Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR037C58956229220.0
Sklu_2357.258857826770.0
YDR037W (KRS1)59156226520.0
Scas_661.2862156426520.0
CAGL0K12012g59156326460.0
Kwal_27.1054159156326430.0
KLLA0F18392g58856426360.0
CAGL0J10230g5434906624e-79
KLLA0F04796g5174966403e-76
Scas_633.285924716402e-75
Kwal_23.47175274966134e-72
AER362W5255045907e-69
YNL073W (MSK1)5764955791e-66
ADL039C5564772211e-18
CAGL0D06556g5534802192e-18
Sklu_2189.35584942192e-18
Scas_347.35524812165e-18
YLL018C (DPS1)5574812149e-18
KLLA0D03839g5554742032e-16
Kwal_27.122356501861622e-11
Kwal_14.23034752661424e-09
YPL104W (MSD1)6581311382e-08
YHR019C (DED81)5545221354e-08
KLLA0A11484g4743771319e-08
Sklu_1963.16551421292e-07
Scas_700.66582191256e-07
KLLA0A08426g5544731239e-07
Sklu_2265.35604811231e-06
AGR206C6511181202e-06
KLLA0E24486g6451291167e-06
AEL020W5523381023e-04
CAGL0H05907g6591111005e-04
CAGL0A02112g548479970.001
Scas_607.14555343900.007
Kwal_0.375428269860.022
Kwal_34.16119465376860.022
CAGL0K07656g49775840.036
Scas_707.1449975820.063
KLLA0F08371g581170830.064
AFR516W49975820.068
KLLA0F25234g49975810.100
Kwal_47.1799849975800.12
YFL022C (FRS2)50375790.16
YCR024C492429740.59
YMR013C (SEC59)51934721.2
KLLA0C15851g75154711.5
Kwal_34.1598950629701.7
KLLA0F24200g65263711.7
CAGL0L08030g46739673.9
Scas_628.2448732665.2
KLLA0F09053g45261648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR037C
         (578 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1130   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1035   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1026   0.0  
Scas_661.28                                                          1026   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1023   0.0  
Kwal_27.10541                                                        1022   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1019   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   259   4e-79
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   251   3e-76
Scas_633.28                                                           251   2e-75
Kwal_23.4717                                                          240   4e-72
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   231   7e-69
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   227   1e-66
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    90   1e-18
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    89   2e-18
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         89   2e-18
Scas_347.3                                                             88   5e-18
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    87   9e-18
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    83   2e-16
Kwal_27.12235                                                          67   2e-11
Kwal_14.2303                                                           59   4e-09
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    58   2e-08
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    57   4e-08
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    55   9e-08
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         54   2e-07
Scas_700.6                                                             53   6e-07
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    52   9e-07
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            52   1e-06
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    51   2e-06
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    49   7e-06
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    44   3e-04
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    43   5e-04
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    42   0.001
Scas_607.14                                                            39   0.007
Kwal_0.375                                                             38   0.022
Kwal_34.16119                                                          38   0.022
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    37   0.036
Scas_707.14                                                            36   0.063
KLLA0F08371g 779264..781009 no similarity, hypothetical start          37   0.064
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    36   0.068
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    36   0.100
Kwal_47.17998                                                          35   0.12 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    35   0.16 
YCR024C (YCR024C) [558] chr3 complement(160739..162217) Asparagi...    33   0.59 
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...    32   1.2  
KLLA0C15851g complement(1378324..1380579) some similarities with...    32   1.5  
Kwal_34.15989                                                          32   1.7  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    32   1.7  
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    30   3.9  
Scas_628.24                                                            30   5.2  
KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces c...    29   8.8  

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/562 (96%), Positives = 543/562 (96%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXXXVENMADLDPSKYFEA 76
           LHLDEVTGEMVSKSELKKRIKQRQVE                   VENMADLDPSKYFEA
Sbjct: 17  LHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKKKVENMADLDPSKYFEA 76

Query: 77  RSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRES 136
           RSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRES
Sbjct: 77  RSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRES 136

Query: 137 GSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGE 196
           GSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGE
Sbjct: 137 GSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGE 196

Query: 197 GEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITY 256
           GEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITY
Sbjct: 197 GEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITY 256

Query: 257 IRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMD 316
           IRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMD
Sbjct: 257 IRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMD 316

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKF 376
           RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKF
Sbjct: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKF 376

Query: 377 HPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKM 436
           HPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKM
Sbjct: 377 HPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKM 436

Query: 437 DCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATK 496
           DCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATK
Sbjct: 437 DCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATK 496

Query: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDR 556
           EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDR
Sbjct: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDR 556

Query: 557 LAMFLTDSNTIREVLLFPTLKP 578
           LAMFLTDSNTIREVLLFPTLKP
Sbjct: 557 LAMFLTDSNTIREVLLFPTLKP 578

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/578 (85%), Positives = 519/578 (89%)

Query: 1   MSXXXXXXXXXXXXXXLHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXX 60
           MS              LHLDEVTGE VSKSELKKRIKQRQ+E                  
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  XVENMADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLP 120
            V+  ADLDPS+YFEARSRQIQELRK+  PNPYPHKF+V+I LP FL KY +L+RGETLP
Sbjct: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120

Query: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
            E+VSIAGRIHAKRESGSKL+FYVLH DGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV
Sbjct: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMR 300
           KDAR RFITRSKIIT+IRKFLD R FIEVETPMMNVIAGGATAKPFVTHHNDL+M M+MR
Sbjct: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300

Query: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
           IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL
Sbjct: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360

Query: 361 FSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHT 420
           FSEMVKEITG Y IK+HP+P +P  E ++NFARPWKRINMIEELEKRFNV FPAGDQLHT
Sbjct: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420

Query: 421 AETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSR 480
           AETGEFLK IL++NKM+C PPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SR
Sbjct: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480

Query: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNAL 540
           D PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QLIDETFCNAL
Sbjct: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540

Query: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKP 578
           EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKP
Sbjct: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKP 578

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/562 (86%), Positives = 516/562 (91%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXXXVENMADLDPSKYFEA 76
           LHLDE TGEMVSKSELKKRIKQRQVE                    +  ADLDPS+YFE 
Sbjct: 17  LHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKKKTDLFADLDPSQYFET 76

Query: 77  RSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRES 136
           RSRQIQELRKT EPNPYPHKF+V+I  P FL KYAHL++GETLPEE+VSIAGRIHAKRES
Sbjct: 77  RSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLPEEKVSIAGRIHAKRES 136

Query: 137 GSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGE 196
           GSKL+FYVLH DGVEVQ+MSQLQDY   ++YE+DH LLKRGDIVGVEGYVGRTQPKKGGE
Sbjct: 137 GSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGE 196

Query: 197 GEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITY 256
           GE+SVFVSR+QLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDAR RFITRS+II Y
Sbjct: 197 GEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRY 256

Query: 257 IRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMD 316
           IR+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDM MYMRIAPELFLKQLVVGG+D
Sbjct: 257 IRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLD 316

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKF 376
           RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL+FSEMVKEITG Y IK+
Sbjct: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKY 376

Query: 377 HPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKM 436
           HPDP DP+KE ++NF+RPWKRINMIEELEK FNV FP+GDQLHTAETGEFLKKIL DNK+
Sbjct: 377 HPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKL 436

Query: 437 DCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATK 496
           +CPPPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SRDQPGLCERFEVFVATK
Sbjct: 437 ECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATK 496

Query: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDR 556
           EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNALEYGLPPTGGWGCG+DR
Sbjct: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDR 556

Query: 557 LAMFLTDSNTIREVLLFPTLKP 578
           LAMFLTDSNTIREVLLFPTLKP
Sbjct: 557 LAMFLTDSNTIREVLLFPTLKP 578

>Scas_661.28
          Length = 621

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/564 (86%), Positives = 517/564 (91%), Gaps = 2/564 (0%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXX--XXXXXXVENMADLDPSKYF 74
           LHLDE TGEMVSKSELKKRIKQRQVE                      +  ADLDPS+YF
Sbjct: 47  LHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKKKKNTDLFADLDPSQYF 106

Query: 75  EARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKR 134
           EARSRQIQELRKTQ PNPYPHKF V+I  P FL KYA+LQRGETLP E+V+IAGRIHAKR
Sbjct: 107 EARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKR 166

Query: 135 ESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKG 194
           ESGSKL+FYVLH DGVEVQ+MSQLQDY++E  YE+DH LLKRGDIVGVEGYVGRTQPKKG
Sbjct: 167 ESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKG 226

Query: 195 GEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKII 254
           GEGEISVFVSRI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFI RS+II
Sbjct: 227 GEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQII 286

Query: 255 TYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGG 314
            +IR+FLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDM MYMRIAPELFLK+LVVGG
Sbjct: 287 RFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGG 346

Query: 315 MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKI 374
           MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL+FSEMVKEITG Y I
Sbjct: 347 MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYII 406

Query: 375 KFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDN 434
           K+HPDPN+P KE ++NF RPWKR+NMIEELEKRFNVTFPAGDQLHTAETGEFLKK+L+DN
Sbjct: 407 KYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADN 466

Query: 435 KMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVA 494
           KM+CPPPLTNARMLDKLVGELED CI+PTFIFGHPQMMSPLAK+SRD PGLCERFEVFVA
Sbjct: 467 KMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVA 526

