKE 564
           +  L  ++F+G  +Y +    +  L+ +D+D+ RR  ++E +  E+ E K 
Sbjct: 554 SLILLAVVFIGCQIYYKC-RFIWKLEDIDIDSDRR--EIEAIIWEDDEPKN 601

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  294 bits (752), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 185/567 (32%), Positives = 301/567 (53%), Gaps = 29/567 (5%)

Query: 7   NKFNEKTVVQTAYS-----PSYASPESTGPFRRFVDSFRREDTSRSG----DLEDGEINS 57
           +   EK+V+Q   +      S +   +TG   R     R+  TS S     DL   +   
Sbjct: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGR-----RKRKTSVSSTQYEDLATEKDEL 60

Query: 58  TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMH 117
            +   +++ ++ RH+ M++LG  IGTGL +  A  L   GP G L+ YL +  V + +  
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 118 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKV 177
           + GEMA   P +  +F+ ++  F+S   G A  +++ L W   F LEL     +I++W  
Sbjct: 121 SLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179

Query: 178 SVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTG 237
            V    ++ IF++ +   + F  + YGE EF     KVL ++GF+I  + I  GA G TG
Sbjct: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKTG 238

Query: 238 YIGDRYWRNPGSF-----VSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292
            IG RYWRNPG+       S T   +  G    L+ A F++ G EL  ++  E  NP+ A
Sbjct: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298

Query: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352
           +P A +K + RILL Y+ ++  IG  VP++  +L  + S  V  SP+++ I+  G +VLP
Sbjct: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLP 357

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
           HI NAVIL ++IS GNS +Y   R+L ++A+ G APK L     +G P +S++  + FG 
Sbjct: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472
           +++   S    K F WL  I G++  F W  I  SH RF QA+K +G S + L Y+A+  
Sbjct: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477

Query: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW 532
            W + YA+FF +++ + Q + +  P    +     F   Y++  L+L+ +  + +Y R  
Sbjct: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRC- 532

Query: 533 TLLNPLDKMDLDTHRRVYDVEVLKQEE 559
            ++  L+ +D+DT RR  ++E +  E+
Sbjct: 533 RIIWKLEDVDIDTDRR--EIESVVWED 557

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  290 bits (741), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 178/524 (33%), Positives = 292/524 (55%), Gaps = 17/524 (3%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           +D+SR  D E     S    ++++ ++ RHV M++LG  IGTGL ++ +  L   GP G 
Sbjct: 56  DDSSRMFDPE----GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGS 111

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           LI ++L+  ++Y +  + GEMA   P +  +F  +S  FIS   G A  +++   W   F
Sbjct: 112 LIAFMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITF 170

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
            LEL     +I+YW  +V    ++ IF++ ++  + F  + YGE EF     KV+ I+GF
Sbjct: 171 ALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGF 230

Query: 222 VIVGILINVGAIGDTGYIGDRYWRNPGSFVSG---TPLDKLKGTAYV--LVTAYFSFGGM 276
           +I  + +  GA G  G IG RYWR PG + +G     ++K +   +V  L++A F++ G 
Sbjct: 231 LIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289

Query: 277 ELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSND-VH 335
           EL  ++  E  NP+ A+P A  K  +RIL+ Y+ ++  IG LVP++  +L GS +   + 
Sbjct: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349

Query: 336 PSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYID 395
            SP+++AI      VLPHI NAVIL ++IS GNS +Y   R+L  L++   APK      
Sbjct: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409

Query: 396 REGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAM 455
           + G P I++++ A+FG +A+   S++ +++F WL  I  ++   TW  I +SH RF Q +
Sbjct: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469

Query: 456 KLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAF 515
           K +G S + L Y+A    + + YA FF  ++ I Q + A  P      +V  FF  Y++ 
Sbjct: 470 KHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAAYISV 525

Query: 516 PLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
            L+ I++  +    R   L   LD++D+D+ RR  DV + ++EE
Sbjct: 526 FLFFIVWAIFQTIYRT-KLFRTLDEVDIDSDRRDIDVIIWEEEE 568

>Scas_377.2
          Length = 490

 Score =  277 bits (709), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 168/493 (34%), Positives = 272/493 (55%), Gaps = 15/493 (3%)

Query: 82  GTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFI 141
           G GL +  +  L   GP G LI YL ++ ++Y +  + GEMA   P +  +F  +S  F+
Sbjct: 4   GXGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFV 62

Query: 142 SKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGAR 201
           S  FG A  +++   W   F LEL     VI++W  +V    ++ IF++ +  ++ F  +
Sbjct: 63  SPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVK 122

Query: 202 GYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLK 260
            YGE EF   + KV+ I+GF+I    +  GA G TG +G RYWR+PG+F  G    DK +
Sbjct: 123 YYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-GVTGPVGFRYWRHPGAFGPGIIAKDKNQ 181

Query: 261 ----GTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIG 316
               G    L+ A F+F G EL  ++  E  NP+  +P A KK V+RIL  Y+L++  IG
Sbjct: 182 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIG 241

Query: 317 FLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPR 376
            LVP+D  +L  + S  V  SP+++AIE  G  VLPHI NAVI+ ++IS GNS +Y   R
Sbjct: 242 LLVPYDDWKLTSTDSY-VSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSR 300

Query: 377 LLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLS 436
           ++  L+    AP  L    + G P +++++ ++FG +A+   S   +K F WL  I G++
Sbjct: 301 IMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVA 360

Query: 437 ELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALV 496
             FTW  I LSH RF QA++++G S + L ++A      + Y VFF  L+ I Q + +  
Sbjct: 361 GFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC 420

Query: 497 PIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEV-L 555
           P      + + F   Y++  +++ +++ +  + R   L+  ++ +D+DT RR  +  V +
Sbjct: 421 PW-----NGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWI 474

Query: 556 KQEEYEFKERMRN 568
           +QE   F ++  N
Sbjct: 475 EQEPRGFWDKFWN 487

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  280 bits (715), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 180/523 (34%), Positives = 287/523 (54%), Gaps = 14/523 (2%)

Query: 51  EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110
           ++ E +  +  +++++++ RH+ M++LG  IGTGL++     L + GP G LI YL +  
Sbjct: 54  KETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGT 113

Query: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170
           V Y +  + GEM    P +  +F+ ++  F+S   G    +++ L W   F LEL     
Sbjct: 114 VIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172

Query: 171 VIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230
           VI+YW  +V    ++VIF+  +  ++ F  + YGE EF     KV+ ++GF+I    +  
Sbjct: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232

Query: 231 GAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AYVLVTAYFSFGGMELYALSVNE 285
           GA    G IG RYWRNPG++  G    DK +G        L+ A F++ G EL  ++  E
Sbjct: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292

Query: 286 LPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEM 345
             NP+ A+P A KK V RIL+ Y+L++  IG LVP++  +L   G   V  SP++++IE 
Sbjct: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF-VSSSPFMISIEN 351

Query: 346 HGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLI 405
            G KVLP I NAV+LI+++S GNS +Y   R+L +L++   AP+ L  + R G P  S++
Sbjct: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411

Query: 406 LCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETL 465
             ++FG +AF   S    K F WL  I G++  F W  I  SH RF QA++ +G S + L
Sbjct: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471

Query: 466 GYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGY 525
            Y+A    + + YA FF  L+ + Q + A  P  +     + F   Y++  L+L ++L +
Sbjct: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP----IDFVAAYISIFLFLAIWLSF 527

Query: 526 MVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
            V+ +   LL  L  +D+D+ RR   +E L   E E K R + 
Sbjct: 528 QVWFKC-RLLWKLQDIDIDSDRR--QIEELVWIEPECKTRWQR 567

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  276 bits (706), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 179/545 (32%), Positives = 296/545 (54%), Gaps = 24/545 (4%)

Query: 38  SFRREDTSRSGD-LEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYG 96
           S R ED+ +  D ++DG+    + T+L++ ++ RH+ M+++G  IGTGLL+    SL+  
Sbjct: 63  SSRLEDSEKQDDYMDDGK---DEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTA 119

Query: 97  GPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQ 156
           GP  + I Y  V ++ +  M A GEMA +Y  L G F +Y+S +     GFA  + +  +
Sbjct: 120 GPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCK 177

Query: 157 WLTVFPLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214
           +L + P +L  A +VI+YW  +  VN  V++ IF + I+ ++F G + +GE EF  +  K
Sbjct: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237

Query: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVS-GTPLDKLKGT----AYVLVTA 269
           V++++G +I+  +I +G       +G R++ +PG+F      +D  KG       VLV A
Sbjct: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYA 297

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            F++ G+EL  +   E  NP+ +IP A K  +YRI++ YL+T+ ++G  V +D   L  +
Sbjct: 298 LFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKA 357

Query: 330 GSNDV--HPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387
            ++      SPYV+AI   G+K LPHI NA +L+ V S  NS +Y A R L  LA    A
Sbjct: 358 KTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417

Query: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           PK     +R G P  SL++ + F L+A+ + S    KIF +   +  +  L +W SI ++
Sbjct: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVL 506
           +  F +A+K Q        YRA    +GS + + F +L+ FI  F V L        D  
Sbjct: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYK 533

Query: 507 SFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL--KQEEYEFKE 564
           +F   Y+  P+++I + GY  + +   +  P +++DL T +   D E    K  + E +E
Sbjct: 534 NFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRE 591

Query: 565 RMRNS 569
           R++NS
Sbjct: 592 RLKNS 596

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  273 bits (697), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 287/518 (55%), Gaps = 19/518 (3%)

Query: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
           D  +L++ +  RHV M+++G  +GTGLL+   +SL   GPA +LI Y  V ++ + +M  
Sbjct: 75  DGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSC 134

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW--K 176
            GEMA AY  L G F +YS+ +     GFA  + +  ++  + P +L    +VI+YW  +
Sbjct: 135 LGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192

Query: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
             VN  V++ I  + II I+F G R +GE E+  +  K+ +++G +I+ +++  G   + 
Sbjct: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNH 252

Query: 237 GYIGDRYWRNPGSFVS-GTPLDKLKGT----AYVLVTAYFSFGGMELYALSVNELPNPKT 291
             +G +YW+NPG+F    T +   KG     A V V A F++ G EL  + V+E  NP+ 
Sbjct: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312

Query: 292 AIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMG--SGSNDVHPSPYVLAIEMHGVK 349
           A+P A K  +YRI++ YL+++ ++G  VP +   L+   S       SP+V+AI   G+ 
Sbjct: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIP 372

Query: 350 VLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAI 409
           VLPHI+NA ILI V S  NS +Y A R L  LA    AP+     +++G P  SL++  +
Sbjct: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432

Query: 410 FGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRA 469
           F L+A+   S    ++F +      +  L +W SI +++ RF +A ++QG    TL Y++
Sbjct: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492

Query: 470 ITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYS 529
               +G+ +++FF +L+ + + + A +       D  SF   Y+  P ++I ++GY ++ 
Sbjct: 493 PLQPYGAWFSLFFCILIGLIKNFPAFL---GDTFDYKSFITGYIGIPTYIISYIGYKLWY 549

Query: 530 RNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMR 567
           +  T + P +++DL + +   D+E   +EE +  +  R
Sbjct: 550 K--TKIIPSEEVDLVSFKEAVDLE---EEEGKMLDEER 582

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  269 bits (688), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 152/469 (32%), Positives = 260/469 (55%), Gaps = 11/469 (2%)

Query: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
           + + +++ ++ RHV M+SLG  IGTGL +  A+ +   GP G L+ Y+ V+ ++Y +  +
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178
            GEMA   P +  +F  ++S F+S   G A  +L+ L W   F LE+     +I YW  +
Sbjct: 105 LGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163

Query: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY 238
           V    ++ IF++ +  I+    + YGE EF     KV+ I+ F+  G+++  G     G 
Sbjct: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG-SKLGR 222

Query: 239 IGDRYWRNPGSFVSGTPLDKLKGTAYV-----LVTAYFSFGGMELYALSVNELPNPKTAI 293
           IG RYW++PG +  G    ++    ++     L+ A F+F G EL  ++  E  NP+  +
Sbjct: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282

Query: 294 PSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSN-DVHPSPYVLAIEMHGVKVLP 352
           P A     +RILL Y+ ++++IG LV +D  +L+  GS  + + SP+V+AI   G KVLP
Sbjct: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
            I+N VI++++IS GNS +Y   R+L  L + G AP  +      G P ++++  ++FG 
Sbjct: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472
           + +   S     +F WL +I  +S  FTW  I +SH RF Q +K +G S + L ++A   
Sbjct: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462

Query: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAF-PLWLI 520
            +G+ YA FF +++ + Q + A  P +   VD ++++ +   F  +WL+
Sbjct: 463 PYGAYYAAFFVIVIILVQGFTAFTPFS--AVDFVAYYISAFIFVVIWLL 509

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  267 bits (683), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 178/603 (29%), Positives = 305/603 (50%), Gaps = 55/603 (9%)

Query: 10  NEKTVVQTAYSPSYASPESTGPFRRFVDSFR----------------REDTSRSGDLE-- 51
            E+ VVQ   SPS  S  +        D+ R                RED     DLE  
Sbjct: 35  KEEDVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKS 94

Query: 52  ---DGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLV 108
              DG+   ++  KL+Q +++RHV +++LG  IGTGLLV  +++LH  GPAGL I Y+++
Sbjct: 95  PSVDGD---SEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 151

Query: 109 SIVSYIMMHAAGEMAVAYPTLPGNFNAYSSI-----FISKPFGFATVWLFCLQWLTVFPL 163
           S V Y +M A GEM    P   G+ +A S+      ++    GFAT W +   ++ +   
Sbjct: 152 SAVIYPIMCALGEMVCFLPG-DGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAA 210

Query: 164 ELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVI 223
           E   A+ V++YW  +V   V++ IF   ++ ++F   + YGE+EF F   K+L IVG +I
Sbjct: 211 ECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLII 270

Query: 224 VGILINVGAIGDTGYIGDRYWRNPGSF---VSGTPLDKLKGTAYVLVTAYFSF-GGMELY 279
           +  ++  G   +   +G RYW++PG+F   ++G  L         ++   F+F  G EL 
Sbjct: 271 LSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 330

Query: 280 ALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL---MGSGSNDVHP 336
            ++  E  + +  I  A ++ V+R++  Y+L  + I  +VP++   L   +  G      
Sbjct: 331 CMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGS 390

Query: 337 SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDR 396
           SP+V+ I+  G+KVLPHI+N  IL S  S  N+ M+++ R L  +AQ G APK L  I++
Sbjct: 391 SPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINK 450

Query: 397 EGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMK 456
            G P +++ +  +   +A+   S +   +F W + I+ +S    W   C+++ RFR+A+ 
Sbjct: 451 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 510

Query: 457 LQGRSLETLGYRAITGQWGSLYAVFFNLLVF----IAQFWVALVPIAKKKVDVLSFFQNY 512
             G     L  R     WG  Y V+F+L+V     I   +   +P   K   V  F   Y
Sbjct: 511 YNG-----LYDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIP---KYWRVADFIAAY 562

Query: 513 MAFPLWLIMFLGYMVYSRNW-TLLNPLDKMDLDT-----HRRVYDVEVLKQEEYEFKERM 566
           +  P++L+++ G+ +Y+R W     P+ ++D+ T       +  ++E ++     FK++ 
Sbjct: 563 ITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKF 622

Query: 567 RNS 569
            ++
Sbjct: 623 LDA 625

>Scas_520.2*
          Length = 372

 Score =  259 bits (662), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/355 (39%), Positives = 202/355 (56%), Gaps = 12/355 (3%)

Query: 201 RGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLK 260
           + +GETEF+ +M ++L I+GF I+GI++  G      +I  +YW  PGSFV      K K
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 261 GTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVP 320
           G   V V A FS+ G+E+ A+S  E  +P+  IP A K+           T ++IG  VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKR-----------TFVLIGCFVP 111

