Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR036W30630015500.0
Sklu_2357.331530811131e-154
Kwal_27.1054330330211111e-154
YBR061C (TRM7)31030911061e-153
CAGL0H10252g30930910881e-150
KLLA0F18414g30130110871e-150
Scas_718.4630930910811e-149
Kwal_33.130548302914423e-49
AFR734C8452124266e-47
Scas_642.128392114212e-46
Sklu_2421.108492854204e-46
YCL054W (SPB1)8412854204e-46
CAGL0B00484g8372674171e-45
KLLA0C00737g8332114152e-45
KLLA0B01980g2892462516e-25
CAGL0H08954g2812402088e-19
Kwal_56.241583071351728e-14
AFL117C3031041692e-13
Sklu_2160.23151051673e-13
Scas_720.46321931579e-12
YGL136C (MRM2)3201031506e-11
ADL215W48437671.9
YMR106C (YKU80)62999672.1
CAGL0H06369g39152627.2
YBR158W (AMN1)54919619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR036W
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   601   0.0  
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        433   e-154
Kwal_27.10543                                                         432   e-154
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   430   e-153
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   423   e-150
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   423   e-150
Scas_718.46                                                           421   e-149
Kwal_33.13054                                                         174   3e-49
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   168   6e-47
Scas_642.12                                                           166   2e-46
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     166   4e-46
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   166   4e-46
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   165   1e-45
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   164   2e-45
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...   101   6e-25
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    85   8e-19
Kwal_56.24158                                                          71   8e-14
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    70   2e-13
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            69   3e-13
Scas_720.46                                                            65   9e-12
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    62   6e-11
ADL215W [1526] [Homologous to ScYNL022C - SH] complement(326586....    30   1.9  
YMR106C (YKU80) [4063] chr13 complement(478300..480189) Componen...    30   2.1  
CAGL0H06369g 627708..628883 highly similar to sp|P31373 Saccharo...    28   7.2  
YBR158W (AMN1) [343] chr2 (556505..558154) Protein involved in t...    28   9.9  

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/300 (97%), Positives = 292/300 (97%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60

Query: 61  RELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDG 120
           RELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDG
Sbjct: 61  RELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDG 120

Query: 121 APDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKV 180
           APDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKV
Sbjct: 121 APDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKV 180

Query: 181 TCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQPLTPGRP 240
           TCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSV        QNWSIQQPLTPGRP
Sbjct: 181 TCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQPLTPGRP 240

Query: 241 LPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKRSG 300
           LPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKRSG
Sbjct: 241 LPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKRSG 300

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  433 bits (1113), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 245/308 (79%), Gaps = 13/308 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQG+RARSAFKLLQLND FHFLD V RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RELF----PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFV 116
           R+LF     +     K+IVAVDLQPMS I+HVTTLQADITHP TL KI+ELF G+KADFV
Sbjct: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120

Query: 117 CSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLL 176
           CSDGAPDVTGLHDLDEYVQQQLILSAL+LT  LL  GGCFVAKIFRGRD+DMLYSQLG L
Sbjct: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180

Query: 177 FDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQPLT 236
           F++V CAKPRSSRG+SLESFIVC GY PP +W P+++ N S+                LT
Sbjct: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGR-----LT 235

Query: 237 PGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLP----KSATALDPVQSPTNPPYKR 292
               L  + +  R IA F+SCGGLDSFDSDATYH++      S +ALDPVQ+PTNPPYK+
Sbjct: 236 LQDNLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKK 295

Query: 293 ALELKRSG 300
           ALELKRSG
Sbjct: 296 ALELKRSG 303

>Kwal_27.10543
          Length = 303

 Score =  432 bits (1111), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/302 (72%), Positives = 243/302 (80%), Gaps = 7/302 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+G+RARSAFKLLQL+++FHFLD V RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RELFPDGKNTK--KRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCS 118
           R LF      K  KRIV+VDLQPM  IE+VTT+QADITHP+TL KI++LF GEKADFVCS
Sbjct: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120

Query: 119 DGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFD 178
           DGAPDVTGLHDLDEYVQQQLILSAL+LT  LL  GG FVAKIFRGRDIDMLYSQL  LF+
Sbjct: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180

Query: 179 KVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQPLTPG 238
           +V CAKPRSSRGTSLESFIVC GY PP +W P+++ N+SV        Q   I + L+  
Sbjct: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSV----EDFFQGCDIGR-LSLD 235

Query: 239 RPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKR 298
             LP Y    R +A FISCGGLDSFDSDATYHD+P     L+PVQ PTNPPYKRALELKR
Sbjct: 236 DKLPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKR 295

Query: 299 SG 300
            G
Sbjct: 296 KG 297

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  430 bits (1106), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 245/309 (79%), Gaps = 14/309 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLD--GVQRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKEQG+RARSAFKLLQLND+FHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRELF---PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADF 115
           LSR+LF   P      ++IV+VDLQPMS I HVTTLQADITHP+TL +I++LF  EKADF
Sbjct: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120

Query: 116 VCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGL 175
           VCSDGAPDVTGLHDLDEYVQQQLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQLG 
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180

Query: 176 LFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQPL 235
           LFDK+ CAKPRSSRGTSLE+FIVC GY PP +W P ++ N SV         N      L
Sbjct: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLN-----KL 235