Query: 495 TKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGV 554
           TKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNALEYGLPPTGGWGCG+
Sbjct: 527 TKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGI 586

Query: 555 DRLAMFLTDSNTIREVLLFPTLKP 578
           DRLAMFLTDSNTIREVLLFPTLKP
Sbjct: 587 DRLAMFLTDSNTIREVLLFPTLKP 610

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/563 (86%), Positives = 512/563 (90%), Gaps = 1/563 (0%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXXXVENM-ADLDPSKYFE 75
           LHLDEVTGEMVSKSELKKR+K RQVE                     ++ ADLDPS+YFE
Sbjct: 17  LHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKKKKNDLLADLDPSQYFE 76

Query: 76  ARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRE 135
           ARSRQI ELRKT  PNPYPHKF V+I  P FL KYAHL+RGETLP E VSIAGRIHAKRE
Sbjct: 77  ARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETLPNEIVSIAGRIHAKRE 136

Query: 136 SGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGG 195
           SGSKL+FYVLH DGVEVQVMSQLQDY   EAYE DH L+KRGDIVGVEGYVGRTQPKKGG
Sbjct: 137 SGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDIVGVEGYVGRTQPKKGG 196

Query: 196 EGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIIT 255
           EGEISVFV RI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKD+R RFITRSKII 
Sbjct: 197 EGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIIK 256

Query: 256 YIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGM 315
           YIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDM M+MRIAPELFLK+LVVGGM
Sbjct: 257 YIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGM 316

Query: 316 DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIK 375
           DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEI G Y IK
Sbjct: 317 DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEINGSYVIK 376

Query: 376 FHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNK 435
           +HPDPN+P KE ++NFARPWKRINMIEELEKRFNVTFPAGDQLHT ETGEFL+K+L DN 
Sbjct: 377 YHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNN 436

Query: 436 MDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVAT 495
           ++CPPP+TNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SRDQPGLCERFEVFVAT
Sbjct: 437 LECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVAT 496

Query: 496 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVD 555
           KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCG+D
Sbjct: 497 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGID 556

Query: 556 RLAMFLTDSNTIREVLLFPTLKP 578
           RLAMFLTDSNTIREVLLFPTLKP
Sbjct: 557 RLAMFLTDSNTIREVLLFPTLKP 579

>Kwal_27.10541
          Length = 591

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/563 (85%), Positives = 516/563 (91%), Gaps = 1/563 (0%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXXXXXXXVEN-MADLDPSKYFE 75
           LHLDE TGEMVSKSELKKR KQRQVE                     +  ADLDPS+YFE
Sbjct: 17  LHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKKKANDAFADLDPSQYFE 76

Query: 76  ARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRE 135
           ARSRQIQEL+KTQ PNPYPHKF+V+IGL  FL KYAHLQRGETLPEE+VSIAGR+HAKRE
Sbjct: 77  ARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETLPEEKVSIAGRVHAKRE 136

Query: 136 SGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGG 195
           SGSKL+FYVLH DGVEVQ+MSQLQDY SE AYE DH L+KRGDI+GVEGYVGRTQPKKGG
Sbjct: 137 SGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDIIGVEGYVGRTQPKKGG 196

Query: 196 EGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIIT 255
           EGEISVFVSRIQLLTPCLH+LPADHFGFKDQETRYRKRYLDLIMNKDAR RFITRSKII+
Sbjct: 197 EGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIIS 256

Query: 256 YIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGM 315
           YIRKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+M M+MRIAPELFLK+LVVGGM
Sbjct: 257 YIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGM 316

Query: 316 DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIK 375
           +RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+LFSEMVKEITG Y IK
Sbjct: 317 ERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEVLFSEMVKEITGSYVIK 376

Query: 376 FHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNK 435
           +HPDP DP+KE ++NFARPWKRINMIEELEKR NV FPAGD+LHTAETGEFLK++L +N 
Sbjct: 377 YHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELHTAETGEFLKRVLKENN 436

Query: 436 MDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVAT 495
           ++CPPPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK SRD PGLCERFEVFVAT
Sbjct: 437 LECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKSRDIPGLCERFEVFVAT 496

Query: 496 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVD 555
           KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCNALEYGLPPTGGWGCG+D
Sbjct: 497 KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGID 556

Query: 556 RLAMFLTDSNTIREVLLFPTLKP 578
           RLAMFLTDSNTIREVLLFPTLKP
Sbjct: 557 RLAMFLTDSNTIREVLLFPTLKP 579

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/564 (85%), Positives = 512/564 (90%), Gaps = 2/564 (0%)

Query: 17  LHLDEVTGEMVSKSELKKRIKQRQVEXXXXXXXXXXXXXX--XXXXXVENMADLDPSKYF 74
           +HLDE+TGEMVSKSELKKRIKQRQVE                      +  ADLDPS+YF
Sbjct: 17  MHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKKKANTDAFADLDPSQYF 76

Query: 75  EARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKR 134
           EARSRQI ELRKT  PNPYPHKF V++ LP FL+KYA+L+RGETLPEE+VSIAGRIHAKR
Sbjct: 77  EARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKR 136

Query: 135 ESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKG 194
           ESGSKL+FYVLH DGVEVQVMSQLQDYH+E +YE DH L+KRGDIVGVEGYVGRT PKKG
Sbjct: 137 ESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKG 196

Query: 195 GEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKII 254
           GEGEISVFVSRIQLLTPCLHMLP DHFGFKDQE RYRKRYLDLIMNKDAR RFITRSKII
Sbjct: 197 GEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKII 256

Query: 255 TYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGG 314
           +Y+RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDM MYMRIAPELFLK+LVVGG
Sbjct: 257 SYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGG 316

Query: 315 MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKI 374
           MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE++ SEMVKEITG Y I
Sbjct: 317 MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVI 376

Query: 375 KFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDN 434
           K+HPDPND +KE ++NF RPWKRINMIEELE RF+VTFPAGDQLHTAETGEFLKK+L DN
Sbjct: 377 KYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDN 436

Query: 435 KMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVA 494
           KMDC PPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SRDQPGLCERFEVFVA
Sbjct: 437 KMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVA 496

Query: 495 TKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGV 554
           TKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQL+DETFCNALEYGLPPTGGWGCG+
Sbjct: 497 TKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGI 556

Query: 555 DRLAMFLTDSNTIREVLLFPTLKP 578
           DRLAMFL DSNTIREVLLFPTLKP
Sbjct: 557 DRLAMFLADSNTIREVLLFPTLKP 580

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  259 bits (662), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/490 (34%), Positives = 267/490 (54%), Gaps = 28/490 (5%)

Query: 101 IGLPAFLNKYAHLQRGE-TLPEERVSIAGRIHAKRESGSKLRFYVLHADGVE-VQVMSQL 158
           + +  FL KY      +     +++S+ GRI + R SG K+ F  L  DG+  +Q++   
Sbjct: 62  VSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAFIDL-VDGIHGIQLILNC 120

Query: 159 QDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHM-LP 217
           ++  +   +E +   L++GD V   G     +  K     IS+  + +  +     M LP
Sbjct: 121 REIGNSATFESELSFLRKGDYVMTTGL---PRLSKSRMKNISLRCTDLPKILSVAQMPLP 177

Query: 218 ADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVI 277
                  D       + +D  +N     R   RS I+  IR FL+ RDFIEVETP+++  
Sbjct: 178 PKLI---DTVKSNSNKVVDYQINGFQNIRI--RSSILKSIRNFLEERDFIEVETPILSSK 232

Query: 278 AGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPE 337
           + GA AKPF++   D D ++ +R+APEL+LK+L++ G ++V+EIG+ FRNEGID +HNPE
Sbjct: 233 SNGAVAKPFMSSSKDFD-KLMLRVAPELWLKRLIISGCNKVFEIGKSFRNEGIDGSHNPE 291

Query: 338 FTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPW-- 395
           FTT EFYQ+Y  + DL+ + E LF +++ ++T +  IK +  P    +  DI  +  W  
Sbjct: 292 FTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYL-PESLLELEDILKSNNWKF 350

Query: 396 KRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNK---MDCPPPLTNARMLDKLV 452
           KR+  +  L K   V      Q+   ++ + L+ I    K          +++++L++L 
Sbjct: 351 KRVEFLPTLSKELGVDL---SQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSSSQILNRLC 407

Query: 453 GEL--EDTCID--PTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDP 508
            EL  E  C    PT I+ HP ++SPLAK + D     +RFE+F+  +E  NAY E N P
Sbjct: 408 SELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYSNAYEEENCP 467

Query: 509 FDQRARFEEQARQK-DQGD-DEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNT 566
             Q  +FE+QAR K D GD D    ID+ + NA+++G+PP GG+G G+DRL M +T    
Sbjct: 468 QVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDRLCMLITGCQR 527

Query: 567 IREVLLFPTL 576
           I +VL F TL
Sbjct: 528 IEQVLPFGTL 537

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  251 bits (640), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 172/496 (34%), Positives = 262/496 (52%), Gaps = 35/496 (7%)

Query: 93  YPHKFNV---TIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHADG 149
           YP   N+   TI +  F+ +Y  L+  +       ++ G+I   R SG K+ F  L  D 
Sbjct: 39  YPSLSNIPKPTIDVSRFIKEYDGLKVDDRSTTH--TLRGKITNMRFSGKKIGFINLLNDE 96