Query: 321 HDSDRLMGSGS-NDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLC 379
           +D+ RL+   S  D   SP V+AIE  G K L  ++NA+ILIS+ISV NSA+Y+  R + 
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 380 ALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELF 439
           A+   G  P+ L+ +D +GRP+ ++I    FGL++F AASD Q  +F WL+A++GL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 440 TWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIA 499
            W +I LSH R RQAM  Q RSL+ L + + TG WGS Y         +A FW +L P+ 
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLG 291

Query: 500 KKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEV 554
               D   FF+ +      + M L   +Y R    +  L  MDLDT RR  D++V
Sbjct: 292 GTSADAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMDLDV 346

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  261 bits (668), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 296/541 (54%), Gaps = 26/541 (4%)

Query: 41  REDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAG 100
           R+D+    D +D      + T+L++ ++ RH+ M+++G  +GTGLL+    +L  GGP  
Sbjct: 66  RDDSFAVPDGKD------ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVA 119

Query: 101 LLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTV 160
           +LI Y  V ++ +  M   GEMA +Y  L G F +Y+S ++    GFA  + +  ++  +
Sbjct: 120 MLIAYAFVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFIL 177

Query: 161 FPLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218
            P +L  A +VI+YW  +  VN  V++ IF + I+ I+  G + +GE EF  +  KV+++
Sbjct: 178 PPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVM 237

Query: 219 VGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVS-GTPLDKLKGT----AYVLVTAYFSF 273
           +G +++  +I +G   +   +G RYWR+PG+F    T +   KG       V V + FS+
Sbjct: 238 LGLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSY 297

Query: 274 GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG--S 331
            G+EL  +  +E  NP+ ++P A K  VYRI++ YL T+ ++G  V ++  RL+ +   S
Sbjct: 298 TGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKS 357

Query: 332 NDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQL 391
                SP+V+AI+  G++VLPHI NA +L+ V S  NS +Y + R L ALA  G APK  
Sbjct: 358 MSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIF 417

Query: 392 DYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRF 451
               R G P  +LIL  +F  +A+   S    KIF +   +  +  + +W +I + +  F
Sbjct: 418 AKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYF 477

Query: 452 RQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVLSFFQ 510
            +A + QG       Y A   ++G+ +A+FF +L+  I  F V L      K D  +F  
Sbjct: 478 DKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFIT 533

Query: 511 NYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL--KQEEYEFKERMRN 568
            Y+  P+++I + GY +  +   ++   D +DL T + +YD E    + ++ E +ER+++
Sbjct: 534 GYIGLPVYIISWAGYKLIYKT-KVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERLKS 591

Query: 569 S 569
           +
Sbjct: 592 N 592

>Scas_486.2
          Length = 597

 Score =  259 bits (663), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 175/538 (32%), Positives = 296/538 (55%), Gaps = 24/538 (4%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           ED + S ++ DG+   T+ T+L++ +  R V M+++G  +GTGLL+    SL   GP  +
Sbjct: 54  EDQNDSYNV-DGK---TEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSM 109

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           LI Y  V ++ +  M + GEMA +Y  L G F +Y++ +     GFA  + +  ++  + 
Sbjct: 110 LIAYAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILP 167

Query: 162 PLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIV 219
           P +L  A +VI+YW  +  VN  V++ IF + I+ I+  G + +GE EF  +  KVL++ 
Sbjct: 168 PNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMF 227

Query: 220 GFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPL---DKLKGTAYVLVTAY--FSFG 274
             +I+  ++ +G   +   +G R+W++PG+F + +P    D  K  A+V V  Y  F++ 
Sbjct: 228 ALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYL 287

Query: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM--GSGSN 332
           G EL  + V E  NP+ ++P A K  +YRI++ YL++++++G  V +D   L+   + S 
Sbjct: 288 GTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKST 347

Query: 333 DVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLD 392
               SP+V+AI   G+KVLPHI NA +L+ V S  NS +Y A R L +LA    APK   
Sbjct: 348 SAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFA 407

Query: 393 YIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFR 452
             +R G P  SL L  +F L+A+ + S    KIF +   +  +  L +W  I +++  F 
Sbjct: 408 RTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFD 467

Query: 453 QAMKLQGRSLETLGYRAITGQWGSLYAVFF-NLLVFIAQFWVALVPIAKKKVDVLSFFQN 511
           +A++ QG    T  Y A   ++G+ +A+FF +L+  I  F V L      + D  +F   
Sbjct: 468 RAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFL----GHQFDYKTFITG 523

Query: 512 YMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL--KQEEYEFKERMR 567
           Y+  P++ I + GY +  +   +++PL+ +DL T +   D E    K E+   KER++
Sbjct: 524 YIGIPVFFISYFGYKLIYKT-KIIDPLE-VDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>Kwal_33.15545
          Length = 576

 Score =  249 bits (635), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 161/520 (30%), Positives = 276/520 (53%), Gaps = 18/520 (3%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           E   +   + +G     +  +L++ +  RHV M+++G  +GTGLL+   +SL   GP  +
Sbjct: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSI 88

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           LI Y  V ++ Y +M   GEMA   P L G F +Y+S ++    GFA  + +  ++  V 
Sbjct: 89  LISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146

Query: 162 PLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIV 219
           P +L    +V+++W  +  VN  V++ IF   I+ I+  G R +GE EF  +  KVL+++
Sbjct: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVML 206

Query: 220 GFVIVGILINVGAIGDTGYIGDRYWRNPGSF------VSGTPLDKLKGTAYVLVTAYFSF 273
           G +++  +I +G   +    G R+WR+PG+F      +SG+   K    A V   A F++
Sbjct: 207 GLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSK-GKFVSFASVFALALFAY 265

Query: 274 GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG--S 331
            G EL  +   E  NP+ ++P A K  +YRI++ Y++T++++G  V ++  RL+ +   +
Sbjct: 266 TGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMA 325

Query: 332 NDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQL 391
                SP+V+AIE   + VLPHI N  +L+ V S  NS +Y A R L  LA  G AP+  
Sbjct: 326 TSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIF 385

Query: 392 DYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRF 451
              ++ G P  SL L  +F L+A+   S    ++F +   +  +  L +W +I +++ RF
Sbjct: 386 ATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRF 445

Query: 452 RQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQN 511
            +A+++Q     +L Y A    W +  A+FF  L+ + + +   +     K D  +F   
Sbjct: 446 DKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISG 502

Query: 512 YMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYD 551
           Y+  P++LI ++GY V  R   L+ P D +DL T +   D
Sbjct: 503 YIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKDAID 540

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  245 bits (625), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 163/553 (29%), Positives = 277/553 (50%), Gaps = 58/553 (10%)

Query: 45  SRSGDLEDGEINSTDTT--KLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLL 102
           S S   E    + TD T  +L+Q +++RHV +++LG  IGTGL V  +++LH  GPAGL 
Sbjct: 55  SLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLF 114

Query: 103 IGYLLVSIVSYIMMHAAGEMAVAYP---TLPGNFNAY-SSIFISKPFGFATVWLFCLQWL 158
           I Y ++S V Y +M   GEM    P   + P  F AY    ++ +  GFA  W +   ++
Sbjct: 115 ISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYV 174

Query: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218
            +   E   A+ V++YW  SV    ++ IF   ++ ++F   + YGE+EF F   K+L I
Sbjct: 175 ILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCI 234

Query: 219 VGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVS-------GTPLDKLKGTAYVLVTAYF 271
           VG +I+  ++  G   +   +G RYW+NPG F         G+ LD   G    ++   F
Sbjct: 235 VGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTG----IIKGGF 290

Query: 272 SF-GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL---M 327
           +F  G E+ A++ +E+ + +  I  A ++ V+R++  Y+L  + I  +V ++   L   +
Sbjct: 291 AFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENAL 350

Query: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387
                    SP+V+ I+  G+KVLPHI+NA IL S  S GN+ M+++ R L  +AQ G A
Sbjct: 351 AQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQA 410

Query: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           P+    ++R G P  ++ L +    +A+   S +   +F W + I+ +S    W  +C++
Sbjct: 411 PRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIA 470

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLL------------VFIAQFWVAL 495
           + RF +A+   G     L Y A     G  Y +++ LL            VFI +FW   
Sbjct: 471 YIRFHKAILFHGMQ-SRLPYTAR----GMPYLIYWPLLVISIITLTNGYEVFIPRFW--- 522

Query: 496 VPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL 555
                   D  +F   Y+  P++ ++++G+ VY R            L   + + +++V+
Sbjct: 523 --------DAKNFVAAYITLPVFWVLWIGHRVYRRK--------IFTLKWWKSIEEIDVV 566

Query: 556 KQEEYEFKERMRN 568
              E E +E+ R 
Sbjct: 567 TGVE-EIEEKTRE 578

>Kwal_26.6940
          Length = 570

 Score =  239 bits (610), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 278/534 (52%), Gaps = 28/534 (5%)

Query: 43  DTSRSGDLEDG--EINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAG 100
           DT     L  G  E    +   L+Q +++RH+ +++LG  IGTGL V  +++L   GPAG
Sbjct: 27  DTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAG 86

Query: 101 LLIGYLLVSIVSYIMMHAAGEMAVAYP----TLPGNFNAYSSIFISKPFGFATVWLFCLQ 156
           LL  Y+++S+V Y +M+A GEM    P       G+ +   S +     GFAT W +   
Sbjct: 87  LLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYC 146

Query: 157 WLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVL 216
           ++ +   E   A+ V+ YW   V    ++ IF   +  ++F   + YGE+EF F + K+L
Sbjct: 147 YVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKIL 206

Query: 217 MIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFV-------SGTPLDKLKGTAYVLVTA 269
            IVG + V  ++  G       +G RYW+ PG+F        +G  LD   G    ++  
Sbjct: 207 CIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTGNTGRFLDVWTG----VIKG 262

Query: 270 YFSF-GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL-- 326
            F+F  G EL A++ +E  + +  I  A ++  YR++  Y+ + + IG +V  +   L  
Sbjct: 263 GFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRD 322

Query: 327 -MGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
            + SG      SP+V+AI+   +K+LPHI+NA IL S  S GNS M++A R L ++A+ G
Sbjct: 323 ALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDG 382

Query: 386 YAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSIC 445
            APK    I+R G P  ++ + A F  +A+   S    K F W + I+ +S    W  I 
Sbjct: 383 VAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIG 442

Query: 446 LSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDV 505
           +++ RFR+A+  +G   + + +++    +G+ + +    ++ +   +   +P   K  D 
Sbjct: 443 VAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGAD- 500

Query: 506 LSFFQNYMAFPLWLIMFLGYMVYSRNW-TLLNPLDKMDLDTHRRVYDVEVLKQE 558
             F   Y+  P+++++++G+ +Y+R   T + P+ ++D+ T   + ++E L +E
Sbjct: 501 --FVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTTG--LAEIEELTKE 550

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  236 bits (602), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 169/578 (29%), Positives = 288/578 (49%), Gaps = 29/578 (5%)

Query: 1   MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDT 60
           M+ +   + +E + +     P  A+       R    S  +E  S   +  DG+    + 
Sbjct: 1   MAEEKFAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQSVDWNY-DGK---HEG 56

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
            +L++ ++ RHV M+++G  +GTGLL+   +SL   GP  +LI Y ++  V + +M   G
Sbjct: 57  IRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLG 116

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW--KVS 178
           EMA AY  L G F +Y++ +     GFA  W +  ++L + P +L    +VI++W     
Sbjct: 117 EMA-AYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAAR 174

Query: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY 238
           V+  V++ +    I+ I+  G R +GE EF  +  KVL+++  +I+ +++ +G       
Sbjct: 175 VSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDR 234

Query: 239 IGDRYWRNPGSFVSGTPLD--------KLKGTAYVLVTAYFSFGGMELYALSVNELPNPK 290
           +G RYW +PG+F   +  D        K      V V A F++ G EL  +   E  +P+
Sbjct: 235 LGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPR 294

Query: 291 TAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM--GSGSNDVHPSPYVLAIEMHGV 348
             +P A K  +YRI++ YL+T+ ++G  V ++   LM   S       SPYV+AIE   +
Sbjct: 295 RNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVI 354

Query: 349 KVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCA 408
            VLP++ NA +L  V S  NS +Y   R L  LA  G APK     ++ G P  +L  C 
Sbjct: 355 PVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCT 414

Query: 409 IFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYR 468
           +F  +A+ + S +    F +   +  +  L +W SI +++  F +A + QG    TL Y 
Sbjct: 415 LFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYV 474

Query: 469 AITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGY-MV 527
           A    +    A+ F + V + + + A +    K+VDV +F   Y+  P+++  F+GY +V
Sbjct: 475 APCQPYAGWVALIFCIFVALIKNFDAFI---GKEVDVPTFITGYIGLPIYIFCFIGYKIV 531

Query: 528 YSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKER 565
           +   W    P  ++DL T +   D+E    EE   +ER
Sbjct: 532 HKTKWI---PSKEVDLFTFKEAIDLE----EEECIRER 562

>Kwal_26.9612
          Length = 543

 Score =  234 bits (598), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 148/501 (29%), Positives = 261/501 (52%), Gaps = 16/501 (3%)

Query: 50  LEDGEINSTDT-TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLV 108
           LE   +N  D  + +++ ++ RH+ +++LG  IG G L+    +L+ GGP  LL+G+ ++
Sbjct: 28  LETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGII 87

Query: 109 SIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITA 168
            +V + +M + GE+   YP+  G F   +  F S+     + + + + +  V   E  T 
Sbjct: 88  GLVCFSIMESIGELVTLYPS-GGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTI 146

Query: 169 TIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILI 228
           + ++++W   V    + +IF+ F +     G   +GE E+     K+L +V F I  I+ 
Sbjct: 147 SSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVY 206

Query: 229 NVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPN 288
             G I     IG +YW+NPG+   G      +G A V V     + G E  AL+  E  N
Sbjct: 207 MSGGIPGKPPIGFQYWKNPGALSHG-----FRGIAVVFVFCSTFYSGTESVALAATESRN 261

Query: 289 PKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGV 348
           P+ A+P A ++  +RIL+VYL      G  VP++ D  +G+ +  +  SP  +A+   G 
Sbjct: 262 PRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYN-DPTLGAQTKSLK-SPISIALSRAGW 319

Query: 349 KVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCA 408
               H+VNA IL++ IS  NS++Y   R L  LA +G AP+ L + D+ G P+ +LI+  
Sbjct: 320 AGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFN 379

Query: 409 IFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYR 468
             GLI+    S      + ++  ++G+     W++I ++H RFR+A   QGRSL  L YR
Sbjct: 380 ALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYR 439

Query: 469 AITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVY 528
           A+   W +++++  N+ + + Q W +LVP   K      F   Y+  P   ++++G   +
Sbjct: 440 ALFYPWTTIFSLAANIFLALIQGWTSLVPFVAKD-----FVDAYILLPAAGLLYVGINFW 494

Query: 529 -SRNWTLLNPLDKMDLDTHRR 548
            +RN+  +N +  ++L+  +R
Sbjct: 495 KNRNFKTVN-IHGINLEEGQR 514

>Kwal_23.2817
          Length = 580

 Score =  234 bits (598), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 157/537 (29%), Positives = 280/537 (52%), Gaps = 33/537 (6%)

Query: 44  TSRSGDLEDGEINSTDT----TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPA 99
           T+   D+E G ++  DT    T++ + +++RHV  ++LG  IGTGL + +  +L   GPA
Sbjct: 41  TAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPA 100

Query: 100 GLLIGYLLVSIVSYIMMHAAGEMAVAYP-TLPGNFNAYSSIFISKPFGFATVWLFCLQWL 158
            LLI Y ++S   + +M+   EM V  P +   +  + +  ++++P  F   W       
Sbjct: 101 PLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMS 160

Query: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218
            V P E+    ++I+YW    NA +FV IF +    +     + +GE+EF  ++ K+L I
Sbjct: 161 MVVPTEITACALLIEYW-TDANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTI 219