Query: 150 VEVQVMSQLQDYHSEEAYEQDHGL-LKRGDIVGVEGYVGRTQPKKGGEGEISVFV-SRIQ 207
             +QV+  L +        Q H    K GD + V G+ G +Q     +G +S+ V S ++
Sbjct: 97  KSLQVIVNLSNLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQK----QGTLSLKVNSELK 152

Query: 208 LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFI 267
           +L+P    +P       D   R   + LD ++N         R  +   IR++L  ++FI
Sbjct: 153 MLSPAQIPIPPKLL---DSSKRNSNKTLDYLVN--GTEAIYIRHLVTKRIREWLYKQEFI 207

Query: 268 EVETPMMNVIAGGATAKPFVTHHNDLDMQ--MYMRIAPELFLKQLVVGGMDRVYEIGRQF 325
           EVETP+++  + GA AKPF+TH   +D +    +RIAPEL+LK+L +GGM++++EIG+ F
Sbjct: 208 EVETPIISSKSNGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIGKVF 267

Query: 326 RNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSK 385
           RNEGID THNPEFTT EFYQ Y ++  L++M+E L   + + I         P   +   
Sbjct: 268 RNEGIDSTHNPEFTTLEFYQCYINMEQLIEMSESLLIYVCQGID-------KPKAQELLD 320

Query: 386 EYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLK-KILSDNKMDCPPPLTN 444
           +   N  + +KR+  +  L ++  + F   D        E LK K+   N       ++ 
Sbjct: 321 QIKANNGK-FKRLEFLPTLTQKTGIDFDNMD----LNNAELLKEKLRKANISISESSVSP 375

Query: 445 ARMLDKLVGE-LEDTC--IDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNA 501
            ++LD+L G+ +E  C  + PT I+ HP ++SPLAK   +   + +RFE+F+  KE  NA
Sbjct: 376 QQILDELCGKYIESQCDTLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRKEYMNA 435

Query: 502 YTELNDPFDQRARFEEQARQKDQ-GDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMF 560
           Y E N P  Q  +F  Q   K Q  DDE   +D  +  A++YG+PP GG+G G+DRL M 
Sbjct: 436 YEEENCPDLQLEKFTNQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGIDRLCML 495

Query: 561 LTDSNTIREVLLFPTL 576
           L D+  I EVL F TL
Sbjct: 496 LADTQRIEEVLSFGTL 511

>Scas_633.28
          Length = 592

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 168/471 (35%), Positives = 263/471 (55%), Gaps = 34/471 (7%)

Query: 124 VSIAGRIHAKRESGSKLRFYVLHAD--GVEVQV---MSQLQDYHSEEAYEQDHGLLKRGD 178
           + + GRI   R SG K+ F  L      V++QV   +++L+   SEE +++   LLK+GD
Sbjct: 126 LQLNGRIKNIRYSGKKIAFIDLFDSRYNVKIQVILNLNKLKQETSEERFQEVVQLLKKGD 185

Query: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIQ-LLTPCLHMLPADHFGFKDQETRYRKRYLDL 237
            +   G  G ++ +      +S+  +++  LL+   + LP+     KD+    + R LD 
Sbjct: 186 YIKAFGIPGFSESRSHT---LSLKGTKLPVLLSAAQYPLPSQ---LKDELKARKNRVLDY 239

Query: 238 IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQM 297
            +N       + RS II  +R FLD ++FIEVETP+++  + GA A+PF+T    L+  +
Sbjct: 240 QVN--GVSSLLLRSNIIRLLRSFLDKQEFIEVETPILSSKSNGANARPFITKSGSLNENL 297

Query: 298 YMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMT 357
            +RIAPEL+LK+L++ G+DRVYEIG+ FRNEG+D THNPEFT  EFY+ Y  + DL++ +
Sbjct: 298 ELRIAPELWLKRLIISGLDRVYEIGKVFRNEGVDSTHNPEFTLLEFYERYLSMTDLIEKS 357

Query: 358 ELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWK--RINMIEELEKRFNVTFPAG 415
           E LF  ++  +    K ++H  P   +    +  A  WK  RI  +  L +  N+ F   
Sbjct: 358 EDLFKHILVNLELK-KSEYHFSPAFDNLYRTLEQAN-WKFRRIEFLPTLSQELNIDFSLI 415

Query: 416 DQLHTAETGEFLKKILSDNKMDC-----PPPLTNARMLDKLVGELEDT----CIDPTFIF 466
           D L+ AE  + L+ + + ++ +      P  L++ ++L+KL     ++     I PT IF
Sbjct: 416 D-LNDAE--KLLESLPAHSRKELFENVPPGELSSQQILNKLCSFYLESRYCDTIHPTIIF 472

Query: 467 GHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQ----K 522
            HP+++SPLAK       + +RFE+F+  KE  NAY E N P  Q   F+ Q       K
Sbjct: 473 HHPRIISPLAKAHPSNQQITKRFEMFINGKEYINAYEEENCPQLQEKNFQLQQFSKETIK 532

Query: 523 DQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLF 573
           ++ +DE    DE F NA++ G+PP GG+G GVDRL M L +   I +VL F
Sbjct: 533 NKENDELISPDEGFINAMKSGMPPVGGFGLGVDRLCMLLMNKGRIEDVLPF 583

>Kwal_23.4717
          Length = 527

 Score =  240 bits (613), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 259/496 (52%), Gaps = 43/496 (8%)

Query: 99  VTIGLPAFLNKYAHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVM--- 155
            T  +  F  KY  L   E  P+    +  RI + R SG  + F  +      VQ++   
Sbjct: 51  ATTTVSEFKQKYQALH--EDQPQSSEVLRARIDSVRISGKNMCFVDVSNARNSVQLILNY 108

Query: 156 -----SQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRI-QLL 209
                +      + E + Q    L+ GD +   G+ G +Q     E  +S+  +++ ++L
Sbjct: 109 NVMKTAMPSSALTREQFFQHVQDLRPGDHIQACGFPGLSQ----RERTLSLKCTKLTEIL 164

Query: 210 TPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEV 269
            P L  +P       D   R   R LD ++N       + R ++ T IR+FL+ R F+EV
Sbjct: 165 APALLAVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTAIREFLNMRGFLEV 219

Query: 270 ETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEG 329
           ETP+++  A GA A+PF T     + ++ +R+APEL+LK+LVV G++RVYE+G+ FRNEG
Sbjct: 220 ETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVNRVYELGKVFRNEG 279

Query: 330 IDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDI 389
           +D THNPEFTT EFYQ+YA + +L++++E L+  ++  +   +  +         K   +
Sbjct: 280 VDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRFAREL--------KNELL 331

Query: 390 NFARPWKRINMIEELEKRFNVTFPAGDQLHTAET---GEFLKKILSDNKMDCPPPLTNAR 446
             A  +KR+  +  L +   V F   D LH ++        K I  D     P      +
Sbjct: 332 ANAGKFKRVEFLPTLLRETGVDFTQID-LHNSDLISRALIAKNIHMDTTGKSP-----QQ 385

Query: 447 MLDKLVGELED----TCIDPTFIFGHPQMMSPLAKHSRDQPGL-CERFEVFVATKEICNA 501
           +LD L G   +    T   PT I+ HP +MSPLAK + D   L  +RFEVF+  KE  NA
Sbjct: 386 ILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKRFEVFINGKEYINA 445

Query: 502 YTELNDPFDQRARFE-EQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMF 560
           Y E N P +Q  +FE +++ Q+  GD E+  +D ++  A+++G+PP GG+G G+DRL M 
Sbjct: 446 YEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPIGGFGLGIDRLCML 505

Query: 561 LTDSNTIREVLLFPTL 576
           LT +  I  VL F T+
Sbjct: 506 LTGNKRIERVLSFGTI 521

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  231 bits (590), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 171/504 (33%), Positives = 253/504 (50%), Gaps = 50/504 (9%)

Query: 93  YPHKFNV---TIGLPAFLNKY-AHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHAD 148
           YP   +V   T  +  F N+Y   L   E  PE    I G+I   R  G  + F  L   
Sbjct: 46  YPSVSSVPRPTASIAEFNNRYVGKLSNDE--PERTYVINGQIRGIRVVGRSMCFVDLQQQ 103

Query: 149 GVEVQVMSQLQDYHSE----EAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVS 204
           G  +Q+M       ++      ++     L+ GD V   G+ G ++ ++     +S+   
Sbjct: 104 GSALQLMVNHSLVRAQLVAKRPFQNAIAGLRLGDHVQPTGFPGLSKTER----TLSLKCR 159

Query: 205 RIQLLTPCLHMLPADHFG----FKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKF 260
           ++        ML A          D+  R + R LD ++N      F  R K +T +R +
Sbjct: 160 KVP------RMLAAAQIAIPQRLTDRVKRQQNRTLDYLVNGLKVLEF--RHKALTALRAY 211

Query: 261 LDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQ-MYMRIAPELFLKQLVVGGMDRVY 319
           L+ R F+EVETPM++  + GA A PFVTH    D Q + +RIAPEL+LK+L VGG  RVY
Sbjct: 212 LNRRGFLEVETPMLSAKSSGANATPFVTHLRGQDKQALELRIAPELWLKRLCVGGAQRVY 271

Query: 320 EIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPD 379
           EIG+ FRNEGID THNPEFTT E YQ YA + +L+++ ++L  ++   +         P 
Sbjct: 272 EIGKVFRNEGIDATHNPEFTTLELYQCYAPLDELLELAQVLLRDICVAVD-------TPV 324

Query: 380 PNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCP 439
                 E   N    ++R+  +  L +   V + A D   +      ++  LS   +D P
Sbjct: 325 SRQLLAEMAQN-GGAFRRVEFLPTLSRETGVDWAAVDLADSTA----IRVALSGAGIDVP 379

Query: 440 PPLTN-ARMLDKLVGE-LED---TCIDPTFIFGHPQMMSPLAKHSRDQPGL-CERFEVFV 493
             + +  ++L+KL  + +ED     + PT I  HP +MSPLAK +    GL   RFE+FV
Sbjct: 380 ESIVSPQQILNKLCADYIEDRYCQSLLPTAILHHPAVMSPLAKSA----GLVANRFELFV 435

Query: 494 ATKEICNAYTELNDPFDQRARFEEQARQKDQ-GDDEAQLIDETFCNALEYGLPPTGGWGC 552
             +E+ NAY E N P +Q  + + Q R ++Q  D E+  ID  +  A++YG+PP GG G 
Sbjct: 436 CGRELINAYEEENCPQEQLKKMQLQQRHREQFHDQESMQIDHHYIEAMKYGMPPIGGLGL 495

Query: 553 GVDRLAMFLTDSNTIREVLLFPTL 576
           G+DRL M L     I EVL F  L
Sbjct: 496 GIDRLCMLLLAKARIEEVLPFGCL 519

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  227 bits (579), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 161/495 (32%), Positives = 250/495 (50%), Gaps = 38/495 (7%)

Query: 106 FLNKYAHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQ---DYH 162
           FL   A L   E  P   +SI GRI + R SG K+ F  L+     ++  +QLQ   +Y+
Sbjct: 84  FLGNPATLHH-EDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYN 142

Query: 163 SEEAYEQDHG-------LLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHM 215
                 +D          LK+GD +   GY G +Q +      +S+  +++ ++     +
Sbjct: 143 KIGGSSEDKANFSEYMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSVSQL 199

Query: 216 -LPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMM 274
            LP+      D+      R +D  +N       + R++II  +RKFLD+R+F+EVETP++
Sbjct: 200 PLPSR---LNDETKIKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVETPIL 254

Query: 275 NVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTH 334
           +  + GA AKPF+T   D D  + +RIAPEL+LK+L++ G+ +VYEIG+ FRNEGID TH
Sbjct: 255 SSKSNGAMAKPFITSSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGIDSTH 313

Query: 335 NPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARP 394
           N EF+T EFY+ Y  + D++  TE LF  ++  +   ++    P P   S+ +       
Sbjct: 314 NAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKTFSELHLALSENN 373

Query: 395 WK--RINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKL- 451
           WK  ++  +  L K   +       L   +  E LK +  D      P   N   L  L 
Sbjct: 374 WKFRKVEFLPTLNKELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNTGQLSSLQ 432

Query: 452 -VGELEDTCID--------PTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAY 502
            + +L D  ++        PT I+  P ++SPLAK       + +RFEVF+  KE  NAY
Sbjct: 433 ILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEYINAY 492

Query: 503 TELNDPFDQRARFEEQARQKDQGDDEAQ----LIDETFCNALEYGLPPTGGWGCGVDRLA 558
            E N P  Q  +F +Q +  +   ++ +    +ID  +   ++YG+PP GG+G G+DRL 
Sbjct: 493 EEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGIDRLC 552

Query: 559 MFLTDSNTIREVLLF 573
           M   D   I EVL F
Sbjct: 553 MLFCDKKRIEEVLPF 567

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 108/477 (22%), Positives = 195/477 (40%), Gaps = 62/477 (12%)

Query: 124 VSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHS-EEAYEQDHGLLKRGDIVGV 182
           V +  R+H  R+ G+ L F +L      +Q + +     +  +   +  G L    IV V
Sbjct: 108 VLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLNLESIVLV 167

Query: 183 EGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLP------------ADHFGFK--DQ 226
            G V + +   K     +  + ++++  ++     LP            A+  G    + 
Sbjct: 168 RGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAGLPVVNL 227

Query: 227 ETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAK 284
           +TR   R +DL  + N+     F  ++ +    R+F  +R+F E+ TP +        A 
Sbjct: 228 DTRLDARVIDLRTVTNQ---AIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSEGGAN 284

Query: 285 PFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEF 343
            F   +       Y+  +P+ + +QL+    +RV+E+   FR E  +   H  EFT  + 
Sbjct: 285 VFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGVDL 342

Query: 344 YQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDIN-FARPWKRINMIE 402
             A+ + Y   ++ E++  EM   +  + K +F  +     K+Y +  F  P     +I 
Sbjct: 343 EMAFEEHYH--EVIEVM-GEMFMFVFTELKKRFAREIAQVRKQYPVEEFKFPADGKMVIL 399

Query: 403 ELEKRFNVTFPAGDQLH-----TAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELED 457
             ++   +   AG ++      + E   FL K++ + K D     T+  +LDK   EL  
Sbjct: 400 HYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVRE-KYD-----TDFYILDKFPAELR- 452

Query: 458 TCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEE 517
               P +    P             P     ++ F+  +EI +    ++DP   R R + 
Sbjct: 453 ----PFYTMPDPA-----------DPRYSNSYDFFMRGEEIMSGAQRIHDPELLRERMKH 497

Query: 518 QARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
              Q +    +A   D  +C+A  YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 498 HGLQPE----DAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNIRRATLFP 548

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 119/480 (24%), Positives = 199/480 (41%), Gaps = 61/480 (12%)

Query: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYE---QDHGLLKRG 177
           ++ V    R+H  R+ G+ L F  L      +Q + +  D   E+  +   +  G L   
Sbjct: 101 DKEVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVK-ADKAGEKISKNMVKWAGSLNLE 159

Query: 178 DIVGVEGYVGRT-QPKKGGE-GEISVFVSRIQLLTPCLHMLP------------ADHFGF 223
            IV V G V    +P K     ++ + V++I  ++     LP            A+  G 
Sbjct: 160 SIVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGL 219

Query: 224 K--DQETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAG 279
              + +TR   R +DL  + N+     F  +  +    R+FL N+ F+EV TP M   A 
Sbjct: 220 PVVNLDTRLDNRVIDLRTVTNQ---AIFRIQHGVCALFREFLANKKFVEVHTPKMLGAAS 276

Query: 280 GATAKPF-VTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPE 337
              A  F VT+      + Y+  +P+   +QL+V   ++V+EIG  FR E  +   H  E
Sbjct: 277 EGGANVFEVTYFKG---KAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTE 333

Query: 338 FTTCEFYQAYADVY-DLMDMTELLFSEMVKEITGDYKIKFH-PDPNDPSKEYDINFARPW 395
           FT  +   A+ + Y +++D+   LF  +  E+   Y  +        P +E+ +      
Sbjct: 334 FTGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKDGKM 393

Query: 396 KRINMIEELEKRFNVTFPAGD-QLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGE 454
            RI   E ++         GD +  + E  +FL K++ + K D     T+  +LDK   E
Sbjct: 394 VRITYKEGIQMLKEAGKDIGDFEDLSTENEKFLGKLVRE-KYD-----TDFYILDKFPLE 447

Query: 455 LEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRAR 514
                I P +    P+            P     ++ F+  +EI +    ++D    +  
Sbjct: 448 -----IRPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGAQRIHD---HKML 488

Query: 515 FEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
            E   R K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 489 ME---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 545

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 117/494 (23%), Positives = 210/494 (42%), Gaps = 68/494 (13%)

Query: 109 KYAHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVL--HADGVEVQVMSQLQDYHSEEA 166
           K+A L   +   E  V    R+H  R+ G+ L F  L   A+ ++  V S  +   S++ 
Sbjct: 97  KFADLSENDDGKE--VVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQM 154

Query: 167 YEQDHGLLKRGDIVGVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLP------- 217
            +    +     IV V G V + +   K      + + +++I  ++     +P       
Sbjct: 155 VKWTSSI-NLESIVLVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDAS 213

Query: 218 -----ADHFGFK--DQETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIE 268
                A+  G    + +TR   R +DL  + N+     F  +S +    R+FL NRDF E
Sbjct: 214 RSEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQ---AIFKIQSGVCELFREFLRNRDFTE 270

Query: 269 VETPMMNVIAGGATAKPF-VTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRN 327
           + TP +        A  F VT+        Y+  +P+++ ++L+    +RV+E+G  FR 
Sbjct: 271 IHTPKLLGSPSEGGANVFEVTYFKG---NSYLAQSPQIYKQELIAADFERVFEVGPVFRA 327

Query: 328 EGIDM-THNPEFTTCEFYQAYADVYD-LMDMTELLFSEMVKEITGDYKIKFHPDPNDPSK 385
           E  +   H  EFT  +   A+ + YD ++D+   LF  +  E+    K ++  +     K
Sbjct: 328 ENSNTHRHMTEFTGLDLEMAFEEHYDEVLDVLSELFVFIFTEL----KSRYSKEIALVRK 383