Query: 219 VGFVIVGILINVGA-IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYV-----LVTAYFS 272
           +G ++VG++I  G        +G  YW  PG+F   + L K    A++     ++ + F+
Sbjct: 220 LGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAF--NSYLVKGSTGAFLAVWKAIIKSGFA 277

Query: 273 FGGM-ELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL---MG 328
           F  + E+ +    E   P+  +P AC++ VYR+ + Y+L  ++IG +V +D+  L   + 
Sbjct: 278 FVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAIS 337

Query: 329 SGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388
           SG  +   SP+V+ I+  G+++LPHI+NA IL S  S   S +Y A R+L +LA +G AP
Sbjct: 338 SGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAP 397

Query: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448
           K    +++ G P  S+   ++FG++A+   S +   +F WL+ IA +S    W  + +++
Sbjct: 398 KFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITY 457

Query: 449 FRFRQA---MKLQGRSLETLGYRAITGQWGSLY--AVFFNLLVFIAQFWVALVPIAKKKV 503
            RFR+    +K+  R    + YR   GQ    Y  A+FF LL     F+V +        
Sbjct: 458 LRFRKITDYLKINDR----VPYRR-RGQRALAYASAIFFALLAITNGFYVFIA----GNW 508

Query: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEY 560
           +V  FF  Y+      ++F+G  +Y + WT  + +D +  +   ++   +  ++EEY
Sbjct: 509 NVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFRD-MDVVGREIMPKIDQADQEEKEEY 564

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  233 bits (595), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 161/544 (29%), Positives = 272/544 (50%), Gaps = 33/544 (6%)

Query: 36  VDSFRREDTSRSGDLEDGEINS------TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89
           VDS ++E    S  L+  E+ S           L + +  RH+ M+S+   IGTGL ++ 
Sbjct: 13  VDSGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLST 72

Query: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149
           A SLH GGPA L + Y ++  V Y+ M   GEM+   P + G+F +Y+  F S+ F  A 
Sbjct: 73  AKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMP-ISGSFCSYARKFGSESFACAL 131

Query: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVF---VVIFYLFIICIHFFGARGYGET 206
           +W +          +L    +V+ YW  + +   +    +IF+ F++ ++    R YGE 
Sbjct: 132 MWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEA 191

Query: 207 EFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRN-PGSFVSGTPLDKLKGTAYV 265
           E+   M KV+ IV F I+ I++NVG      YIG + W +    FV+G      KG A +
Sbjct: 192 EYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFVNG-----FKGFASL 246

Query: 266 LVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDR 325
            V+A F++GG E   L+  E  NP    P   K   +RIL+ Y+L+   IG  +P+D   
Sbjct: 247 FVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYP- 305

Query: 326 LMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
             G  +  V  SP+ L  +M G +     +NAVIL SVIS  N A+++  R++  +A  G
Sbjct: 306 --GLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDG 363

Query: 386 YAPKQL-DYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSI 444
           Y PK++    +R   P +++++    G +   A+      ++ WL  I G+S    W  I
Sbjct: 364 YLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCI 423

Query: 445 CLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVD 504
            ++  RFR+ +++QG++ + L ++  T  +G  + V F + + + Q W A  P +     
Sbjct: 424 GITSIRFRKGLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDPWS----- 477

Query: 505 VLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKE 564
           V  FF  Y+   ++  +++ + ++ R+W +    + MD  T R +   E++     E  E
Sbjct: 478 VTDFFSVYLELFVFPFVYIIWWLWKRDWFV--KYEDMDFVTDRYIPTKEIV-----ELNE 530

Query: 565 RMRN 568
           R+ N
Sbjct: 531 RLDN 534

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  232 bits (591), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 155/522 (29%), Positives = 256/522 (49%), Gaps = 18/522 (3%)

Query: 51  EDGEINSTD-TTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVS 109
           ED +++  D  T +++ ++ RH+ +++LG  IG G LV    +L+ GGP  LL+G+ ++ 
Sbjct: 36  EDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIG 95

Query: 110 IVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITAT 169
           I+++ +M + GEM   YP+  G F   +  F S        + + + +  V   E  T +
Sbjct: 96  IIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLS 154

Query: 170 IVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILIN 229
            ++++W   V    +++IF+         G   +GETE+     K++ +V + I  I+  
Sbjct: 155 SILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYI 214

Query: 230 VGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNP 289
            G I +    G  YW +PG+   G      KG A V V     + G E  AL+  E  NP
Sbjct: 215 SGDIRNRPAFGFHYWNSPGALSHG-----FKGIAIVFVFCSTFYSGTESVALAATESKNP 269

Query: 290 KTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVK 349
             A+P A ++ ++RIL+VY+   +  G  VP D   L  S S  V  SP  +AI   G  
Sbjct: 270 GKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL--SASTKVLKSPIAIAISRAGWA 327

Query: 350 VLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAI 409
              H+VNA ILI+ IS  N ++Y   R L  LA +G APK L + DR G P+ ++ +   
Sbjct: 328 GGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNA 387

Query: 410 FGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRA 469
            GLI+    S      + ++  ++G+     W  I  +H R R+A   QGRS+E L Y A
Sbjct: 388 LGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEA 447

Query: 470 ITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYS 529
           +   W  + ++  N+ + + Q W   VP      D  +F   Y+  P+ +++++G  V+ 
Sbjct: 448 LFYPWTPVLSLAANIFLALIQGWSYFVPF-----DAGNFVDAYILLPVGILLYIGICVFK 502

Query: 530 RNWTLLNPLDKMDLDTHRRVYDVEV-LKQEEYEF--KERMRN 568
            N      L  ++LD  RR  D+E  L  +E      E M++
Sbjct: 503 SNHFRTVDLRSINLDEGRR-KDMEADLSDQESSLASSETMKD 543

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  230 bits (586), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 150/526 (28%), Positives = 262/526 (49%), Gaps = 27/526 (5%)

Query: 48  GDLEDGEINSTDTTKLQQR----MRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLI 103
           GD + G  +  +  K  Q+    ++TRH+ +++LG+ IGTGL + +  +L   GPA LLI
Sbjct: 36  GDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLI 95

Query: 104 GYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYS--SIFISKPFGFATVWLFCLQWLTVF 161
            Y+++S   + +M+   EM    P LPG  + YS    +++ P  F   W        + 
Sbjct: 96  AYIIISFFVWSIMNQMTEMVCLIP-LPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIV 154

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
           P E+    ++++YW    N+ +F+ IF +  I +     + +GE+EF  +  K+L IVG 
Sbjct: 155 PAEITACALLVQYW-TDANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGL 213

Query: 222 VIVGILINVGAIGDTGYI-GDRYWRNPGSF---VSGTPLDKLKGTAYVLVTAYFSFGGME 277
           +IVGI+I  G      ++ G  YW+NPG+F   ++     +       ++ + FSF  + 
Sbjct: 214 IIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVP 273

Query: 278 LYALSVN-ELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMG---SGSND 333
               S + E   P+  +P AC++ +YR+ + Y++  +++G +V  ++DRL+    SG +D
Sbjct: 274 ETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSD 333

Query: 334 VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDY 393
              SP+V+ I+  G+K+LPHI+NA IL S  S G   +Y + R L ++A +G APK    
Sbjct: 334 AAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAK 393

Query: 394 IDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQ 453
           ++R G P  S  L ++F  +A+   S +   +F WL+ IA +S   +W  + +++ RFR+
Sbjct: 394 VNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRK 453

Query: 454 AMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYM 513
            +     +      R        L   FF +L     + V      K   +V  FF +Y+
Sbjct: 454 VINALDLNDRVPFRRPFQVPLAYLTCGFFFILSLTNGYAV----FVKGNWNVSDFFASYV 509

Query: 514 AFPLWLIMFLGYMVYSRNWTL-------LNPLDKMDLDTHRRVYDV 552
                + ++L    Y + WT        +  L K+D+       DV
Sbjct: 510 TIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERNDV 555

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  226 bits (577), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 146/520 (28%), Positives = 266/520 (51%), Gaps = 24/520 (4%)

Query: 43  DTSRSGDLEDGEINS---------TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASL 93
           D    G+   G +N           D   L++ + +RH+ +++LG  IGTGL V  +++L
Sbjct: 17  DVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTL 76

Query: 94  HYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLF 153
           H  GP  L + ++++S + Y +M+   EM + Y    G     +S ++    GFA  W +
Sbjct: 77  HNCGPLPLFLSFVIISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVDPSLGFAAGWNY 135

Query: 154 CLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMC 213
              +  +   EL  A  V++YW   V+  V++ IF + ++ ++F   + YGE+EF F   
Sbjct: 136 AYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASL 195

Query: 214 KVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF---VSGTPLDKLKGTAYVLVTAY 270
           K++ I+G +IV I+I  G       +G RYW NPG F   ++G    +       ++ + 
Sbjct: 196 KIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTGRFLDIWTAIIKSG 255

Query: 271 FSF-GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
           F+F    EL  L+  E  + +  I  A ++ ++RI+  Y+ + + IGF++  D  +L+ +
Sbjct: 256 FAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQA 315

Query: 330 GSNDV---HPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGY 386
            ++D      SP+V  I   G+ VL HI+NAVIL S  S  NS MY++ R + ALA+QG 
Sbjct: 316 LTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGD 375

Query: 387 APKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICL 446
           APK    I+R G P  ++ L      + +  AS +  ++F WL+ I  +S    W  I +
Sbjct: 376 APKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGI 435

Query: 447 SHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVL 506
           ++ RFR+A+       E + +++    + + + V F +L+ +   +   +P   K  +  
Sbjct: 436 TYLRFRKAI-FYNNLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIP---KYWNAS 491

Query: 507 SFFQNYMAFPLWLIMFLGYMVYSRN-WTLLNPLDKMDLDT 545
            F   Y+  P++ +++LG+ ++ +  W +  P  ++D+ T
Sbjct: 492 DFVAAYITLPIFFLLYLGHKIWFKTRWYI--PFREIDVIT 529

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  226 bits (575), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/514 (28%), Positives = 266/514 (51%), Gaps = 31/514 (6%)

Query: 49  DLEDGEINS--TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYL 106
            LE+ E  S  ++   L + +++RH+ +++LG  IGTGL V  + +LH  G A LL+ ++
Sbjct: 30  SLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFI 89

Query: 107 LVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELI 166
           L+S + Y +M +  EM + Y    G+     S ++    GFAT W +   +  +   EL 
Sbjct: 90  LISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELS 148

Query: 167 TATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGI 226
            A  V+ YW   V    ++ IF + ++ ++F   + YGE EF F   K++ I+G ++V +
Sbjct: 149 AAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSV 208

Query: 227 LINVGAIGDTGYIGDRYWRNPGSFV-------SGTPLDKLKGTAYVLVTAYFSFGGMELY 279
           +I  G   +    G RYW+NPG F        +G  LD  +    V+ +A+      EL 
Sbjct: 209 VIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTGRFLDVWRA---VIKSAFAFILSPELI 265

Query: 280 ALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL---MGSGSNDVHP 336
            ++  E  + +     A ++ +YRI+  Y+   +MIG ++     +L   + +G+     
Sbjct: 266 GIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAAS 325

Query: 337 SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDR 396
           SP+V  I   G+ VL H++N  IL S  S GNS MY++ R++ ALA++G APK L  I+R
Sbjct: 326 SPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINR 385

Query: 397 EGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAM- 455
            G P  ++I+C +   +A+         +F WL+ I  +S    W ++ ++  RFR+ + 
Sbjct: 386 YGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIV 445

Query: 456 --KLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQ-FWVALVPIAKKKVDVLSFFQNY 512
              LQ R    + Y+     + + Y  F  ++V +   F V L    K + +V+ F   Y
Sbjct: 446 FNNLQSR----IPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFL----KGRWNVVDFVAAY 497

Query: 513 MAFPLWLIMFLGYMVYSRN-WTLLNPLDKMDLDT 545
           +  P++L+++LG+ ++ R  W +  P++++D+ T
Sbjct: 498 VTLPIYLVLYLGHKLWFRTRWYI--PVEQIDVIT 529

>Scas_552.3
          Length = 558

 Score =  224 bits (570), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 256/517 (49%), Gaps = 28/517 (5%)

Query: 51  EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110
           ED +  +     LQ+ ++ RH+ M+S+   IGTGL ++ A SL+ GGPA L + Y ++  
Sbjct: 42  EDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGG 101

Query: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170
           V Y+ +   GEM+   P + G+F +Y+  F S+ F  A +W +          ++    +
Sbjct: 102 VVYLTLLCLGEMSTYMP-ISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQL 160

Query: 171 VIKYWKVSVN------ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIV 224
           V+ YW    +      A++      + +  IH    R YGE E+   M KV+ I+ F I+
Sbjct: 161 VMDYWDTEASGFPYWAASLLFWFLVVLLNVIH---VRFYGEAEYWLAMLKVIAIIIFFIL 217

Query: 225 GILINVGAIGDTGYIGDRYWRN-PGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSV 283
            I++NVG      YIG + W +    FV G      KG A + V+A F++GG E   L+ 
Sbjct: 218 SIVVNVGHNPQHEYIGFKNWNHGEAPFVDG-----FKGFASLFVSASFAYGGTESITLTN 272

Query: 284 NELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAI 343
            E  NP    P   K   +RIL+ Y+ +   I   +P+D     G  +  V  SP+ L  
Sbjct: 273 GEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYP---GLDTKSVVTSPFTLVF 329

Query: 344 EMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQL-DYIDREGRPLI 402
           +M G K     +NAVI+ SVIS  N A+++  R++  +  +G+ PK++    +R   P +
Sbjct: 330 QMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYV 389

Query: 403 SLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSL 462
           S+++ +  GL+ F A+      ++ WL  I G+S    W  I ++  RFR+ ++ QG++ 
Sbjct: 390 SVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH 449

Query: 463 ETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMF 522
           E L Y+  T  +G  + V F   + + Q W A  P      DV +FF  Y+   ++   F
Sbjct: 450 E-LRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDPW-----DVTNFFSYYLDLFVFPFCF 503

Query: 523 LGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
           + + +Y R+      L+ MD  T R +   E+++  E
Sbjct: 504 IIWWLYKRD--RFVKLEDMDFVTDRYIPTKEIIELNE 538

>Scas_84.1
          Length = 213

 Score =  213 bits (541), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 142/208 (68%)

Query: 217 MIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGM 276
           M+ GF I+GI++  G  G+ GYIG + W NPGSF    P+D+ KG A  L  A F+FG  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 277 ELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHP 336
           E   ++ +E  NP+ AIPSA K  +YRI+ +YL ++ ++G+LVP+DSD+L+G+       
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGAATKA 120

Query: 337 SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDR 396
           SPYVLAI +HGV+V+PH ++AVIL+SV+SVGNSA YS  R L  L+Q GYAP  L+Y+DR
Sbjct: 121 SPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVDR 180

Query: 397 EGRPLISLILCAIFGLIAFSAASDNQEK 424
            GRP+ +  +  + G+IA+ A S  + K
Sbjct: 181 NGRPMKAYCVSPLAGVIAYCATSPEEAK 208

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  223 bits (568), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 142/478 (29%), Positives = 240/478 (50%), Gaps = 17/478 (3%)

Query: 51  EDGEINSTDT----TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYL 106
           E+  +N  DT    + ++++++ RH+ +++LG  IG G L+    +L  GGP  LL+G+ 
Sbjct: 40  EEQSLNREDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFG 99

Query: 107 LVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELI 166
           ++ I+++IMM + GEM   YP+  G F   +  F S        + + + +  V   E  
Sbjct: 100 IIGILAFIMMESIGEMITLYPS-GGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYN 158

Query: 167 TATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGI 226
           T + ++++W   V    +++IF+         G   +GETE+     K+L ++ + I  I
Sbjct: 159 TLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSI 218