Query: 386 EYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLT-- 443
           +Y +   +  K   M+               +LH  +    L++  +  ++D    L+  
Sbjct: 384 QYPVEDFKLPKDGKMV---------------RLHFKDGIAMLRE--AGKQVDDFEDLSTE 426

Query: 444 NARMLDKLVGELEDT---CIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICN 500
           N ++L KLV E  DT    +D   +   P    P  + SR        ++ F+  +EI +
Sbjct: 427 NEKLLGKLVREKYDTDFYILDKFPLAVRPFYTMPDPEDSR----YSNSYDFFMRGEEILS 482

Query: 501 AYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMF 560
               ++D        +E+ +  +   ++  L D  +C+A  YG PP  G G G++R+ MF
Sbjct: 483 GAQRIHDS----EFLKERMKVHELSPEDPGLKD--YCDAFTYGCPPHAGGGIGLERVVMF 536

Query: 561 LTDSNTIREVLLFP 574
             D   IR   LFP
Sbjct: 537 YLDLKNIRRASLFP 550

>Scas_347.3
          Length = 552

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 115/481 (23%), Positives = 195/481 (40%), Gaps = 70/481 (14%)

Query: 124 VSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQ-DYHSEEAYEQDHGLLKRGDIVGV 182
           V    R+H  R+ G+ L F         +Q + ++Q D    +   +  G L    IV V
Sbjct: 104 VVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSKQMVKWAGSLNLESIVVV 163

Query: 183 EGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLP------------ADHFGFK--DQ 226
           +G V R +   K     ++ + ++ I  ++     LP            A+  G    + 
Sbjct: 164 KGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASRSEAEAEAAGLPVVNL 223

Query: 227 ETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAK 284
           +TR   R +DL  + N+     F  +S +    R++L    F EV TP +        A 
Sbjct: 224 DTRLDARVIDLRTVTNQ---AIFKIQSGVCQLFREYLSGLKFTEVHTPKLLGAPSEGGAS 280

Query: 285 PFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCE- 342
            F   +     + Y+  +P+   +QL+V   ++V+EIG  FR E  +   H  EFT  + 
Sbjct: 281 VFEVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDM 338

Query: 343 ---FYQAYADVYDLM-DMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDI-NFARPWKR 397
              F + Y +V D++ D+   +F+E+ K  + + +I          K+Y + +F  P   
Sbjct: 339 EMAFEEHYHEVLDVLSDLFVFIFTELKKRFSKEIEI--------VRKQYPVEDFKLPADG 390

Query: 398 INMIEELEKRFNVTFPAGDQL---HTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGE 454
                   K   + +  G Q+      E G+F    LS           N + L KLV E
Sbjct: 391 --------KMVRIQYKEGIQMLKDAGKEIGDF--DDLSTE---------NEKFLGKLVRE 431

Query: 455 LEDTCIDPTFIFGHPQMMSPL-AKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRA 513
             DT  D   +   P  + P       + P     ++ F+  +EI +    ++D     A
Sbjct: 432 KYDT--DFYILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHD----HA 485

Query: 514 RFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLF 573
             +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   LF
Sbjct: 486 LLQERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLF 543

Query: 574 P 574
           P
Sbjct: 544 P 544

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 115/481 (23%), Positives = 202/481 (41%), Gaps = 64/481 (13%)

Query: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHS-EEAYEQDHGLLKRGDI 179
           ++ V    R+H  R+ G+ L F  L      +Q + +     +  +   +  G L    I
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESI 165

Query: 180 VGVEGYVGRT-QPKKGGEGE-ISVFVSRIQLLTPCLHMLP------------ADHFGFK- 224
           V V G V +  +P K    + + + +++I  ++     LP            A+  G   
Sbjct: 166 VLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPV 225

Query: 225 -DQETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETP-MMNVIAGG 280
            + +TR   R +DL  + N+     F  ++ +    R++L  + F EV TP ++   + G
Sbjct: 226 VNLDTRLDYRVIDLRTVTNQ---AIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEG 282

Query: 281 ATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFT 339
            ++   VT+      + Y+  +P+   +QL+V   +RVYEIG  FR E  +   H  EFT
Sbjct: 283 GSSVFEVTYFKG---KAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFT 339

Query: 340 TCE----FYQAYADVYD-LMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARP 394
             +    F + Y +V D L ++   +FSE+ K    + ++        P +E+ +     
Sbjct: 340 GLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIEL---VRKQYPVEEFKLPKDGK 396

Query: 395 WKRINMIEELEKRFNVTFPAGD-QLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVG 453
             R+   E +E         GD +  + E  +FL K++ D K D     T+  +LDK   
Sbjct: 397 MVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRD-KYD-----TDFYILDKFPL 450

Query: 454 ELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRA 513
           E     I P +    P             P     ++ F+  +EI +    ++D     A
Sbjct: 451 E-----IRPFYTMPDPA-----------NPKYSNSYDFFMRGEEILSGAQRIHD----HA 490

Query: 514 RFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLF 573
             +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   LF
Sbjct: 491 LLQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLF 548

Query: 574 P 574
           P
Sbjct: 549 P 549

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 112/474 (23%), Positives = 198/474 (41%), Gaps = 56/474 (11%)

Query: 124 VSIAGRIHAKRESGSKLRFYVL--HADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVG 181
           V    R+H  R+ G+ L F  L   A+ ++  V +  +   S++  +   G +    IV 
Sbjct: 107 VVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKW-VGSINLESIVV 165

Query: 182 VEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLP------------ADHFGFK--D 225
           V G V + +   K      + V +++I  ++     LP            A+  G    +
Sbjct: 166 VHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLPVVN 225

Query: 226 QETRYRKRYLDL--IMNKDARGRFITRSKIITYIRKFLDNRDFIEVETP-MMNVIAGGAT 282
            +TR   R +DL  + N+     F  +S +    R+FL N+ F EV TP ++   + G +
Sbjct: 226 LDTRLDSRVIDLRTVTNQ---AIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGGS 282

Query: 283 AKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTC 341
               VT+      + Y+  +P+L+ +QL+    +RV+E+   FR E  +   H  EFT  
Sbjct: 283 NVFEVTYFKG---KSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGL 339

Query: 342 EFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMI 401
           +   A+ + YD +  T    +E+   I    K ++  +     K+Y +   +  K   M+
Sbjct: 340 DLEMAFEEHYDEVVDT---LAELFVFIFSQLKTRYAKEIALVRKQYPVEEFKLPKDGKMV 396

Query: 402 EELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCID 461
                   + F  G  L   E G+ +     D+  D      N ++L KLV +  +T  D
Sbjct: 397 -------RIPFKEGIAL-LREAGKDV-----DDFEDL--STENEKLLGKLVRDKYET--D 439

Query: 462 PTFIFGHPQMMSPL-AKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQAR 520
              +   P  + P       + P     ++ F+  +EI +    ++D        +E+  
Sbjct: 440 FYILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDA----DLLKERMN 495

Query: 521 QKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
             +   ++  L D  +C A  YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 496 AHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP 547

>Kwal_27.12235
          Length = 650

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 91/186 (48%), Gaps = 7/186 (3%)

Query: 178 DIVGVEGYVGRTQPKKGGEG-EISVFVSRIQLLTPCLHMLPADHFGFKDQETRY-RKRYL 235
           D+V +EG +   + K+     E  + +S+++ L       P+    FK+Q       RYL
Sbjct: 96  DVVQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYL 154

Query: 236 DLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDL-D 294
            L + K  +     R +I TYIRK L+++ F E+ETP++         +  V   N L D
Sbjct: 155 QLRLPK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARNKLSD 213

Query: 295 MQMYMRI--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYD 352
              +  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   A+A    
Sbjct: 214 KPTFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFASGSQ 273

Query: 353 LMDMTE 358
           +MD+ E
Sbjct: 274 VMDVVE 279

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>Kwal_14.2303
          Length = 475

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 116/266 (43%), Gaps = 30/266 (11%)

Query: 124 VSIAGRIHAKRESGSKLRFYVL--HADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVG 181
           V +  R+H  R+ G+ L F  L   A+ ++  V S  +   S++  +   G +    IV 
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVKSNAEGTISKQMVKWT-GSISPESIVL 179

Query: 182 VEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLP------------ADHFGFK--D 225
           V G V + +   K      + + +++I  ++     LP            A+  G    +
Sbjct: 180 VHGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPVVN 239

Query: 226 QETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKP 285
            +TR   R +DL    + +  F  +S +    R+FL  R F+E+ TP +        A  
Sbjct: 240 LDTRLDARVIDLRTATN-QAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGANV 298

Query: 286 F-VTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEF 343
           F VT+      + Y+  +P+ + ++L+    +RV+E+   FR E  +   H  EFT  + 
Sbjct: 299 FEVTYFKG---KSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGLDL 355

Query: 344 YQAYADVYD-----LMDMTELLFSEM 364
             A+ + YD     L D+   +F+++
Sbjct: 356 EMAFEEHYDEVIDVLSDLFVFIFTQL 381

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 7/131 (5%)

Query: 233 RYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFV----T 288
           RYL L  N   +     RS I   IR   +N DF EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 289 HHNDLDMQMY-MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 347
             +D     Y +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 348 ADVYDLMDMTE 358
           A+  D+M + E
Sbjct: 270 ANSEDVMKIIE 280

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  + +    P  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 125/522 (23%), Positives = 203/522 (38%), Gaps = 74/522 (14%)

Query: 75  EARSRQIQELRKTQEPNPYPHK----FNVTI----GLPAFLNKYAHLQRGETLPEERVSI 126
           +A  ++ QEL+K Q+      K     N+TI     LPA +    +    +    +RV +
Sbjct: 77  KAVKQKEQELKKQQKEAENAAKQLSALNITIKEDESLPAAIKTRIYDSYSKV--GQRVKV 134

Query: 127 AGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYV 186
           +G IH  R S  K+ F VL      +Q +        + A  Q    L     V + G +
Sbjct: 135 SGWIHRLR-SNKKVIFVVLRDGSGFIQCV-----LSGDLALAQQTLDLTLESTVTLYGTI 188

Query: 187 -----GRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLD---LI 238
                G+T P   G  E++V    +  L P       D F  K  E       LD   L 
Sbjct: 189 VKLPEGKTAP---GGVELNVDYYEVVGLAPG----GEDSFTNKIAEGSDPSLLLDQRHLA 241

Query: 239 MNKDARGRFI-TRSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDM 295
           +  DA    +  R+ ++  +R+  D     EV  P M    + GG+T    +   N    
Sbjct: 242 LRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFKMNYYGE 297

Query: 296 QMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLM 354
           + Y+  + +L+L +  +  +  VY I   FR E      H  E+T  E   A+    DL+
Sbjct: 298 EAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFDDLL 356

Query: 355 DMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPA 414
              E L  + V+ +  D      P      K+ + NF  P K   M   L+ +  +T+  
Sbjct: 357 QHIETLIVKSVQYVLED------PIAGPLVKQLNPNFKAP-KAPFM--RLQYKDAITWLN 407

Query: 415 GDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHP-QMMS 473
              +   E  +F  K   D             + +    ++ DT   P F+   P ++ S
Sbjct: 408 EHDIKNEEGEDF--KFGDD-------------IAEAAERKMTDTIGVPIFLTRFPVEIKS 452

Query: 474 PLAKHSRDQPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLI 532
              K   D P + E  +V +    EI      ++D  +  A F+   R+    D     I
Sbjct: 453 FYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFK---REGIDTDAYYWFI 509

Query: 533 DETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           D+      +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 510 DQR-----KYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 87/377 (23%), Positives = 147/377 (38%), Gaps = 56/377 (14%)

Query: 203 VSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLD 262
           V   Q   P L  LP         E ++R  YL  ++      RF  R K+ + + K LD
Sbjct: 139 VQNKQTSLPTLRKLP---------EFKHRTTYLSNLL------RF--RHKVESQLTKTLD 181

Query: 263 NRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIG 322
             DF  V  P++  I      + F    +  D  + + ++ +L L+ L++G + RVY + 
Sbjct: 182 GLDFTMVRPPILTSIDCEGAGEMFNLKQDHWDEIVNLTVSSQLHLEVLMMG-LGRVYCLQ 240

Query: 323 RQFRNEGIDMT-HNPEFTTCEFYQAYADVYD-LMDMTELLFSEMVKEI--TGDYKIKFHP 378
             FR E  D   H  EF   E   ++ D  + LMD+ EL+   +V  +  T D    F  
Sbjct: 241 PCFRAEKSDTNRHLCEFWMLEVEASFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPV 300

Query: 379 DPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQL-HTAETGEFLKKILSDNKMD 437
             N           + WKRI   + +E   +    +G +  H    G+ L          
Sbjct: 301 GCNIDITSRWAKLLQDWKRITYTDAVEALLS----SGVKFEHDLAWGKDLNS-------- 348

Query: 438 CPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEV-FVATK 496
                 + R L    G        P F+  +P+         R      E F++ F    
Sbjct: 349 -----EHERWLCDHFG-------GPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIG 396

Query: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDR 556
           EI       +D +D     +++  ++D   ++     + + N  + G  P GG+G G++R
Sbjct: 397 EIVGGSVREDD-YDT---LKQEIERRDMASNQL----DWYLNLRKEGTVPHGGFGIGIER 448

Query: 557 LAMFLTDSNTIREVLLF 573
           L  +L  +  IR+ + F
Sbjct: 449 LVSYLYGNPNIRDSIPF 465

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 233 RYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMM-NVIAGGATAKPFVTHHN 291
           RYL L + K  +    TR +    IRK LD   F EVETPM+      GA      T  +
Sbjct: 152 RYLQLRLPK-YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRRS 210

Query: 292 DLDMQMYMRI--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYAD 349
           +     +  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   A+A 
Sbjct: 211 ESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFAS 270

Query: 350 VYDLMDMTELLFSEMVKEITGD 371
             ++MD+ E + ++    ++ +
Sbjct: 271 GNEVMDVVEDMVTKAWSNLSSN 292

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 485 LCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGL 544
           L + +++ V+  E+    T ++DP  Q   F+E  +       + + +      A E G 
Sbjct: 540 LGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH-----QPERLFGHLLTAFEMGT 594

Query: 545 PPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 595 PPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>Scas_700.6
          Length = 658

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 97/219 (44%), Gaps = 14/219 (6%)

Query: 154 VMSQLQDYHSEEAYEQDHG----LLKRGDIVGVEGYVGRTQPKKGGEGE----ISVFVSR 205
             SQL+D   +     D G     L R D++ V G + + + K     E      + V +
Sbjct: 75  TFSQLRDVKGDTVQLVDSGSQLKALNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEK 134

Query: 206 IQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFI-TRSKIITYIRKFLDNR 264
           I +L    +  P+    FK ++  Y   Y  L +       F+  R +I   +R+ L+  
Sbjct: 135 ISVLNSS-NEKPSQLHEFK-KDGNYPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEE 192

Query: 265 DFIEVETPMM-NVIAGGAT--AKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEI 321
           +F+E+ETP++      GA     P  T  N       +  +P+ + + L+  G+ + +++
Sbjct: 193 EFLEIETPILFKPTPEGAREFLVPTRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQV 252

Query: 322 GRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
            R FR+E +     PEFT  +   ++++  D+M + E L
Sbjct: 253 ARCFRDEDLRADRQPEFTQIDMEMSFSNGEDVMALLERL 291

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  + +    P  C  + +++ +   E+    T ++DP  Q   FE   + ++
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKIEN 581

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
             +    L+      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 582 AEELFGHLL-----RAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 99/473 (20%), Positives = 182/473 (38%), Gaps = 74/473 (15%)

Query: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
           ++RV ++G +H  R + S +  +++  DG     +  +       +Y+  +  L+    +
Sbjct: 129 DKRVKVSGWVHRLRNNKSVV--FIILRDGT--GFLQTVLTGDLARSYQIVNLTLE--TTI 182

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKD--QETRYRKRYLD-- 236
            + G +      K   G + +FV   +++ P     P+    F +  QE       LD  
Sbjct: 183 TLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQR 238

Query: 237 --LIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHND 292
             ++  +        R+ ++  IR+  D     EV  P M    + GG+T      +   
Sbjct: 239 HLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYGE- 297

Query: 293 LDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVY 351
              + ++  + +L+L +  +  +  VY I   FR E      H  E+T  E    + D  
Sbjct: 298 ---EAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFD 353

Query: 352 DLMDMTELLFSEMVK-----EITGDYKIKFHPD---PNDPSKEYDINFARPWKRINMIEE 403
           DL+   E + ++ ++      + G    K +P+   P  P K  +   A  W + + I+ 
Sbjct: 354 DLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIKN 413

Query: 404 LEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPT 463
            E +    F  GD +  A          ++ KM                    DT   P 
Sbjct: 414 EEDK---EFQFGDDIAEA----------AERKMT-------------------DTIGVPI 441

Query: 464 FIFGHP-QMMSPLAKHSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQ 521
            +   P ++ S   K   D   + E  +V + T  EI      ++D  +  A F      
Sbjct: 442 LLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF------ 495

Query: 522 KDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           K +G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 108/481 (22%), Positives = 180/481 (37%), Gaps = 74/481 (15%)

Query: 113 LQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHG 172
           + +  T    R+ ++G IH  R S   L F VL  DG          D    +AY+    
Sbjct: 127 ISKSYTTIGSRIKVSGWIHRLR-SNKSLCFVVLR-DGTGFLQAVLAGDL--AKAYQTSTL 182

Query: 173 LLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPA--DHFGFKDQETRY 230
            L+    V + G + +    K   G + + V   ++++    + P+  D F  K QE   
Sbjct: 183 TLE--STVTLYGTISKLPEGKTAPGGVELAVDYYEIVS----LAPSGEDAFTNKVQEGAD 236

Query: 231 RKRYLD----LIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAK 284
               LD     +  +        R+ ++  IR+  +     EV  P M    + GG+T  
Sbjct: 237 PSLLLDQRHLALRGETLSAVMKVRASLLRAIRRAYEEEQLTEVTPPCMVQTQVEGGSTLF 296

Query: 285 PFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEF 343
               +      + Y+  + +L+L +  +  +  VY I   FR E      H  E+T  E 
Sbjct: 297 KLDYYGE----EAYLTQSSQLYL-ETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEA 351