Query: 227 LINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNEL 286
           +   G + +    G +YW +PG+  +G      KG A V V     + G E  AL+  E 
Sbjct: 219 VYISGGVKNRPAFGFQYWNDPGALSNG-----FKGIANVFVFCSTFYSGTESVALAATES 273

Query: 287 PNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMH 346
            NP+ A+P A ++  +RIL+VYL   I  G  VP++ + L  + +  V  SP  +AI   
Sbjct: 274 KNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENL--NFATKVLKSPIAIAISRA 331

Query: 347 GVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLIL 406
           G     H+VNA ILI+ IS  N ++Y   R L  LA +G APK L + DR G P+ ++ +
Sbjct: 332 GWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITV 391

Query: 407 CAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLG 466
               GLI+    S      + ++  ++G+     W  I L+H RFR+A KLQG + + L 
Sbjct: 392 FNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELP 451

Query: 467 YRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLG 524
           Y+A       + ++  N+ + + Q W    P      D  +F   Y+  P  +I++LG
Sbjct: 452 YKAKLFPVFPIVSIIANIFLGLVQGWSYFKPF-----DAKNFVDAYILIPAGIILYLG 504

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  220 bits (561), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/538 (26%), Positives = 270/538 (50%), Gaps = 27/538 (5%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
            D+ ++G L +     +    L++ +++ H+ ++++G  IGTGL V  +++L+  GPAGL
Sbjct: 33  NDSEKNGSLPNKP--QSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGL 90

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLP------GNFNAYSSIFISKPFGFATVWLFCL 155
            I Y ++S + Y +M+A  EM    P LP      G+ +   + ++    GFA  W +  
Sbjct: 91  FISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVY 150

Query: 156 QWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKV 215
            ++ +   E   A+ V+ YW  +V    ++ IF   I+ ++      YG +E IF   K+
Sbjct: 151 CYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKI 210

Query: 216 LMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF---VSGTPLDKLKGTAYVLVTAYFS 272
             I+G +IV I++  G   +   +G R+W++PG++   ++     +L      ++ A F+
Sbjct: 211 FCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFA 270

Query: 273 F-GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS-- 329
           F  G EL  L+  E  + +  I  A ++ V+R++  Y ++ +  G +V  +   L+ +  
Sbjct: 271 FILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALS 330

Query: 330 -GSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388
            G      SP+V+ I+  G+KVLPHI+N  IL S  S GNS MY+  R L +L+Q+GYAP
Sbjct: 331 QGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAP 390

Query: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448
           K  + ++R G P   +     F  +A+   S +   +F W + I+ +S    W    +++
Sbjct: 391 KIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAY 450

Query: 449 FRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSF 508
            RFR+A+       + L ++     + + + +    ++ +   + + V    K      F
Sbjct: 451 LRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFVHWNYKD-----F 504

Query: 509 FQNYMAFPLWLIMFLGYMVYSRNWT-LLNPLDKMDLDTHRRVYDVEVLKQEEYEFKER 565
              Y+  PL+LI++LG+  Y+R W+  +  + ++D+ T  R      +++E  E   R
Sbjct: 505 IAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLR-----EIEEETKELNAR 557

>Kwal_8.590
          Length = 629

 Score =  210 bits (534), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 261/541 (48%), Gaps = 35/541 (6%)

Query: 49  DLEDGEINSTDTTKLQQR------------------MRTRHVVMMSLGTGIGTGLLVANA 90
            LE+GE  + D   LQ R                  +  R V M+ +G  IGT L V+  
Sbjct: 85  SLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIG 144

Query: 91  ASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV 150
             +  GGP  LLI + L S+V +I +     + V Y  + G+F  ++  F+ +  GFA  
Sbjct: 145 TKIIQGGPGSLLIAFCLWSVV-FIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVG 203

Query: 151 WLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIF 210
           W + +        E+    +V++YW   +     + +  +    ++ +    +GE EF  
Sbjct: 204 WTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYL 263

Query: 211 NMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF---VSGTPLDKLKGTAYVLV 267
           ++ KV++ +G +I  +++  G       +G + W NPG+F   +S   + +  G    LV
Sbjct: 264 SIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLV 323

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSD--- 324
            A + F G++    + +E  NP+  IPS+ +K   R+++ Y+   I +G L+P++     
Sbjct: 324 FALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMI 383

Query: 325 RLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQ 384
           R +  G+     SPYV A++  G++VLPHIVN +IL S+IS GNS++YSA R+L  LA  
Sbjct: 384 RAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALD 443

Query: 385 GYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSI 444
             AP+      ++G P+   I   +   +A+ + S++   +  W   +   +    +  I
Sbjct: 444 NQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFI 503

Query: 445 CLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVD 504
           C+S+ +FR+    Q   L++L Y + +  + + +++F+ +L+ +   +   +   K   D
Sbjct: 504 CVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFL---KGSWD 560

Query: 505 VLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKE 564
             SF  +Y   P +L+   G+ +Y +    + PL+ MDL T      +E L  E+  + E
Sbjct: 561 TQSFVFSYFMIPFFLVFLFGHKLY-KGTKSVRPLE-MDLFT-----GIEELADEDRYWAE 613

Query: 565 R 565
            
Sbjct: 614 N 614

>Kwal_26.8097
          Length = 544

 Score =  192 bits (489), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 159/536 (29%), Positives = 252/536 (47%), Gaps = 37/536 (6%)

Query: 44  TSRSGDLEDGEINSTDTTK--LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           TS S    D E    D  +  L + +  RH+ M+S+   IGTGL +    +L  GGPA L
Sbjct: 19  TSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPASL 78

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLT-- 159
           +I Y ++ +V Y+ M   GEM+   P + G+F +Y+  F S    F    L C  W    
Sbjct: 79  VINYSIIGLVVYLTMLCLGEMSTFMP-ISGSFCSYAKKFGSGSLAFT---LMCNYWFNDA 134

Query: 160 -VFPLELITATIVIKYWKVSVNAN----VFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214
                +L    +++ +WK S +A+       +IF+  ++ ++    R YGE E+   M K
Sbjct: 135 VSVASDLTALQLILDFWKTS-DAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLK 193

Query: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWR-NPGSFVSGTPLDKLKGTAYVLVTAYFSF 273
           V+ I+ F I+ I++N G   D  YIG + W      FV+G      KG A + V++ F++
Sbjct: 194 VIAIIIFFIISIVVNAGHNQDHSYIGFKNWSVGEAPFVNG-----FKGFASLFVSSSFAY 248

Query: 274 GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSND 333
           GG E   L+  E  NP    P   K   +RIL+ Y+ T   IG  VP++  +L       
Sbjct: 249 GGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKL---SEKS 305

Query: 334 VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGY-APKQLD 392
           V  SP+ +  +M G K     +NAVIL SVIS GN A+++  R+L  L  +GY  P  + 
Sbjct: 306 VMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIIT 365

Query: 393 YIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFR 452
             +R   P +++++    G + F ++      ++ WL  I G+S    W  I +   RFR
Sbjct: 366 KTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFR 425

Query: 453 QAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNY 512
           + +  QG++ E L +   T  +G  + V F   + + Q W +  P      +V  FF  Y
Sbjct: 426 RGLAKQGKTHE-LQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAPW-----NVTDFFSYY 479

Query: 513 MAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568
           +     LI+F+   V+   W     +   D+D    V D  +   EE    E + N
Sbjct: 480 IE----LIVFVALYVFWWLWKRDAFVRSEDMDF---VTDKYISPHEEVLLNEELDN 528

>Kwal_23.4026
          Length = 534

 Score =  187 bits (476), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/510 (26%), Positives = 252/510 (49%), Gaps = 23/510 (4%)

Query: 35  FVDSFRREDTSRSGDLEDGEINSTD--------TTKLQQRMRTRHVVMMSLGTGIGTGLL 86
           FV      DT  S   ++GE+   D        +  LQ+  + RHV M+++   IGTGL+
Sbjct: 10  FVKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLV 69

Query: 87  VANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFG 146
           +    +L  GGP  LLI ++    +   ++ +  EMA ++  +  +F+ Y++ ++    G
Sbjct: 70  IGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYATRYVDPALG 128

Query: 147 FATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGET 206
           FAT W + L++      EL    ++++YW+  ++  +F+V+F + ++ ++F   + YGE 
Sbjct: 129 FATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEV 188

Query: 207 EFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPG---SFVSGTPLDKLKGTA 263
           EF   + K L+++   + G+++  G       IG RYWR        V GT    L   A
Sbjct: 189 EFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGTTGRFLGWWA 248

Query: 264 YVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLV-PHD 322
            V+ + Y ++ G E   +   E PNPK  IP+A +  ++RI   Y++ ++++G ++ PHD
Sbjct: 249 CVIQSCY-AYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHD 307

Query: 323 SDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALA 382
              L  + ++D   SP+V+A    G+K LP  +NA++++ + S  N+A+Y   R    LA
Sbjct: 308 KT-LANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLA 366

Query: 383 QQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWT 442
           + G APK     +R G P    +L  +  L++F   S++   IF +L +   +     W 
Sbjct: 367 KDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWL 426

Query: 443 SICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKK 502
           S+ +S+  + +A        + + +R     + +   +FF  L+     + A +   K K
Sbjct: 427 SVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYK 486

Query: 503 VDVLSFFQNYMAFPLWLIMFLGYMVYSRNW 532
               SF  +Y+     + +F+G  ++ + W
Sbjct: 487 ----SFIVSYIG----IAVFIGNTLFWKFW 508

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  177 bits (448), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 149/573 (26%), Positives = 253/573 (44%), Gaps = 91/573 (15%)

Query: 63  LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEM 122
           +Q++++ RH+ M+SLG  IG GL + +  +    GP G  +GYL  ++     + +  E+
Sbjct: 229 IQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILATLLSFAEI 288

Query: 123 AVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW----KVS 178
               P + G  +   S FI   FGF+  W     +   FP ELI   I++ Y+     +S
Sbjct: 289 VALIPLITG-ISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSYYTNLQSIS 347

Query: 179 VNANVF---VVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGD 235
            N       +VI    +  ++    R YGE E+  +  K++++   +I+ I++N G + +
Sbjct: 348 TNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIVVNCGGL-N 406

Query: 236 TGYIGDRYWRNPGS------FVSGTPLDKLKGT-------------------AYVLVTAY 270
            GYIG RYW    S      F +  P   LK T                   A  LV A 
Sbjct: 407 NGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCIASTLV-AV 465

Query: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIG------------FL 318
           FS+ G E+  ++  E  NP+ A+PS  K+   R+++ YLL++ ++G            + 
Sbjct: 466 FSYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVFYLLSIFVVGLNFYSGDPRLLRYY 525

Query: 319 VPHDS--------------DRLMGSGSNDV-----------HPSPYVLAIEMHGVKVLPH 353
            P D+              D L G   N V           + SP+V+A++      L  
Sbjct: 526 SPEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFVNESSNQSPWVIALKSFKQCTLSS 585

Query: 354 IVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLI 413
           IVN V +    S  +S +Y++ R L ++A Q  AP    + +R G P +S+I CA  G +
Sbjct: 586 IVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGVPYMSVIFCAFLGFL 645

Query: 414 AFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYRA 469
           +    +     +FI    I  +  +  W S+ LS  RF  A+K +     R  +   Y++
Sbjct: 646 SLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALKRRPDIISRDSKEYPYKS 705

Query: 470 ITGQWGSLYA-VFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVY 528
               + S++  V   +LV    F        K      +F  +Y    L+++++ GY   
Sbjct: 706 PLQPYLSIFGMVSTAILVLFNGFQNFFYWNTK------NFISSYCTVVLFVVLYFGY--- 756

Query: 529 SRNW---TLLNPLDKMDLDTHRRVYDVEVLKQE 558
             NW   + +N L+ +DLD+ RR  D  + K++
Sbjct: 757 --NWFKHSQINKLENIDLDSGRREMDSIIWKED 787

>Scas_460.3
          Length = 584

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 131/546 (23%), Positives = 245/546 (44%), Gaps = 30/546 (5%)

Query: 35  FVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLH 94
           F+ +  R  TS S    D +     +   ++ +  RHV ++++   IGT + VA    L+
Sbjct: 45  FIPTTSRGTTSVSSQDNDSKTFLVASHTTKRNLVNRHVQLIAISGVIGTAIFVAIGKPLY 104

Query: 95  YGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFC 154
            GGPA LL+ + +  I    +  +  EM    P +   F   ++  +         W F 
Sbjct: 105 RGGPAFLLLAFAIWCIPILCITVSTAEMVCFMP-VSSPFLRLATKCVDDSLAVMASWNFW 163

Query: 155 LQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214
                  P E++T   +I YW+   +A + +VI  L  + I     + YGE EF     K
Sbjct: 164 FLECVQIPYEIVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLASFK 223

Query: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWRN-------PGSFVSGTPLDKLKGTAYVLV 267
           +++ +G      +  +G        G RY+ +       P     G+     +G    L+
Sbjct: 224 IVLAMGLFCFTFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYFQGFFICLI 283

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLV-PHDSDRL 326
            A F+  G E  ++   E+  P+  +P A K+   R+ +++L + + +G L  P+DS   
Sbjct: 284 QASFTIAGGEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSS-- 341

Query: 327 MGSGSNDVHP----SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALA 382
           + +  N+  P    SPYV+A+   G+++LP IVN  ++ +  S GN+  Y + R L  +A
Sbjct: 342 LTAAINEARPGAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMA 401

Query: 383 QQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWT 442
             GYAPK     +++G P+ ++ +  ++  I+    + N   +  WL  I   S+L  + 
Sbjct: 402 LDGYAPKIFTRCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFA 461

Query: 443 SICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKK 502
            +C+++  FR+A  LQ   L  L +++    + +++ +   +++ I Q +    P   K 
Sbjct: 462 ILCITYLFFRRAYLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFP---KN 518

Query: 503 VDVLSFFQNYMAFPLWLIMFLG---YMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559
            +V  F   Y      L++F+    Y+ Y   W L    DK+  D     ++ E+ + E 
Sbjct: 519 WNVQDFLFCY------LMIFINIGIYIFYKFIWRLGK--DKIK-DPATISFEDELREIEN 569

Query: 560 YEFKER 565
           +E +  
Sbjct: 570 HELEHN 575

>Scas_377.1
          Length = 148

 Score =  155 bits (391), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 104/136 (76%)

Query: 433 AGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFW 492
           +GLS+LFTW SICLSH RFR+AM++QGRS+  +G+++  G +GSLY+    +L+ IAQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 493 VALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDV 552
            ALVP+ + K DV +FF+NY+A P++++++ G+ ++ ++W L    + +DL +HR ++D 
Sbjct: 61  TALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDE 120

Query: 553 EVLKQEEYEFKERMRN 568
           E+LKQE+ E++ ++R+
Sbjct: 121 ELLKQEDEEYRRKLRD 136

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/503 (25%), Positives = 225/503 (44%), Gaps = 36/503 (7%)

Query: 7   NKFNEKTVVQTAYSPSYASPESTG--------PFRRFVDSFRREDTSRSGDLEDGEINST 58
           NK+   T    +  PS    E +G        P    V     ED   S D +D      
Sbjct: 21  NKYKTITTRIKSIEPSEGWLEPSGSVGHINTIPEAGDVHVDEHEDRGSSID-DDSRTYLL 79

Query: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
             T+ ++++  RHV ++++   IGT L VA   +L+ GGPA LL+ + L  +    +  +
Sbjct: 80  YFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVS 139

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178
             EM   +P +   F   ++  +         W F        P E+++   +I YW+  
Sbjct: 140 TAEMVCFFP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDD 198

Query: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY 238
            +A + + +  +  + I     + YGE EF     K+++ +G      +  +G  G+  +
Sbjct: 199 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLG--GNPEH 256

Query: 239 IGDRY-WRNPGS------FVSGTPLDK----LKGTAYVLVTAYFSFGGMELYALSVNELP 287
             DRY +RN G       F  G  + K     +G    L+ A F+  G E  ++   E+ 
Sbjct: 257 --DRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVK 314

Query: 288 NPKTAIPSACKKGVYRILLVYLLTMIMIGFLV-PHDSDRLMGSGSNDVHP----SPYVLA 342
            P+  +P A K+   R+  ++L + + +G +  P+D D  + +  N+  P    SPYV+A
Sbjct: 315 RPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPD--LTAAINEARPGAGSSPYVIA 372

Query: 343 IEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLI 402
           +    +++LP IVN  ++ +  S GN+  Y + R    +A  GYAPK     +R G P+ 
Sbjct: 373 MNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIY 432

Query: 403 SLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSL 462
           S+ +  ++ L++    + N   +  WL  +   S+L  +  +C+ +  FR+A  +Q  SL
Sbjct: 433 SVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSL 492

Query: 463 ETLGYRAITGQWGSLYAVFFNLL 485
             L +R+    WG  Y     L+
Sbjct: 493 PKLPFRS----WGQPYTAIIGLV 511

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  166 bits (419), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 145/584 (24%), Positives = 266/584 (45%), Gaps = 96/584 (16%)

Query: 63  LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEM 122
           +Q+++  RH+ M++ G+ +G GL + +  +    GP G L+GY+L   +      +  E+
Sbjct: 257 VQRKLEARHIQMIASGSSLGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVMASTLSFTEL 316

Query: 123 AVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNAN 182
               P   G F+  +S F+   FGFA  WL+   ++   P +++ +T+++ Y++ S+N +
Sbjct: 317 CALIPLTSG-FSGLASRFVEDAFGFALGWLYWFSFIIAVPSQVVASTMLLNYYQ-SLNLS 374

Query: 183 V-----FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVG--AIGD 235
                 FV +F +F I I+    R +G   +   + K++  +  + V I++N G  A+G 
Sbjct: 375 SGKIAGFVTLFLVFAIFINLCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLNSGGAALGH 434

Query: 236 TGYIGDRYW----RNPGSF-----------------VSGTPLDKLKGTAYVL--VTAYFS 272
              +G R+W      PG F                 +SG    K +  A  L  + A F+
Sbjct: 435 D-RVGFRFWDAGKSAPGLFYGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLSMLIAAFT 493

Query: 273 FGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL------ 326
           + G+E+  ++  E+ NPK A+PSA KK +Y +LL+Y +++ ++G  +     RL      
Sbjct: 494 YSGIEMTFVASCEVRNPKKALPSAMKKTLYIMLLIYTISIFVVGLNIYSGDPRLPRFYTY 553

Query: 327 MGSGSN-----------------------------DVHPSPYVLAIEMHGVKVLPHIVNA 357
               SN                             D + S +V+A+   G      ++N 
Sbjct: 554 SQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGSLLSDGNRSAWVIALRSFGRCTFASVLNG 613

Query: 358 VILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSA 417
           +++    + G S++Y A   L ++A QG AP+        G P I++++  IFG+I++ A
Sbjct: 614 ILIFYGATSGCSSLYGASHTLYSMAIQGKAPRICKACTSYGVPWIAVLVSGIFGVISYMA 673

Query: 418 ASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYR----- 468
              +    F  LA I+  +    W  + +S  RF  A+K++     R      YR     
Sbjct: 674 VDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKIRPDIMSRDDPMFPYRSPFQP 733

Query: 469 --AITGQWGSLYAVFF-NLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGY 525
             +  G +GSL  +FF     F   FW           ++  FF  Y     ++++++GY
Sbjct: 734 YLSYYGLFGSLVMIFFAGFTSFFHGFW-----------NIKIFFSCYGGLVFFIVLYIGY 782

Query: 526 MVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQE-EYE--FKERM 566
            ++    + L  LD++D+D  R   D  +  Q+ EY+  +KER+
Sbjct: 783 KLFGT--SKLQRLDQIDMDIGRIELDRTIWNQQTEYQGNWKERL 824

>Scas_682.30
          Length = 845

 Score =  164 bits (416), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 154/624 (24%), Positives = 276/624 (44%), Gaps = 89/624 (14%)

Query: 20  SPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTK--LQQRMRTRHVVMMSL 77
           S S+   ES G    F D  RR+      DLE    N    TK  +Q+++R RH+ M+S+
Sbjct: 226 SKSHIIEESPGSMTSFTDRERRKSI-LPFDLEK-MFNDPGNTKYYVQRKLRVRHIQMLSI 283

Query: 78  GTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYS 137
           GT    G  + +  +    GP G L+G+ L   +    + +  E++   P   G F+  +
Sbjct: 284 GTCFSVGFFLTSGRAFSIAGPFGTLLGFALAGSIVLATLLSFTELSTLIPVSSG-FSGLA 342

Query: 138 SIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK-VSVNANV---FVVIFYLFII 193
           S F+   FGF   W +    +  FP E+ ++T  + Y++ +++       FV +F  + I
Sbjct: 343 SRFVEDAFGFGLGWTYWFSCMIAFPSEVASSTFYLSYYQHLNLTRGAIAGFVTLFSSYSI 402

Query: 194 CIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY-----IGDRYWRNPG 248
            I+    R  GE  +I  + K+L+ +  + V ++IN G     GY     +G R+W +  
Sbjct: 403 IINLLDVRILGEATYIIGLSKILITIVIIFVMVIINAGH----GYKIHNQVGFRFWDSSK 458

Query: 249 SF---------------------VSGTPLDKLKGTAYVLVT--AYFSFGGMELYALSVNE 285
           S                       +G P    +  A +LV   + F+F G+E+  ++  E
Sbjct: 459 SVGDLTYGLFRPTFDLGDVGRGSTNGIPGATGRFLAVILVMLISTFAFSGVEMTFMASGE 518

Query: 286 LPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHD----------------------- 322
             NP+  IPS+ K+    +L VY+L +  +G  +                          
Sbjct: 519 AINPRKTIPSSIKRTFSIVLTVYMLAIFAVGINIYSGDPRLLSYFAKYSSERYTSTINGI 578

Query: 323 ------SDRLMG-------SGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNS 369
                 SDR  G       S S+ ++ SP+VLA++  G+      +N +++    + G S
Sbjct: 579 GTDWQLSDRCKGVYTEREHSTSHAIYTSPWVLALQSFGLCTFASALNGILIFFTSTAGVS 638

Query: 370 AMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWL 429
           ++Y++ R + A++ Q  AP      ++ G P +++I   +F +IA+ A +    + F  L
Sbjct: 639 SLYNSSRTIYAMSVQRKAPLIFQRCNKRGVPYVAVIFSGVFYIIAYLAVNVGSSRNFDVL 698

Query: 430 AAIAGLSELFTWTSICLSHFRF----RQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLL 485
             I+  S    W+ + +S  RF    +Q   L  R+ +T  Y++    + S Y + F  L
Sbjct: 699 VNISSASTSIIWSGLNISFIRFYFALKQRKDLISRNDKTYPYKSPFQPYLSFYGL-FGCL 757

Query: 486 VFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDT 545
           +F+   ++      K +    SFF  Y    L+ I++ G+ +     + +  LD++D+DT
Sbjct: 758 IFV--IFMGFPNFIKGQWSTRSFFSAYGGLFLFAILYAGFKIIGT--SKIQRLDQIDMDT 813

Query: 546 HRRVYDVEV-LKQEEYE--FKERM 566
            RR  D  V  +  EY   +KE +
Sbjct: 814 GRREMDRIVWTEHSEYATPYKENL 837

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  164 bits (414), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 140/591 (23%), Positives = 256/591 (43%), Gaps = 94/591 (15%)

Query: 57  STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMM 116
           +T    +Q++++ RH+ M+S+G     GL + +  +    GP G L+G+ L   +    M
Sbjct: 271 ATRKYHIQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPFGTLLGFGLTGSIILATM 330

Query: 117 HAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK 176
            +  E++   P   G F+  +S F+   FGFA  W + +  +   P ++ ++T  + Y+ 
Sbjct: 331 LSFTELSTLIPVSSG-FSGLASRFVEDAFGFALGWTYWISCMLALPAQVSSSTFYLSYYN 389

Query: 177 -VSVNANV---FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232
            V+++  V   F+ +F  F I ++       GE  ++  + KV++ +  V   I++N G 
Sbjct: 390 NVNISKGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGISKVIIAILMVFTMIILNAGH 449

Query: 233 IGDTGY-IGDRYWRNPGSF------------------------VSGTPLDKLKGTAYVLV 267
             D    +G RYW +  S                         +SG P  +   TA V++
Sbjct: 450 GNDIHEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEGSKKGISG-PKGRFLATASVML 508

Query: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327
            + F+F G+E+  L+  E  NP+  IPSA K+    +L+ Y+  +  +G  +     RL+
Sbjct: 509 ISTFAFSGVEMTFLASGEAINPRKTIPSATKRTFSIVLISYVFLIFSVGINIYSGDPRLL 568

Query: 328 ----------------GSGSN-------------------DVHPSPYVLAIEMHGVKVLP 352
                           G+G +                     + SP+V+A++  G+    
Sbjct: 569 SYFPGISEKRYEAIIKGTGMDWRLRTNCRGGIDYRQISVGTGYSSPWVVALQNFGLCTFA 628

Query: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412
              NA+++    + G S+++S  R L A++ Q  AP   +   + G P +S+I  ++F +
Sbjct: 629 SAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGVPYVSVIFSSLFSV 688

Query: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYR 468
           IA+ A      + F  LA ++  S    W  + LS  RF  A+K +     R+  +  Y+
Sbjct: 689 IAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRKDIISRNDSSYPYK 748

Query: 469 -------AITGQWG-SLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLI 520
                  AI G  G SL+ +F     FI  FW              +FF  Y     + I
Sbjct: 749 SPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFW-----------STKAFFSAYGGLMFFFI 797

Query: 521 MFLGYMVYSRNWTLLNPLDKMDLDTHRRVYD-VEVLKQEEY--EFKERMRN 568
            +  Y V     + +  LD++D+D+ RR  D  +  +  +Y   ++ER + 
Sbjct: 798 SYTAYKVLGT--SKIQRLDQLDMDSGRREMDRTDWTEHSQYLGTYRERAKK 846

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  162 bits (411), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 134/565 (23%), Positives = 249/565 (44%), Gaps = 86/565 (15%)

Query: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
           D   +Q++++ RH+ M+++G  IG GL + +  +    GP G L+G+ +   V    M +
Sbjct: 275 DRYHIQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLS 334

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178
             E++   P   G F+  +S F+   FGFA  W + L +   FP ++I +  ++ Y++  
Sbjct: 335 FTELSTLIPISSG-FSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASVFMLSYYEKV 393

Query: 179 VNANV----FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV-GAI 233
           V   +     V +F+L+    +    R + E  +I    KVL+ +  +I+ + +NV G  
Sbjct: 394 VATRISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVD 453

Query: 234 GDTGYIGDRYWRNPGSFVSGT-----PLDKLKGTAY------------------VLVTAY 270
           G +G IG R+W +  S    T     P   L  T                    V++ + 
Sbjct: 454 GKSGAIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLIST 513

Query: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG 330
           +SF G+E+  ++  E  NP+  +PSA K+   +I+ +Y+L++  +G  +     RL+  G
Sbjct: 514 YSFNGVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYG 573

Query: 331 -----------------------SNDV---------HPSPYVLAIEMHGVKVLPHIVNAV 358
                                    D+         + SP++LA++  G+  L    N V
Sbjct: 574 VDVPTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQSFGLCSLASAFNGV 633

Query: 359 ILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAA 418
           ++   IS  +S+++++ R L ++A Q  APK        G P I+++    FG+IA+ + 
Sbjct: 634 LVFFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYISV 693

Query: 419 SDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYRAITGQW 474
           +++    F  L++IA  +    W  + +S  RF  A+K +     R   T  YR+    +
Sbjct: 694 AESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQPF 753

Query: 475 GSLYA--------VFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYM 526
            S Y         +F     F+  FW              SF  +Y     ++  +  Y 
Sbjct: 754 LSFYGLIGSGLVVIFMGFTNFLHGFW-----------STRSFLSSYGGLIFFITSYFAYK 802

Query: 527 VYSRNWTLLNPLDKMDLDTHRRVYD 551
           ++    + +  L+++D+DT RR  D
Sbjct: 803 LFGA--SKIQSLEQLDMDTGRREMD 825

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  160 bits (405), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 154/640 (24%), Positives = 284/640 (44%), Gaps = 107/640 (16%)

Query: 15  VQTAYSPSYASP---ESTGPFRRFVDSFRREDT--------SRSGDLEDGEIN------S 57
           ++  Y+ S+AS    ++ GP   F+D F+ ED         + S ++++  I+      S
Sbjct: 158 IEMNYTNSHASTAIIDNIGPELDFID-FKFEDNDIMKIQEVTVSDNIDEVPIDNHHRRKS 216

Query: 58  TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMH 117
              T LQ++++ RH+ M+SLG  IG GL + +  +    GP G  IG+L  ++V    + 
Sbjct: 217 RHNTSLQRKLKIRHLQMISLGATIGVGLFLNSGRAFSIAGPMGAFIGFLYGALVILATLF 276

Query: 118 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW-- 175
           +  EM    P + G  +   S F+   FGF   W   L +   FP ELI + I+I Y+  
Sbjct: 277 SFAEMVAFIPLITG-ISGLCSRFVGDSFGFTVGWCHWLSYAVAFPSELIASAIMISYYTP 335

Query: 176 --KVSVNA---NVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230
             KV+ +     + V I  + +  I+    R Y E E+I ++ K+ +++  +++ +++N 
Sbjct: 336 FEKVATDNLYLGLTVTILIIVLTGINLLDVRIYAELEYIMSVFKLAVVLFLLVLVLILNC 395

Query: 231 GAIGDTGYIGDRYW---RNPGSFVSGTPL--------------DKLKGTAYVL------- 266
           G   + GY+G ++W   R+P   V+  P                 + G   VL       
Sbjct: 396 GGFRN-GYLGFKFWTKDRSPSPDVTFGPFRPTFDLNDYGSGSKQGIGGFGGVLLSCITCS 454

Query: 267 VTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL 326
           V++ FS+ G E+  ++  E  NP+ A+PS  K+   R++L YLL++ M+G ++     RL
Sbjct: 455 VSSIFSYIGSEIGFIAAPEAENPRKAVPSVTKRIFVRVVLFYLLSIFMVGTVIYAGDPRL 514

Query: 327 M-------------------------GSGSN-----------DVHPSPYVLAIEMHGVKV 350
           +                         G   N             + SP+V+A +      
Sbjct: 515 LRIISDNSKVTDQNLEKFMLIIDQLGGMNCNTRLQNDNIFQESSNQSPWVIAFKAVKQCD 574

Query: 351 LPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIF 410
           L +++N V +   IS  +S +Y++ R L ++A Q  AP    +    G P +S++ C   
Sbjct: 575 LANVINGVFVCIGISAASSQLYASSRTLYSMATQNKAPSVFTWCTNGGVPYVSILFCGSL 634

Query: 411 GLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLG 466
           G ++         +  +   +I     +  W  + LS  RF  A+K +     R+ +   
Sbjct: 635 GFLSLLCFDLRSTEALLLFISIGITGSVVMWFGMNLSFLRFYMALKRRPDIIDRNSKEYP 694

Query: 467 YRAITGQW----GSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMF 522
           Y++    +    G     F  L+  I  F+V             +F  +Y+   ++++++
Sbjct: 695 YKSPFQPYLCIFGMASTTFLLLMNGIQNFFVW---------KTANFISSYLIIVIFIVLY 745

Query: 523 LGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEF 562
            GY V     + +N L+++DLD+ RR  D  VL +E  ++
Sbjct: 746 SGYNVVRT--STINRLEQIDLDSGRREMD-RVLWKENADY 782