Query: 344 YQAYADVYDLMDMTELLFSEMVK-----EITGDYKIKFHPD---PNDPSKEYDINFARPW 395
              + D  DL+   E + ++ V+      I G    + +PD   P  P K  +   A  W
Sbjct: 352 ELCFLDFDDLLSHIERVITKSVQYVLEDPIAGPLIKQLNPDFQAPQLPFKRLEYKDAIEW 411

Query: 396 KRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGEL 455
            + + I+  +      F  GD +  A          ++ KM                   
Sbjct: 412 LKEHGIKNEDGE---EFKFGDDIAEA----------AERKMT------------------ 440

Query: 456 EDTCIDPTFIFGHP-QMMSPLAKHSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRA 513
            DT   P  +   P ++ S   K   D P + E  +V + T  EI      ++   +  A
Sbjct: 441 -DTIGVPILLTRFPVEIKSFYMKRCTDDPSVTESVDVLMPTVGEITGGSMRIDSIEELMA 499

Query: 514 RFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLF 573
            F      K +G D A      F +   YG  P GG+G G +R+  +L D  T+R+  L+
Sbjct: 500 GF------KREGIDPAAYY--WFIDQRRYGSCPHGGYGLGTERILAWLCDRFTVRDCSLY 551

Query: 574 P 574
           P
Sbjct: 552 P 552

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 244 RGRFITRSKIITYIRKFLDNRDFIEVETPMM-NVIAGGATAKPFVTHHNDLDMQMYMRI- 301
           + R   R      +R  L+   F+EVETP++      GA      T H      ++  + 
Sbjct: 162 QARMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALP 221

Query: 302 -APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
            +P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E
Sbjct: 222 QSPQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVE 279

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  + +  ++P  C  + ++  V   E+    T ++DP  QR  F +  +  +
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINN 572

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           +      L++     A   G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 573 EDQVFGHLLE-----AFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 61/129 (47%), Gaps = 4/129 (3%)

Query: 233 RYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHND 292
           RYL L + K  +     R +    +R  LD+ +F EVETP++         +  V     
Sbjct: 151 RYLQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPTRGK 209

Query: 293 LDMQMYMRI---APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYAD 349
           +D +        +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A++ 
Sbjct: 210 IDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMAFSS 269

Query: 350 VYDLMDMTE 358
             D+ ++ E
Sbjct: 270 GKDVREVVE 278

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  +++    P  C  E +++ V   E+    T ++DP  Q   F E    K+
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/338 (21%), Positives = 127/338 (37%), Gaps = 56/338 (16%)

Query: 249 TRSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDMQMYMRIAPELF 306
            R+  +  IR+  ++   +EV  P M    + GG+T    +   +    + ++  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 307 LKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELLFSEMV 365
           L +  +  +  V+ I   FR E      H  E+T  E    + D   L+  TE + + +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 366 K-----EITGDYKIKFHPD---PNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQ 417
           +      + G    + +PD   P  P    +   A  W   + I+  E      F  GD 
Sbjct: 366 RYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGE---EFKFGDD 422

Query: 418 LHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHP-QMMSPLA 476
           +  A          ++ KM                    DT   P F+   P ++ S   
Sbjct: 423 IAEA----------AERKMT-------------------DTIGKPIFLTRFPLELKSFYM 453

Query: 477 KHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETF 536
           K   D P + E F+V + T       +   D  D     E  A  K +G +        F
Sbjct: 454 KRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WF 506

Query: 537 CNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
            +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 507 SDQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKHSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  + +    P  C  + +++ +   E+    T ++DP  Q+  FE   +  +
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN 579

Query: 524 QGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 580 -----YQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 249 TRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVT--------HHNDLDMQMYMR 300
           TR ++   +R+ LD   F E+ETP +   A    A+ F+            D  + M+  
Sbjct: 166 TRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPTRVSAKIKQVDKIVPMFYA 224

Query: 301 I--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           +  +P+ + + L+  G+ + ++  R +R+E +     PEFT  +   ++A   D+M + E
Sbjct: 225 LTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMSVIE 284

Query: 359 LLFSEMVKE 367
              + + K+
Sbjct: 285 KCITSVWKK 293

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 105/479 (21%), Positives = 179/479 (37%), Gaps = 88/479 (18%)

Query: 122 ERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEE-AYEQDHGLLKRGDIV 180
           +RV I+G IH  R S  K+ F VL  DG        LQ   + + A  Q    L     V
Sbjct: 124 QRVKISGWIHRLR-SNKKVMFIVLR-DG-----YGYLQSVLTGDLAIAQQSLDLTIESTV 176

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGF-------KDQETRYRKR 233
            + G + +    K   G + + V   +++     + P+    F        D      +R
Sbjct: 177 TLYGTITKVPEGKSAPGGVELLVDYYEVV----GLAPSGDEAFTNKIAEGADPSLLLDQR 232

Query: 234 YLDLIMNKDARGRFIT-----RSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAKPF 286
           +L L      RG  ++     R+ ++  IR+        EV  P M    + GG+T    
Sbjct: 233 HLAL------RGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGSTLFKL 286

Query: 287 VTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQ 345
             +      Q Y+  + +L+L +  +  +  VY +   FR E      H  E+T  E   
Sbjct: 287 DYYGE----QAYLTQSSQLYL-ETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAEL 341

Query: 346 AYADVYDLMDMTELLFSEMVK-----EITGDYKIKFHPD---PNDPSKEYDINFARPWKR 397
           A+    +L+D  E +  + V+      I G    + +PD   P  P    +   A  W +
Sbjct: 342 AFLTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEWLK 401

Query: 398 INMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELED 457
            + I+  +      F  GD +  A          ++ KM                    D
Sbjct: 402 EHDIKNEDGE---EFKFGDDIAEA----------AERKMT-------------------D 429

Query: 458 TCIDPTFIFGHP-QMMSPLAKHSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARF 515
           T   P  +   P ++ S      +D   + E  +V + T  EI      +N   +  A F
Sbjct: 430 TIGVPILLTKFPAEIKSFYMPRCKDDNRVTESVDVLMPTVGEITGGSMRINTEEELLAGF 489

Query: 516 EEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
                +++  D +A      F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 490 -----KRENIDPKAYYW---FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 540

>Scas_607.14
          Length = 555

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 71/343 (20%), Positives = 130/343 (37%), Gaps = 58/343 (16%)

Query: 245 GRFITRSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATAKPFVTHHNDLDMQMYMRIA 302
           G    R+ ++  +R+  +    +EV  P M    + GG+T      +      + ++  +
Sbjct: 250 GVMKVRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGSTLFKLDYYGE----EAFLTQS 305

Query: 303 PELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELLF 361
            +L+L +  +  +  V+ +   FR E      H  E+T  E   A+    +L++  E L 
Sbjct: 306 SQLYL-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLI 364

Query: 362 SEMVK-----EITGDYKIKFHPD---PNDPSKEYDINFARPWKRINMIEELEKRFNVTFP 413
            + V+      + G    + HP    P  P    +   A  W + + I+  +      F 
Sbjct: 365 VKSVQYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKNEDGE---DFK 421

Query: 414 AGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHP-QMM 472
            GD +  A          ++ KM                    DT   P  +   P ++ 
Sbjct: 422 FGDDIAEA----------AERKMT-------------------DTLNVPILLTRFPVEIK 452

Query: 473 SPLAKHSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL 531
           S      +D P + E  +V + T  EI      ++D  +  A F      K +G D    
Sbjct: 453 SFYMPKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPY 506

Query: 532 IDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
               F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 507 Y--WFIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 547

>Kwal_0.375
          Length = 428

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 109/269 (40%), Gaps = 42/269 (15%)

Query: 121 EERVSIAGRIHAKRESGSKLRFYVLHADG---VEVQVMSQLQDYHSEEAYEQDHGLLKRG 177
           ++RV ++G IH +R S S L F VL  DG   ++  +   L   H       +  +   G
Sbjct: 129 DQRVKVSGWIHRQRSSKS-LVFIVLR-DGTGYLQAVLTGDLARAHQTSTLTLESSITLYG 186

Query: 178 DIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGF-------KDQETRY 230
            +  +    G+T P     G + + V   ++++    + P+    F        D     
Sbjct: 187 KVCKLPE--GKTAP-----GGVELLVDYYEIIS----LAPSGDDAFTNKIAEGADPSLLL 235

Query: 231 RKRYLDLIMNKDARGRFIT-----RSKIITYIRKFLDNRDFIEVETPMM--NVIAGGATA 283
            +R+L L      RG  ++     R+ ++  +R+F D     EV  P M    + GG+T 
Sbjct: 236 DQRHLAL------RGETLSAVMKVRAALLRSVRRFYDQEGLTEVTPPCMVQTQVEGGSTL 289

Query: 284 KPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCE 342
                +      + Y+  + +L+L +  +  +  VY I   FR E      H  E+T  E
Sbjct: 290 FKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQESFRAEKSHTRRHLSEYTHIE 344

Query: 343 FYQAYADVYDLMDMTELLFSEMVKEITGD 371
               +    +++   E L +++V+ +  D
Sbjct: 345 AELCFLSFDEMLVHIEKLITQVVQSVLDD 373