>Kwal_23.3847
          Length = 579

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/465 (25%), Positives = 215/465 (46%), Gaps = 15/465 (3%)

Query: 37  DSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYG 96
             F  E    S  LE  +  S DT    +++  RHV+++ +   IGT L V+   +L++G
Sbjct: 39  SEFAFESLDLSPPLEGKQ--SLDTDATHRKLHERHVMLIGISGVIGTALFVSIGKALYHG 96

Query: 97  GPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQ 156
           G A LL+G  +  I    +  +  EM V Y  L   F   ++  +      A  W F   
Sbjct: 97  GSAFLLLGMAVWCIPMLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFL 155

Query: 157 WLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVL 216
                P E++    +I YW+   +A + +V+  +    I  F  R YGE EF     K++
Sbjct: 156 ECVQIPFEIVAVNTIIHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKII 215

Query: 217 MIVGFVIVGILINVGAIGDTGYIGDRYWRNPG------SFVSGTP-LDKLKGTAYVLVTA 269
           + +G     ++  +G        G R + +        S V GTP     +G    L+ A
Sbjct: 216 LALGLFTFTLVAMLGGNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLACLIQA 275

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            F+  G +  ++   E   P+  +P A K    R+ +++L + + +G L   + D  + +
Sbjct: 276 SFTIAGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSAN-DPDLTA 334

Query: 330 GSNDVHP----SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
             N+  P    SPYV+A++  G++ LP +VNA ++ +  S GN+  + + R L  +A  G
Sbjct: 335 AINEARPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDG 394

Query: 386 YAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSIC 445
            AP+     +R G P+ ++ +   + L++    + N   +  WL  +   S+L  +  +C
Sbjct: 395 NAPRIFRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLC 454

Query: 446 LSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQ 490
           L++  FR+A   Q  +L +L +++    + +L  +F +LL+ + Q
Sbjct: 455 LTYLYFRRAYLSQQHNLPSLPFKSWGQPYTALLGLFASLLMALVQ 499

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  155 bits (391), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 116/466 (24%), Positives = 212/466 (45%), Gaps = 25/466 (5%)

Query: 39  FRREDTSRSGDLEDGEINSTDT-------TKLQQRMRTRHVVMMSLGTGIGTGLLVANAA 91
           F  +D +RS   ++ E +S D+       T   +++  RHV  +++   IGT L VA   
Sbjct: 26  FESDDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGTALFVAIGK 85

Query: 92  SLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVW 151
            L+ GGPA LL+ + L  I    +  +  EM V++  +   F   +   + +  G    W
Sbjct: 86  PLYRGGPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPFLRLAKKCVDESLGVTASW 144

Query: 152 LFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFN 211
            F        P E+++   +I YW+   +  + +VI  +  + I     + YGE EF   
Sbjct: 145 NFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLA 204

Query: 212 MCKVLMIVGFVIVGILINVGAIGDTGYIGDRYW-RNP-------GSFVSGTPLDKLKGTA 263
             K+++ VG      +  +G        G RY+  +P       G+  +G      +G  
Sbjct: 205 SFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNEGAGKSAGYFQGFL 264

Query: 264 YVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDS 323
             L+ A F+  G E  ++   E+  P+  +P A K+   R+ +++L + + +G +V   +
Sbjct: 265 TCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCVG-IVCSPN 323

Query: 324 DRLMGSGSNDVHP----SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLC 379
           D  + +  N+  P    SPYV+A+    ++VLP IVN  ++ +  S GN+  Y + R L 
Sbjct: 324 DSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLY 383

Query: 380 ALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELF 439
            +A  GYAPK     ++ G P+ ++ +   + L++    + N   +  WL  +   S+L 
Sbjct: 384 GMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLI 443

Query: 440 TWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLL 485
            +  +C+ +  FR+A   Q   L  L +++    W   Y V   L+
Sbjct: 444 NFVFLCVIYLFFRRAYMTQKERLPELPFKS----WWQPYTVIVGLV 485

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 146/589 (24%), Positives = 257/589 (43%), Gaps = 97/589 (16%)

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
            +LQ+ ++ RH+ M+++   +  G+ + +  +    GP G L+G+++   V    M +  
Sbjct: 273 NQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIATMMSFA 332

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW---KV 177
           E+A   P   G F+  +S F+   FGFA  W +    +   P +++++T    ++   K+
Sbjct: 333 ELATLIPVSSG-FSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYFSHYDHLKL 391

Query: 178 SVNANV-FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
           +      FV +F LF + ++ F  R  GE  +I  + KVL+ +  VIV +++N G   D 
Sbjct: 392 TRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVIVMLVLNAGHGFDV 451

Query: 237 -GYIGDRYW-----RN----------PGSFVSGTPLDKLKGTA----------YVLVTAY 270
            G +  RYW     RN          P   +S   L  + G             V++ + 
Sbjct: 452 HGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRGRFIAVVSVMLVST 511

Query: 271 FSFGGMELYALSVNELPNPKTAIPSACKK----------------------GVYRILLVY 308
           F+F G+E+  ++  E  NP+  IPSA K+                      G  R+L  Y
Sbjct: 512 FAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSINIYTGDPRLLSYY 571

Query: 309 ----------LLTMIMIGFLVPHDSDR-LMGSGSNDVH---PSPYVLAIEMHGVKVLPHI 354
                     +   +   + V +  +  L G    DV     SP+VLA+E  G       
Sbjct: 572 TGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVLALENFGFCSFAAG 631

Query: 355 VNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIA 414
            NAV++    S   S++Y++ R L A++ Q  AP      DR G P +++   ++F ++A
Sbjct: 632 FNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPYVAIGFSSLFAIVA 691

Query: 415 FSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYR-- 468
           + A  D     F  L  I+  +    W  + ++  RF  A+K +     R      YR  
Sbjct: 692 YLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDIISRDDVFYPYRSP 751

Query: 469 -----AITGQWG-SLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMF 522
                ++ G  G S++ +F   + FI  +W           +  SFF +Y    L+ + +
Sbjct: 752 FQPYLSMFGLLGCSIFVLFMGFINFIHGYW-----------NTKSFFSSYGGLILFGVCY 800

Query: 523 LGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK----ERMR 567
           LGY + S   + +  LD++DLDT RR  D  +L  E  +++    ER++
Sbjct: 801 LGYKLIST--SKIQRLDQLDLDTGRREID-RILWTEHRQYRGPYSERLK 846

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  153 bits (386), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 135/540 (25%), Positives = 239/540 (44%), Gaps = 29/540 (5%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           E +S  GD       +       +++  RHV ++ +   IGT L V+   +L+ GG   L
Sbjct: 32  EHSSEVGDEASSAGFAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSL 91

Query: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161
           L+G+ L  +    +  +  EM V Y  L   F   +S  ++        W F        
Sbjct: 92  LLGFALWCVPILCITVSTAEM-VCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQI 150

Query: 162 PLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGF 221
           P E++    +I YW+   +A + +V+  +  + I  F  R YGE EF     KVL+ VG 
Sbjct: 151 PFEIVAVNSIIHYWRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGL 210

Query: 222 VIVGILINVGAIGDTGYIGDRY-WRNPGSFVSGT--PLDK----LKGTAYVLVTAYFSFG 274
                +  VG        G RY    P    S T  P+       +G    L+ A F+  
Sbjct: 211 FCFTFVTMVGGNPKRDRYGFRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIA 270

Query: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDV 334
           G +  ++   E   P+  +P A K+   R+ +++L   + +G +V   +D  + +  N  
Sbjct: 271 GPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVG-IVCSANDPDLTAAINAS 329

Query: 335 HP----SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQ 390
            P    SPYV+A+   G+K+LP IVNA ++ +  S GN+  Y + R L  LA  GYAP  
Sbjct: 330 RPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAI 389

Query: 391 LDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFR 450
               +R G P+ ++ +  ++ +++    + N   +  WL ++   S+L  +  +C+ +  
Sbjct: 390 FKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLY 449

Query: 451 FRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQ----FWVALVPIAKKKVDVL 506
           FR+A   Q  +L  L +++    + +   +   LL+ + Q    F+ AL        +V 
Sbjct: 450 FRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSAL-------WNVK 502

Query: 507 SFFQNYMAFPLWLIMFLGYM-VYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKER 565
            F   Y+   + + ++LGY  ++ R    + P  ++DL T      +E+   E +   ER
Sbjct: 503 DFLFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTTGL----LEIELHERHHGFER 558

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  152 bits (385), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/461 (25%), Positives = 203/461 (44%), Gaps = 30/461 (6%)

Query: 40  RREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPA 99
             E+   S D      N++ + KLQ R    HV ++ +   IGT L V+   +L+ GGP 
Sbjct: 34  ESEEIVISSDDNSSYFNNSTSRKLQNR----HVQLIGISGVIGTALFVSIGKALYRGGPV 89

Query: 100 GLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLT 159
            L++G+ L  I    +  +  EM V Y  +   F   +    +        W F      
Sbjct: 90  SLILGFSLWCIPILCITVSTAEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECV 148

Query: 160 VFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIV 219
             P E++    ++ YW+   +  + + +  L  I I  F  R YGETE      K+L+ +
Sbjct: 149 QIPFEIVAVNTILHYWRDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAI 208

Query: 220 GFVIVGILINVGAIGDTGYIGDRYW----------RNPGSFVSGTPLDKLKGTAYVLVTA 269
           G  +   +  +G        G RY            N GS    + +   +G    ++ A
Sbjct: 209 GLFLFTFITMLGGNPKHDRYGFRYITDTKFKQYFPNNEGS----SSMGYFQGFLACVIQA 264

Query: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329
            F+  G +  A+   E   P+  +P A K+   R+ +++L   + +G +V   +D  + +
Sbjct: 265 SFTIAGPDYVAMIAGECKLPRKVLPVAFKQVFIRLTVLFLGGCLCVG-IVCSSNDPNLTA 323

Query: 330 GSNDVHP----SPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQG 385
             N+  P    SPYV+A+   G+KVLP +VNA ++ +  S GN+  Y + R L  L+  G
Sbjct: 324 VINNPRPGAGSSPYVIAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDG 383

Query: 386 YAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSIC 445
           YAPK   Y  + G P+ ++++   +  I+      N   +  WL  +   S+L  ++ +C
Sbjct: 384 YAPKLFQYCTKSGVPINAVLVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILC 443

Query: 446 LSHFRFRQAMKLQGRS--LETLGYRAITGQWGSLYAVFFNL 484
           + +  FR+A   Q  S  L  L +++    WG  Y  +  L
Sbjct: 444 VIYLSFRRAYIKQHPSGELPELPFKS----WGQPYTAYCGL 480

>Kwal_27.11900
          Length = 726

 Score =  146 bits (368), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/499 (23%), Positives = 227/499 (45%), Gaps = 76/499 (15%)

Query: 61  TKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAG 120
           + +Q+++R RH+ M+SLG  IG GL + +  +    GP G LIG+ +   +    + +  
Sbjct: 230 STIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIGFTIGGTLILATLFSFA 289

Query: 121 EMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK---- 176
           EM    P + G  +   S F+   FGF+  W   L +   FP E+I +TI++ Y+K    
Sbjct: 290 EMVALIPLITG-ISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSEVIASTIMLSYYKNLEQ 348

Query: 177 VSVN---ANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAI 233
           ++ N     + +    + +  I+    R YGE E+  ++ K+ ++V  +I+ I++NVG +
Sbjct: 349 IATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVFLIILMIVMNVGGL 408

Query: 234 GDTGYIGDRYWRNPGSFVSGTPLDKLKGT-------------------------AYVLVT 268
            +  YIG RYW    S +  T     + T                         A  LV+
Sbjct: 409 HND-YIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVPGFGGVLLSCIASTLVS 467

Query: 269 AYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM- 327
             F++ G E+  ++  E  NP+ A+PS  K+   R+++ YLL++ ++G  +     RL+ 
Sbjct: 468 V-FAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVIMFYLLSIFVVGLNIYSGDPRLLR 526

Query: 328 -GSGSN-----------------------------------DVHPSPYVLAIEMHGVKVL 351
             +GSN                                   + + SP+V+A++      L
Sbjct: 527 YDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENIFLVDNPNQSPWVIAMQSLNQCTL 586

Query: 352 PHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFG 411
             ++N V +   IS  +S +Y++ R L ++A Q  AP    +  + G P + ++ C + G
Sbjct: 587 SSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAPALFTWCTKGGVPYMCVLFCGLLG 646

Query: 412 LIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGY 467
            ++    + +  ++F    +I  +  +  W  + LS+ RF  A+K++     R+ +   Y
Sbjct: 647 FLSLLCLNMDSAEVFFIFVSIGAMGSVIVWFGMNLSYLRFYYALKVRPDILSRNAKEFPY 706

Query: 468 RAITGQWGSLYAVFFNLLV 486
           R+    + ++Y +   +L+
Sbjct: 707 RSPCQPYLAIYGMVLAVLL 725

>Kwal_53.19461
          Length = 565

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 129/574 (22%), Positives = 250/574 (43%), Gaps = 94/574 (16%)

Query: 74  MMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
           M++ G  +G GL + +  +L  GGP G L+G+ +   +    M +  E+A   P L    
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIP-LSSGI 59

Query: 134 NAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW---KVSVNANV-FVVIFY 189
           +  +S F+   FGFA  W + L +      +++ +  ++ Y+        + V FV  F 
Sbjct: 60  SGLASRFVEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFL 119

Query: 190 LFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY--IGDRYW--- 244
           +F I  +        E  + F   K+++    +   +++N GA G   +  +G R+W   
Sbjct: 120 VFAIAGNLLDVNILAELAYGFTFFKIVITATMIFAMVILNAGA-GRHKHPRVGFRFWDAS 178

Query: 245 RNPGSFV------------------SGTPLDKLK--GTAYVLVTAYFSFGGMELYALSVN 284
           ++P +                    +G P  K +      V++ + FSF G+E+  ++  
Sbjct: 179 KSPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACG 238

Query: 285 ELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM----------------- 327
           E  NP+ ++PSA K+ +  ++++Y++++ +I   V     RL+                 
Sbjct: 239 EAANPRRSLPSATKRTIMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRA 298

Query: 328 ------------------GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNS 369
                              +   +   SP+VLA+E  G+     + NA+++I  ++   S
Sbjct: 299 FNNNWQTDQVCTAHEIVSTTDFTNGSQSPWVLALESFGLCTFSSVFNAMLVIFGVTSELS 358

Query: 370 AMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWL 429
           ++Y++ R L +++ QG AP       R+G P +++I   +FG +A+   +    +IF  L
Sbjct: 359 SLYASSRTLYSMSIQGKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQAL 418

Query: 430 AAIAGLSELFTWTSICLSHFRFRQAMKLQ----GRSLETLGYRAITGQWGSLYAVFFNLL 485
           A I+G +    W    LS  RF  A+K +     R   +  YR+    + + Y +F + L
Sbjct: 419 ANISGATISIIWFGFNLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFL 478

Query: 486 V--------FIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNP 537
           +        F+  FW           +   FF +Y    ++++ + GY +     + +  
Sbjct: 479 IVVLMGFSNFLDGFW-----------NTKMFFSSYGGLIVFILCYAGYRLLGT--SKIQR 525

Query: 538 LDKMDLDTHRRVYDVEV-LKQEEY--EFKERMRN 568
           LD++DLD+ RR  D  +  +  EY    +ER+R 
Sbjct: 526 LDQLDLDSGRREMDRMIWTEHREYTNSVRERIRK 559

>Scas_619.2*
          Length = 471

 Score =  140 bits (353), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 126/472 (26%), Positives = 228/472 (48%), Gaps = 50/472 (10%)

Query: 116 MHAAGEMAVAYPTLPGNFN--AYSSIF-----ISKPFGFATVWLFCLQWLTVFPLELITA 168
           M+A GEM V Y  LPGN +  A SS +     + +  GFA+ W +   ++ +   E   A
Sbjct: 1   MNAFGEM-VCY--LPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAA 57

Query: 169 TIVIKYWK--VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGI 226
             V++YW   + V    ++ IF   ++ ++      YGE+EF F   K+L I+G +I+  
Sbjct: 58  AGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSF 117

Query: 227 LINVGAIGDTGYIGDRYWRNPGSFVS-------GTPLDKLKGTAYVLVTAYFSFG-GMEL 278
           ++  G       +G RYW+ PG+F         G  LD   G    ++   F+F  G EL
Sbjct: 118 ILFWGGGPSHDRLGFRYWQRPGAFADHITDGTGGNFLDVYTG----VIKGGFAFVLGPEL 173

Query: 279 YALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL---MGSGSNDVH 335
            +L+ +E  + +  I  A ++ V+R+++ Y+L  + I  +V ++   L   +        
Sbjct: 174 VSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAG 233

Query: 336 PSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYID 395
            SP+V+ I+  G+KVLPHI+N  I+ S  S GN+ M+++ R L  +A  G+APK    I+
Sbjct: 234 SSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKIN 293

Query: 396 REGRPLISLILCAIFG--------LIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447
           R        + C+I G        L +         K F  +   + +S    W   C++
Sbjct: 294 R--------LRCSIRGSWLFLLILLFSLLKRLLIDSKRFQLVFKHSTISGFIGWICACVA 345

Query: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507
           + RFR+A+       + L Y+    ++   Y++F   L+ +   +   +P   +  D   
Sbjct: 346 YIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIP---RFWDYKD 401

Query: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLN-PLDKMDLDTHRRVYDVEVLKQE 558
           F   Y+  P+++++++G+ + +R+W     P+DK+D+ T   + ++E L  E
Sbjct: 402 FIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTG--LEEIEELTNE 451

>Scas_485.4*
          Length = 237

 Score =  125 bits (313), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 111/197 (56%), Gaps = 2/197 (1%)

Query: 57  STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMM 116
             +   +++ ++ RH+ M++LG  IGTGL +  +  L   GP G LI YL ++ ++Y + 
Sbjct: 11  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 70

Query: 117 HAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK 176
            + GEMA   P +  +F  +S  F+S  FG A  +++   W   F LEL     VI++W 
Sbjct: 71  QSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 129

Query: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
            +V    ++ IF++ +  ++ F  + YGE EF   + KV+ I+GF+I    +  GA G T
Sbjct: 130 FAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-GVT 188

Query: 237 GYIGDRYWRNPGSFVSG 253
           G +G RYWR+PG+F  G
Sbjct: 189 GPVGFRYWRHPGAFGPG 205

>Scas_476.4
          Length = 237

 Score =  124 bits (312), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 111/197 (56%), Gaps = 2/197 (1%)

Query: 57  STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMM 116
             +   +++ ++ RH+ M++LG  IGTGL +  +  L   GP G LI YL ++ ++Y + 
Sbjct: 11  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 70

Query: 117 HAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK 176
            + GEMA   P +  +F  +S  F+S  FG A  +++   W   F LEL     VI++W 
Sbjct: 71  QSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 129

Query: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
            +V    ++ IF++ +  ++ F  + YGE EF   + KV+ I+GF+I    +  GA G T
Sbjct: 130 FAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-GVT 188

Query: 237 GYIGDRYWRNPGSFVSG 253
           G +G RYWR+PG+F  G
Sbjct: 189 GPVGFRYWRHPGAFGPG 205

>Scas_642.22
          Length = 237

 Score =  121 bits (304), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 110/197 (55%), Gaps = 2/197 (1%)

Query: 57  STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMM 116
             +   +++ ++ RH+ M++LG  IGTGL +  +  L   GP G LI YL ++ ++Y + 
Sbjct: 11  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 70

Query: 117 HAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWK 176
            + GEMA   P +  +F  +S  F+S  FG A  +++   W   F LEL     VI++W 
Sbjct: 71  QSLGEMATFIP-VTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWT 129

Query: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
            +V    ++ IF++ +  ++ F  + YGE EF   + KV+ I+GF+I    +  GA G T
Sbjct: 130 FAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGA-GVT 188

Query: 237 GYIGDRYWRNPGSFVSG 253
           G +  RYWR+PG+F  G
Sbjct: 189 GPMSFRYWRHPGAFGPG 205

>CAGL0B02838g complement(274984..276762) highly similar to sp|P50276
           Saccharomyces cerevisiae YGR055w MUP1, High-affinity
           methionine permease, hypothetical start
          Length = 592

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 80/372 (21%), Positives = 149/372 (40%), Gaps = 43/372 (11%)

Query: 34  RFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASL 93
           +F  S + ED +   D E G+  +T+  + ++R+     + +     +GTG+   ++   
Sbjct: 40  KFSSSEKSEDDTS--DFETGQQFATELDQGEKRLGLISCIGLICNRMLGTGVFAVSSTIY 97

Query: 94  HYGGPAGL-LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV-- 150
              G  GL LI + + ++++   ++   E   A P   G  N   +IF  KP  F T   
Sbjct: 98  TLSGSIGLALILWAVGALIALAGLYVYMEFGTAIPRNGGEKNYLEAIF-KKPKFFITCMY 156

Query: 151 --WLFCLQW-----LTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGY 203
             ++F L W     +    + L  A   +  W    N     V    F   ++    R  
Sbjct: 157 ASYVFFLGWAAGNSVNTAVMFLTAANTEVTKW----NQRGIGVAVVFFCFAVNSINVRAG 212

Query: 204 GETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTA 263
              + +  + K+ +++   I G +   G +   GY       N  +   GT     K TA
Sbjct: 213 LYIQNVLGVFKLGIVIFISITGWVALAGGL-KHGYQS----HNFHNAFEGTN----KATA 263

Query: 264 YVLVTAYF----SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLV 319
           Y +V A +    SF G      ++ E+ NP   +  A    +  + ++Y+   I    +V
Sbjct: 264 YGVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSLICLAIIYIFVNIAYFAVV 323

Query: 320 PHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVN-AVILISVISVGN--SAMYSAPR 376
           P   D+L+         S  +LA +   +    H    A  L+ + ++GN  S ++S  R
Sbjct: 324 P--KDKLI--------SSKLILAADFFDICFGGHAKRVAAALVGLSALGNVMSVIFSQGR 373

Query: 377 LLCALAQQGYAP 388
           ++  L ++G  P
Sbjct: 374 IIQQLGREGVLP 385

>AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH]
           complement(286339..287967) [1629 bp, 542 aa]
          Length = 542

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query: 33  RRFVDSFRREDTSRSGDLEDGEINSTDTTKLQ----QRMRTRHVVMMSLGTGIGT----- 83
           R  +D  +R  + +    EDGE ++   T  Q    Q +R    +   LG G G      
Sbjct: 6   RDSMDLVKRHPSGQC--CEDGEKSNVGMTTCQVDEGQLLRKSFSLWSVLGVGFGLTNSWF 63

Query: 84  GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
           G+ V+    +  GGP  ++ G +++++VS  +  +  E++ AYP   G F
Sbjct: 64  GISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSLAELSSAYPHAGGQF 113

>Scas_720.18
          Length = 569

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 8/102 (7%)

Query: 37  DSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGT-----GLLVANAA 91
           D+F +   S      DG+ N+ +    +  +R    V   LG G G      G+  +   
Sbjct: 28  DTFDKNKLSTKTQELDGDANNNNG---EVHLRKSFSVWSILGVGFGLTNSWFGISASMVT 84

Query: 92  SLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
            +  GGP  ++ G +++++VS  +  +  E++ AYP   G F
Sbjct: 85  GISSGGPMMVVYGIIIIALVSICIGTSLSELSSAYPHAGGQF 126

>CAGL0H03399g complement(316110..317780) highly similar to sp|P19807
           Saccharomyces cerevisiae YGL077c HNM1 choline permease,
           hypothetical start
          Length = 556

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 14/111 (12%)

Query: 37  DSFRREDTSRSGDLEDGEINSTDTTKLQQR---------MRTRHVVMMSLGTGIGT---- 83
           D  R   TS+   + DG+  + +  K+ ++         +R    +   LG G G     
Sbjct: 5   DIERTSITSQQDSILDGQFEAKNGKKIIEQEQSIDGEVHLRKSFSLWSILGVGFGLTNSW 64

Query: 84  -GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
            G+  +    ++ GGP  ++ G ++++++S  +  + GE++ AYP   G F
Sbjct: 65  FGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLGELSSAYPHAGGQF 115

>YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline
           permease, member of the amino acid permease family of
           membrane transporters [1692 bp, 563 aa]
          Length = 563

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 7/119 (5%)

Query: 20  SPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGT 79
           S  Y  P+ +          R E+  +   L+D +         +  +R    +   LG 
Sbjct: 9   SGGYMQPDQSSNASMHKRDLRVEEEIK--PLDDMDSKGAVAADGEVHLRKSFSLWSILGV 66

Query: 80  GIGT-----GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNF 133
           G G      G+  +  A +  GGP  ++ G ++V+++S  +  + GE++ AYP   G F
Sbjct: 67  GFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQF 125

>ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH]
           (390867..392552) [1686 bp, 561 aa]
          Length = 561

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 146/363 (40%), Gaps = 40/363 (11%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
           E  + + D+E GE   T+  K  +R+     + +     +GTG+ V  A      G    
Sbjct: 23  ESNADANDVEAGEHFITELDKGDKRLGLFSSIGLICNRMLGTGIFVVPAKIFQLTGSVYF 82

Query: 102 LIG-YLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT----VWLFCLQ 156
            +G ++L ++++   ++   E   A P   G  N    IF  KP  F T     ++  L 
Sbjct: 83  ALGLWVLGALIALAGLYVYMEFGTAIPRNGGEKNYLEFIF-KKPKFFITSMYSAYVIFLG 141

Query: 157 WLTVFPLELITATIVIKYWKVSVN-----ANVFVVIFYLFIICIHFFGARGYGETEFIFN 211
           W       ++ A + +   KV             VIF+ F++      A  Y +   I  
Sbjct: 142 WAA--GNSVMAAAMFLDAGKVEATRWRERGLGVAVIFFCFLVNSLSVKAGLYFQN--ILG 197

Query: 212 MCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYF 271
           + K+  I+   I G++   G I   G  G   +R+       +P D L  +AY +V A +
Sbjct: 198 VFKIGTIIFIAITGLVALGGHI--DGAPGTENFRH-------SPSD-LSPSAYTIVNALY 247

Query: 272 ----SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327
               SF G      ++ E+ NP   +  A    +  +  +YLL  +    +VP +   ++
Sbjct: 248 QVIWSFVGYSNVNYALGEVKNPVRTLKIAGPSSLAVLGTLYLLVNVAFFAVVPME---IL 304

Query: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGN--SAMYSAPRLLCALAQQG 385
                ++ P  + +A      +       + I I + ++GN  S ++S  R++  L ++G
Sbjct: 305 KDAGMNLTPKFFDIAFGDKARRA------SAIFIGLSALGNVCSVIFSQGRIVQQLGREG 358

Query: 386 YAP 388
             P
Sbjct: 359 VLP 361

>YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity
           methionine permease [1725 bp, 574 aa]
          Length = 574

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 147/376 (39%), Gaps = 37/376 (9%)

Query: 28  STGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLV 87
           S+   ++ V +   +  + + D E G+  +T+  + ++++     + +     +GTG+  
Sbjct: 22  SSSTTKKEVSNSTVDADNGASDFEAGQQFATELDQGEKQLGILSCIGLICNRMLGTGVFA 81

Query: 88  ANAASLHYGGPAGL-LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFG 146
            ++      G  GL LI + + +I++   ++   E   A P   G  N   +IF  KP  
Sbjct: 82  VSSTIYTLCGSVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGGEKNYLEAIF-RKPKF 140

Query: 147 FAT----VWLFCLQW-----LTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHF 197
           F T     ++F L W     +    + L  A   +  W       V VV F   I  ++ 
Sbjct: 141 FITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTKWN-QRGIGVAVVFFAFLINSLNV 199

Query: 198 FGARGYGETEFIFNMCKVLMI--VGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTP 255
                      IF +  VL I   G+V +G     G + D GY    + RN      GT 
Sbjct: 200 KIGLYLQNILGIFKIGIVLFISITGWVALG-----GGLKD-GYQSHNF-RNA---FEGTE 249

Query: 256 LDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMI 315
                G    L +  +SF G      ++ E+ NP   +  A    +  + ++Y+   I  
Sbjct: 250 TATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAY 309

Query: 316 GFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVN-AVILISVISVGN--SAMY 372
             +VP D           +  S  +LA +   +         A  L+ + ++GN  S ++
Sbjct: 310 FAVVPKD----------KLISSKLILAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIF 359

Query: 373 SAPRLLCALAQQGYAP 388
           S  R++  L ++G  P
Sbjct: 360 SQGRIIQQLGREGVLP 375

>Sklu_2305.6 YGL077C, Contig c2305 10656-12281
          Length = 541

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 17/124 (13%)

Query: 18  AYSPSYASPESTGPFRRFV---DSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVM 74
           A S SY    S    +  +   D  +  +T +S  LE GE  +         +R    + 
Sbjct: 4   ALSSSYQEVSSQNGIQHLLKEEDQLQHTNTVKSCTLE-GERGA--------ELRKSFSLW 54

Query: 75  MSLGTGIGT-----GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTL 129
             LG G G      G+  +    +  GGP  ++ G +++++VS  +  + GE++ AYP  
Sbjct: 55  SILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLGELSSAYPHA 114

Query: 130 PGNF 133
            G F
Sbjct: 115 GGQF 118

>CAGL0K04367g 412204..413952 highly similar to sp|P50276
           Saccharomyces cerevisiae YGR055w high-affinity
           methionine permease, hypothetical start
          Length = 582

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 78/373 (20%), Positives = 148/373 (39%), Gaps = 41/373 (10%)

Query: 33  RRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAAS 92
           ++  +     +T  + D+E G+  +T+  + ++R+     + +     +GTG+   ++  
Sbjct: 25  KKSEEGVYSNETEEASDVETGQQFTTELDQGEKRLGLFSCIGLICNRMLGTGVFAVSSTI 84

Query: 93  LHYGGPAGL-LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV- 150
               G  GL LI + + +I++   ++   E   A P   G  N Y    + KP  F T  
Sbjct: 85  YTLSGSIGLALILWAVGAIIAISGLYVYMEFGTAIPKNGGEKN-YLEAIVKKPKFFITCM 143

Query: 151 ---WLFCLQW-----LTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARG 202
              ++F L W     +    + L  A   I  W    N     V    F   ++    + 
Sbjct: 144 YASYVFFLGWAAGNSVNTAVMFLTAADAEITKW----NQRGIGVAVVFFCFAVNAISVKA 199

Query: 203 YGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGT 262
               + +  + KV  IV F+ V   + +G     GY       N  +   GT     K T
Sbjct: 200 GLYLQNLLGIFKV-GIVLFISVTGWVALGGGLKHGYQS----HNFHNAFEGTN----KAT 250

Query: 263 AYVLVTAYF----SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFL 318
           AY +V A +    SF G      ++ E+ +P   +  A    +  + ++Y+   I    +
Sbjct: 251 AYGVVNALYNVIWSFVGYSNVNYALGEVKDPVRTLKIAGPTSMVCLAIIYIFVNIAYFAV 310

Query: 319 VPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVN-AVILISVISVGN--SAMYSAP 375
           VP   ++L+         S  +LA +   +    H    A  L+ + ++GN  S ++S  
Sbjct: 311 VP--KEKLIS--------SKLILAADFFDICFGGHSKRVAAALVGLSALGNVMSVIFSQG 360

Query: 376 RLLCALAQQGYAP 388
           R++  L ++G  P
Sbjct: 361 RIIQQLGREGVLP 373

>Scas_670.14
          Length = 585

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 153/391 (39%), Gaps = 49/391 (12%)