>Kwal_34.16119
          Length = 465

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 143/376 (38%), Gaps = 54/376 (14%)

Query: 214 HMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPM 273
           H LP   F   +   ++R  YL  ++      RF  RS + + + +F D++DF +V  P+
Sbjct: 118 HSLP---FLRSNPTLKHRSNYLGALL------RF--RSHVESSLVEFFDSQDFTKVAPPI 166

Query: 274 MNVIAGGATAKPFVTHHND--------LDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQF 325
           +         + F    N              Y+ ++ +L L+ L +  + R + +   F
Sbjct: 167 LTSSDCEGAGELFRVESNSRWARNSSYFGKPTYLTVSTQLQLEVLAM-ALSRCWTLTPCF 225

Query: 326 RNEGIDMT-HNPEFTTCEFYQAYAD-VYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDP 383
           R E  D   H  EF   E    + D V+ L  + EL+   +VK        + H  PN  
Sbjct: 226 RAEESDTNRHLAEFWMLEAEVCFIDNVHQLTQLAELMLKHVVKSCMAH---QSHLLPNLV 282

Query: 384 SKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLT 443
            +E   N   P     ++   E   +  +P   +L  ++  E LK   +  K    P   
Sbjct: 283 PQE---NADGP---QTVLARWESLLSTEWP---RLTYSKAIEILKAQDAKEKFKFTPEWG 333

Query: 444 NARMLDKLVGELEDTCI----DPTFIFGHPQMMSP--LAKHSRDQPGLCERFEVFVATKE 497
                  L  E E         P FI  +P+      + K+S +    C  F++ V    
Sbjct: 334 K-----DLQSEHEKWIAAHYNSPVFITDYPRECKAFYMKKNSDNTTVAC--FDLIVPQMG 386

Query: 498 ICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRL 557
                +   D +D     E + R  +  D E       + +  + G  P GG+G G++R 
Sbjct: 387 EIIGGSIREDDYDSLLH-EMRNRSMNTADLEW------YTSLRQNGSVPHGGFGLGLERF 439

Query: 558 AMFLTDSNTIREVLLF 573
             +L  ++ IR+ + F
Sbjct: 440 VSWLFGAHNIRDSIPF 455

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 375 KFHPDPN---DPSKE 386
           KF P  N   +PS E
Sbjct: 400 KFKPTYNPYTEPSME 414

>Scas_707.14
          Length = 499

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM--GVTG---L 401

Query: 375 KFHPDPN---DPSKE 386
           +F P  N   +PS E
Sbjct: 402 RFKPTYNPYTEPSME 416

>KLLA0F08371g 779264..781009 no similarity, hypothetical start
          Length = 581

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 18/170 (10%)

Query: 221 FGFKDQETRYRKRYLDLIMNKDARGR-----FITRSKIITYIRKFLDNRDFIEVETPMMN 275
           FG  +   RYR + ++ + + D+ G+     FIT +++   +    D  D+I  +  + +
Sbjct: 416 FGPIESGARYRAKMVNDMKSDDSTGKPRWCHFITSAEMKGILDFIFDGLDYIANDDTLPD 475

Query: 276 VIAGGATAKPFVTHHNDLDMQMYMRIAPELFLKQL--VVGGMDRVY--EIGRQFRNEGID 331
            ++ G    PF  H + +   M   ++ +  +K    V+ G  +V+  E+ +Q    G D
Sbjct: 476 KLSKGIKPNPFKQHESRIRSHMVGYVSGKKCMKDAKNVLTGERKVFAEEMYKQVI--GYD 533

Query: 332 MTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMV-----KEITGDYKIKF 376
               P  T  EF  A  +V  +MD  E LF +          TG YK++F
Sbjct: 534 DKRRPYNTLKEF--AVMEVKYMMDNIEDLFGKFYWVDPGTVPTGGYKVRF 581

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 375 KFHPDPN---DPSKE 386
           +F P  N   +PS E
Sbjct: 402 RFKPTYNPYTEPSME 416

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 35.8 bits (81), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 375 KFHPDPN---DPSKE 386
           +F P  N   +PS E
Sbjct: 402 RFKPTYNPYTEPSLE 416

>Kwal_47.17998
          Length = 499

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM--GVTG---L 401

Query: 375 KFHPDPN---DPSKE 386
           +F P  N   +PS E
Sbjct: 402 RFKPTYNPYTEPSME 416

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGDYKI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M   +TG   +
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM--GVTG---L 405

Query: 375 KFHPDPN---DPSKE 386
           +F P  N   +PS E
Sbjct: 406 RFKPTYNPYTEPSME 420

>YCR024C (YCR024C) [558] chr3 complement(160739..162217)
           Asparaginyl-tRNA synthetase, mitochondrial [1479 bp, 492
           aa]
          Length = 492

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 86/429 (20%), Positives = 159/429 (37%), Gaps = 54/429 (12%)

Query: 173 LLKRGDIVGVEGYVGRTQP--KKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRY 230
           +LK G  + +     ++ P  K+  E +I   V  I+L+ P     P      K Q  RY
Sbjct: 80  ILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGPVSENYPLQK---KYQTLRY 136

Query: 231 RK-----RYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKP 285
            +     +Y    ++   R R     + + Y +K      F +V  P++         + 
Sbjct: 137 LRSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQK----NHFTKVSPPILTSNDCEGAGEL 192

Query: 286 FVTHHND-------LDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPE 337
           F    N             Y+ ++ +L L+ L +  + R + +   FR E  D   H  E
Sbjct: 193 FQVSTNTSPTASSYFGKPTYLTVSTQLHLEILALS-LSRCWTLSPCFRAEKSDTPRHLSE 251

Query: 338 FTTCEFYQAYAD-VYDLMDMTELLFSEMVKEITGDY-----KIKFHPDPNDPSKEYDIN- 390
           F   E    + + V +L    E     ++K    +      K       N+ S E  IN 
Sbjct: 252 FWMLEVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFISSQENNASSELSINQ 311

Query: 391 ----FARPWKRINMIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNAR 446
                   W+  ++I E  K  N+T+    ++      E +     + K   P    + +
Sbjct: 312 ETQQIKTRWE--DLINE--KWHNITYTNAIEILKKRHNE-VSHFKYEPKWGQPLQTEHEK 366

Query: 447 MLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSRDQPG-LCERFEVFV-ATKEICNAYTE 504
            L    GE   +   P F+  +P++  P        P      F++ V    EI      
Sbjct: 367 FL---AGEYFKS---PVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEIIGGSLR 420

Query: 505 LNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDS 564
            +D +D+  R E +AR  ++  +      + + +  + G  P GG+G G +R   +L  +
Sbjct: 421 EDD-YDKLCR-EMKARGMNRSGEL-----DWYVSLRKEGSAPHGGFGLGFERFISYLYGN 473

Query: 565 NTIREVLLF 573
           + I++ + F
Sbjct: 474 HNIKDAIPF 482

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 84  LRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGE 117
           L+K     P+    +  IGLP F N + HL+ GE
Sbjct: 249 LKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGE 282

>KLLA0C15851g complement(1378324..1380579) some similarities with
           sgd|S0006294 Saccharomyces cerevisiae YPR089w/YPR090w,
           hypothetical start
          Length = 751

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 64  NMADLDPSKYFEARSRQIQELRK--TQEPNPYPHKFNVTIGLPAFLNKYAHLQR 115
           N   L+P +Y    S  I+ L     + PN YPHK N+   +     +YAH +R
Sbjct: 250 NYKHLEPRQYISFTSLDIESLSSLVAKLPNKYPHKPNIAAAVTFQCIRYAHHKR 303

>Kwal_34.15989
          Length = 506

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 390 NFARPWKRINMIEELEKRFNVTFPAGDQL 418
           N A+PW  +N   +L+++ +  FP  DQL
Sbjct: 95  NLAQPWVYLNATNDLQRKISSLFPFSDQL 123

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 509 FDQRARFEEQARQKD----QGDDEAQLIDETFCN--ALEYGLPPTGGWG---CGVDRLAM 559
           FDQ +  E + R +      GDDE Q +++ F N       LPP GG+G   C    L M
Sbjct: 148 FDQTSDSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVM 207

Query: 560 FLT 562
           F T
Sbjct: 208 FST 210

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 536 FCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           + N  + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 420 YVNLRKQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>Scas_628.24
          Length = 487

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 543 GLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 447 GSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

>KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces
           cerevisiae YGL190c CDC55 ser/thr phosphatase 2A
           regulatory subunit B singleton, start by similarity
          Length = 452

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 11/61 (18%)

Query: 360 LFSEMVKEITGDYKIKFHPDPNDPS-------KEYDINF-ARPWKRINMIEELEKRFNVT 411
            F+E+   I+    +KF PD    +       K +DIN   +P K IN+ E+LE+R N T
Sbjct: 282 FFTEITSSISD---VKFSPDGRYIASRDYLTVKIWDINMDNKPLKTINIHEQLEERLNDT 338

Query: 412 F 412
           +
Sbjct: 339 Y 339

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,480,016
Number of extensions: 820032
Number of successful extensions: 2159
Number of sequences better than 10.0: 54
Number of HSP's gapped: 2155
Number of HSP's successfully gapped: 63
Length of query: 578
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 471
Effective length of database: 12,891,983
Effective search space: 6072123993
Effective search space used: 6072123993
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)