Query: 49  DLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL-LIGYLL 107
           D+E G+   T+  + ++++     + +     +GTG+   ++      G  GL LI + +
Sbjct: 44  DVEAGQQFVTELDQGEKKLGLVSCIGLICNRMLGTGVFAVSSTIYTLCGSIGLALIMWAV 103

Query: 108 VSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT----VWLFCLQW-----L 158
            +I++   ++   E   A P   G  N   +IF  KP  F T     ++F L W     +
Sbjct: 104 GAIIAISGLYVYMEFGTAIPKNGGEKNYLEAIF-KKPRFFITSMYAAYVFFLGWAAGNSV 162

Query: 159 TVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMI 218
               + L  A   +  W     A V V+ F  FI  +             IF +  VL I
Sbjct: 163 NTAVMFLTAAGADVTTWNQRGIA-VAVIFFAFFINSVSVKTGLYIQNALGIFKIFIVLFI 221

Query: 219 --VGFVIVGILINVGAIGDTGYIGDRYW-RNPGSFVSGTPLDKLKGTAYVLVTAYF---- 271
              G+V +G           G + D Y   N     +GT       TAY +VTA +    
Sbjct: 222 SVTGWVALG-----------GGLKDGYQTHNFHDAFAGTE----NATAYGIVTALYNVIW 266

Query: 272 SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHD---SDRLMG 328
           SF G      ++ E+ +P   +  A    +  I +VY+   +    +VP +   S +L+ 
Sbjct: 267 SFVGYSNVNYALGEVKDPVRTLKIAGPTSMVFIAIVYIFVNVAYFAVVPKEKLISSKLV- 325

Query: 329 SGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388
                +    + +    HG K     V    L +V+SV    ++S  R++  L ++G  P
Sbjct: 326 -----LAADFFDIVFGEHGKKAAAAFVGLSALGNVLSV----IFSQGRIIQQLGREGVLP 376

Query: 389 KQLDYIDRE--GRPLISLILCAIFGLIAFSA 417
               +   +    P++ L    I  LI F A
Sbjct: 377 FSNFFASSKPFDSPMVGLFQHMIICLITFLA 407

>YHL036W (MUP3) [2250] chr8 (26239..27879) Low affinity methionine
           amino acid permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1641 bp, 546 aa]
          Length = 546

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 95/462 (20%), Positives = 185/462 (40%), Gaps = 39/462 (8%)

Query: 35  FVDSFRREDTSRSGDLEDGEINSTDTTKLQ----------QRMRTRHV-----VMMSLGT 79
           F+D    + T++ G    G  +S DT + Q          +  + RH+     V++ +  
Sbjct: 18  FIDVEVGDITTKYGSTNTGSFSSMDTVEAQAIKAETARFMEVPQGRHLGVFSTVVLFVSR 77

Query: 80  GIGTGLL-VANAASLHYGGPAGLLIG-YLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYS 137
            +G+G+  V +   L+ GG   +    ++  + +++  ++   E     P   G  N   
Sbjct: 78  IMGSGIFAVPSVILLNTGGNKLIYFAIWVFSAAIAFAGLYLFLEFGSWIPKSGGRKNFLE 137

Query: 138 SIFISKPFGFATVWLFCLQWLTVFPL--ELITATIVIKYWKVSVNA-NVFVVI-FYLFII 193
             F  +P    +V   C   LT + L   ++    V+  + V+ ++ + +V I F +F +
Sbjct: 138 RSF-ERPRLLISVVFSCYSVLTGYALTGSIVFGKYVLSAFGVTDDSWSKYVSISFIIFAV 196

Query: 194 CIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSG 253
            IH    R     +      K++MIV     G L  +     TG +    W  P + V  
Sbjct: 197 LIHGVSVRHGVFIQNALGGLKLIMIVLMCFAG-LYTLFFYKSTGQVA---WDLPVTQVEK 252

Query: 254 TPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMI 313
             L  +   A   ++++F F G +      +E+ NP   +  +    +    + Y  TM+
Sbjct: 253 DSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLIICFVCY--TMM 310

Query: 314 MIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYS 373
            + +L     + ++ +G         VL  ++ G +V    +   I IS  S     +YS
Sbjct: 311 NVAYLKVLTYEEIVSAGPL----VGSVLFTKLFGPRVGGKFIAFSIAISAASNILVVIYS 366

Query: 374 APRLLCALAQQGYAPKQLDYIDRE---GRPLISLILCAIFGLIAFSAASDNQEKIFIWLA 430
             R+   + ++GY P  + ++ +      PL S+ LC  F  IA+      + + F +L 
Sbjct: 367 ISRVNQEIFKEGYLPFSI-HMSKNWPFDAPLPSISLCG-FITIAWILILPKEGESFNYLV 424

Query: 431 AIAGLSELFTWTSICLSHF--RFRQAMKLQGRSLETLGYRAI 470
           ++ G    F    + +  F  RF+   ++      T G  AI
Sbjct: 425 SMDGYGNQFFLLLVAIGLFIWRFKHKNEVPEIRASTFGVLAI 466

>Sklu_2218.2 YGR055W, Contig c2218 1631-2173
          Length = 180

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 7/128 (5%)

Query: 35  FVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLH 94
           FV S  +E ++   D+E+GE   T+  +  +R+     + +     +GTG+   ++    
Sbjct: 20  FVTS-SKEGSAEPTDVENGEQFVTELDRGSKRLGLFSCIGLICNRMLGTGVFAVSSTIFT 78

Query: 95  YGGPAGL-LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT---- 149
             G  GL LI + + +I++   ++   E   A P   G  N    IF  KP  F T    
Sbjct: 79  LSGSIGLALILWAVGAIIALSGLYVYMEFGTAIPRNGGEKNYLEYIF-PKPRFFVTSMYA 137

Query: 150 VWLFCLQW 157
            ++F L W
Sbjct: 138 AYVFFLGW 145

>YLR166C (SEC10) [3572] chr12 complement(495431..498046) Component
           of exocyst complex required for exocytosis [2616 bp, 871
           aa]
          Length = 871

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 14/147 (9%)

Query: 334 VHPSPYVLA--IEMHGVKVLP-HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQ 390
           ++ SP + A  IEM   ++    I+  +IL   I+V  S  +SA  +LC   ++ + PK 
Sbjct: 668 LNNSPEIKAQIIEMTNSQIQKMEILINIILQETITVI-STKFSA--ILCKQKKKDFVPKS 724

Query: 391 LDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFR 450
            + +D++  P I ++   I  LI   ++   + K       + G  EL+    + LSH+ 
Sbjct: 725 QELLDQDTLPAIEIV--NILNLIFEQSSKFLKGKNLQTFLTLIG-EELY---GLLLSHYS 778

Query: 451 FRQAMKLQG--RSLETLGYRAITGQWG 475
             Q   + G   + + +GY+     WG
Sbjct: 779 HFQVNSIGGVVVTKDIIGYQTAIEDWG 805

>KLLA0B13233g complement(1159097..1160833) highly similar to
           sp|P50276 Saccharomyces cerevisiae YGR055w MUP1 high
           affinity methionine permease, start by similarity
          Length = 578

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 138/365 (37%), Gaps = 44/365 (12%)

Query: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101
            D +RS  +E GE    +  K  +++     + +     +GTG+   ++      G  GL
Sbjct: 38  SDDNRS--VETGEHFDVELDKGSKKLGLISCIGLICNRMLGTGIFAVSSTIYTLSGSVGL 95

Query: 102 -LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTV 160
            LI + + +I++   ++   E   A P   G  N    IF +  F F T    C+    V
Sbjct: 96  ALIMWAVGAIIALAGLYVYMEFGTAIPRNGGEKNYLERIFPAPKF-FVT----CMYGAYV 150

Query: 161 FPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGET--EFIFNMCKVLMI 218
           F L           W    + N  V+        I  +  RG G     F F +  V + 
Sbjct: 151 FFLG----------WAAGNSVNTAVMFLTAANADITEWNQRGIGVAVVGFAFLINSVNVK 200

Query: 219 VGFVIVGILINVGAIGDTGYIGDRYWRN-PGSFVSGTPLDKL--------KGTAYVLVTA 269
           VG  I  IL  +  IG   +I    W    G    G   D            TAY +V A
Sbjct: 201 VGLYIQNIL-GIFKIGVVLFIAVTGWVALGGGLKDGYKTDNFHNAFEGTGNATAYGIVNA 259

Query: 270 YF----SFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDR 325
            +    SF G      ++ E+ NP   +  A    +  + +VY+   I    +VP +  R
Sbjct: 260 LYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSLIFLAIVYIFVNIAYFAVVPKEVFR 319

Query: 326 LMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGN--SAMYSAPRLLCALAQ 383
              +    +    + LA +    K       A +L+ + ++GN  S ++S  R++  L +
Sbjct: 320 ---TSKLILVADFFELAFKSDSAKKA-----ASVLVGLSALGNVMSVIFSQGRIIQQLGR 371

Query: 384 QGYAP 388
           +G  P
Sbjct: 372 EGVLP 376

>YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protein
            required for autophagy and vesicle formation in ER to
            Golgi transport [6588 bp, 2195 aa]
          Length = 2195

 Score = 31.2 bits (69), Expect = 2.8,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 4    DSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKL 63
            D++NK N+K  V   ++P  ++  ST    +    F+ + TS+S           DTT L
Sbjct: 1423 DALNKKNDKKKVFDGFTPGSSANSSTVDLTQTFTPFQAQVTSQS---------YVDTTAL 1473

Query: 64   QQRMRT--RHVVMMSLGTGIGTGLLVANAASLHYGG 97
                     H V+ S  + +  GL+ AN    H  G
Sbjct: 1474 LHNAHNVPSHSVLHSKPSNVSKGLVEANLPYTHRIG 1509

>Kwal_33.13806
          Length = 549

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 126/331 (38%), Gaps = 60/331 (18%)

Query: 27  ESTGPFRRFVDSFRREDTSRSGD----LEDG--EINSTDTTKLQQRMRTRHVVMMSLGTG 80
           ES    + F D F+R   S   +    L+DG  E       K +Q++       +S G+ 
Sbjct: 3   ESVRVPQSFRDGFQRLPQSVWANWDSILQDGDDEQEEVQAFKYEQQLDRSF---LSKGSI 59

Query: 81  IGTGLLVANAA---------SLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPT--- 128
           IG G  + +            L  GGP  +L+G+L+  + +++   + GE+   +P    
Sbjct: 60  IGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFLINGLATWLCSLSLGEIVSRFPIELH 119

Query: 129 ------LPGNFNAYSSIFISKPFGFATVWLFCL-QWLTVFPLELITATIVIKYWKVSVNA 181
                  P N+    S F        T WL  L  W     +    A +VI    ++ + 
Sbjct: 120 GGSAMLAPYNYQLSCSWF--------TGWLMLLGNWTMSTSITFAGAQLVISLVTMANDQ 171

Query: 182 NV--------FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAI 233
            +         V+ FY+ +  +     R     E +  +C   +I   + + IL+ +   
Sbjct: 172 LIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCVYWIIYAVIFIDILLLLFHS 231

Query: 234 GDTGYIGDRY----WRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNP 289
           G   Y   +Y    + N  S  S   L  + G       + F+  G  +     +E+  P
Sbjct: 232 GS--YRSLKYALFHFDNSFSGYSSKALSFMIG----FQQSSFTLQGFSMLPALADEVKRP 285

Query: 290 KTAIPSACKKGVYRILLVYLLTMIMIGFLVP 320
           +  IP    KG++  +L   LT I+  FL+P
Sbjct: 286 ERDIP----KGMFTAVLTSTLTGIV--FLLP 310

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 201 RGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236
           RG G  + IF+    L+IVG+V+V  L+N  A  +T
Sbjct: 70  RGQGPADVIFSKRSALIIVGWVLVSYLVNRIASNET 105

>CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces
           cerevisiae YLR130c ZRT2 or sp|P32804 Saccharomyces
           cerevisiae YGL255w ZRT1, hypothetical start
          Length = 433

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 6/93 (6%)

Query: 258 KLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGF 317
           K  G+  ++ TA+     + L   + + L NP      A     + I L+ L  + +I  
Sbjct: 71  KFFGSGVIVATAF-----IHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFLIEI 125

Query: 318 LVPHDSDRLMGSGSNDVHPSPYVLA-IEMHGVK 349
           +  H   + MG G N  H  P       MHGV+
Sbjct: 126 VSHHYVGKTMGGGHNHSHNMPTTFGQTHMHGVE 158

>Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement
          Length = 568

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 116/291 (39%), Gaps = 35/291 (12%)

Query: 62  KLQQRMRTRHVVMMSLGTGIGT---GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118
           KL + + +R  V+  LG G+ +   G+    +  L  GGP  ++ G+++V   +++   +
Sbjct: 51  KLDKSLLSRGSVI-GLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVGFATWLCSLS 109

Query: 119 AGEMAVAYPTLPGNFNAYSSIFISKP----FGFATVWLFCL-QWLTVFPLELITATIVIK 173
            GE+   +P      +  S++  +K     F + T WL  L  W     +    A +VI 
Sbjct: 110 LGEIVSKFPI---ELHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITFAGAQLVIS 166

Query: 174 YWKVSVNANV--------FVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVG 225
              ++ ++ V         VV+FY  +  +     +     E I  +C   +I   +   
Sbjct: 167 LISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCVYWIIYAIIFTD 226

Query: 226 ILINVGAIGDTGYIGDRY----WRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYAL 281
           IL+ +   G+  Y   +Y    + N  S      L  + G       + F+  G  +   
Sbjct: 227 ILLLLFHTGE--YRSLKYALAHFDNSLSGYRSAALSFMIG----FQQSNFTLQGFSMLPA 280

Query: 282 SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDS-----DRLM 327
             +E+  P+  IP      V    L  L+ ++ I  ++P  S     DR+M
Sbjct: 281 LADEVKEPERDIPRGMSLSVVLSALSGLVFLLPIMLILPDTSAILNNDRVM 331

>Scas_689.19
          Length = 612

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 24/198 (12%)

Query: 51  EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLL-------VANAASLHYGGPAGLLI 103
           +  E+ S +  K  Q +  + ++  S   G+G GL+        + A  L  GGPA +L 
Sbjct: 36  DTDEVESVEHFKYNQELD-KSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPATILW 94

Query: 104 GYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKP----FGFATVWLFCL-QWL 158
           G+++  I  +    + GE+   +P      +  S++   K       + T WL  L  W 
Sbjct: 95  GFIISGICIWFCSLSLGEVVSKFPM---ELHVSSAMLAPKDAKLICSWYTGWLMLLGNWT 151

Query: 159 TVFPLELITATIVIK---YWKVSVNANVF-----VVIFYLFIICIHFFGARGYGETEFIF 210
               +    A + I      K  + A  +     V+IFYL +  +     +     E I 
Sbjct: 152 MSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARFIETIN 211

Query: 211 NMCKVLMIVGFVIVGILI 228
            +C V +I    ++ IL+
Sbjct: 212 KVCVVWIIYAICVIDILL 229

>KLLA0A06666g complement(603169..604851) similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 560

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 33  RRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGT---GLLVAN 89
            R +     ED     D+ D     T   +L + + +R  V+  LG G+ +   G+    
Sbjct: 55  ERLLSLLNEEDQ----DIPDEVKEFTYVQQLDKNLLSRTSVI-GLGFGLMSPVLGMSTTM 109

Query: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYP 127
           +  L  GG   ++ GYL+  I+++I   +  E+   YP
Sbjct: 110 SIGLLNGGSPSIIFGYLICGIMTWISSLSLSEIVSKYP 147

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,767,151
Number of extensions: 746068
Number of successful extensions: 2762
Number of sequences better than 10.0: 141
Number of HSP's gapped: 2394
Number of HSP's successfully gapped: 150
Length of query: 569
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 462
Effective length of database: 12,891,983
Effective search space: 5956096146
Effective search space used: 5956096146
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)