Query: 236 TPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKS----ATALDPVQSPTNPPYK 291
                L  ++E  R IA F++CG L SFDSDATYHDLP S    +++LDPVQSPTNPPYK
Sbjct: 236 CISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYK 295

Query: 292 RALELKRSG 300
           +ALELKRSG
Sbjct: 296 KALELKRSG 304

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  423 bits (1088), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/309 (68%), Positives = 241/309 (77%), Gaps = 15/309 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDG--VQRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKE+G+RARSA+KLLQLN+EFHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 59  LSRELFP------DGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEK 112
           LSR+LF       DG+   ++I+AVDLQPMS I+HV TLQADITHPRTL +I ELF  +K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 113 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQ 172
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 173 LGLLFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXX-XXQNWSI 231
           LG LF+K+ CAKPRSSRGTSLE+FIVC GY PP  W P ++ N SV            SI
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 232 QQPLTPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYK 291
              L P +  P      R IA F++CG L S+DSDATYHDLPK   ALDPVQ+PTNPPYK
Sbjct: 241 DDTLQPWKDQP------RSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYK 294

Query: 292 RALELKRSG 300
           RALELKR G
Sbjct: 295 RALELKRDG 303

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  423 bits (1087), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 240/301 (79%), Gaps = 7/301 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQG+RARSAFKLLQL+D+FHFL    RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQQAVRVVDLCAAPGSWSQVLS 60

Query: 61  RELFPDGK-NTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSD 119
           R LFP    N+ ++IVAVDLQPMS I++V TLQADITHP+TL  I ELF+G+KADF+CSD
Sbjct: 61  RRLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSD 120

Query: 120 GAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDK 179
           GAPDVTGLHDLDEYVQQQLILSAL+L+  LL  GG FVAKIFRGRDIDMLYSQLG LF+K
Sbjct: 121 GAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK 180

Query: 180 VTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQPLTPGR 239
           V CAKPRSSRGTSLESFIVC GY PP +W P ++ N SV        Q   I + L    
Sbjct: 181 VICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSV----EDFFQGCDIGK-LRLED 235

Query: 240 PLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKRS 299
             P Y E  R IA FI+CGGL SFDSDATYH +  S  ALDPVQSPTNPPYK+ALELKR 
Sbjct: 236 KCPNYHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELKRR 294

Query: 300 G 300
           G
Sbjct: 295 G 295

>Scas_718.46
          Length = 309

 Score =  421 bits (1081), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 216/309 (69%), Positives = 245/309 (79%), Gaps = 15/309 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLD--GVQRVVDLCAAPGSWSQV 58
           MGK+SKDKRD+YYRKAKEQGFRARSAFKLLQLND+FHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRELFPDGKNTK----KRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKAD 114
           LS++LF DGK  +    ++IVAVDLQPMS I HVTTLQADITHP+TL +I++LF  EKAD
Sbjct: 61  LSQKLF-DGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKAD 119

Query: 115 FVCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLG 174
           FVCSDGAPDVTGLHDLDEYVQQQLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQLG
Sbjct: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLG 179

Query: 175 LLFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWSIQQP 234
            LFDKV CAKP+SSRGTSLE+FIVC GY PP  W   ++ N SV         +      
Sbjct: 180 YLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMS-----K 234

Query: 235 LTPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYH--DLPKS-ATALDPVQSPTNPPYK 291
           L+    LP + E  R IA F+SCG L+SFDSDATYH  D  +   T+LDPVQSPTNPPYK
Sbjct: 235 LSIHDKLPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYK 294

Query: 292 RALELKRSG 300
           +ALELKRSG
Sbjct: 295 KALELKRSG 303

>Kwal_33.13054
          Length = 830

 Score =  174 bits (442), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 151/291 (51%), Gaps = 24/291 (8%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N++F HF++  + V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +K+    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q  L L ALKL V  L  GG FV KIFR +D + L      LFDKV 
Sbjct: 122 PNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQLFDKVE 181

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQN--WSIQQPLTPGR 239
             KP +SR  S E F+VC+G+  P    P +     V        QN    I  P    R
Sbjct: 182 ATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDAKEVFEELPDGPQNNEAKIYNPEKKVR 241

Query: 240 PLPMYSEG------HRGIAPFISC-------GGLDSF---DSDATYHDLPK 274
               Y EG      H+ I  F+ C       G L+ F   D+D+ +  L K
Sbjct: 242 KRQGYEEGDYLLYHHKPIMDFVRCEDPIEMLGSLNKFTVDDNDSEWKILRK 292

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  168 bits (426), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 129/212 (60%), Gaps = 8/212 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N++F HFL+  + V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +K+    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDL-DEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKV 180
           P+V GL+ + D + Q  L L ALKL V  L  GG FV KIFR +D + L      LFDKV
Sbjct: 122 PNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQLFDKV 180

Query: 181 TCAKPRSSRGTSLESFIVCQGYTPPLSWAPNI 212
              KP +SR  S E F+VC+G+  P    P +
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Scas_642.12
          Length = 839

 Score =  166 bits (421), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/211 (44%), Positives = 125/211 (59%), Gaps = 6/211 (2%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N++F HFL+  + V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +  T Q+DIT     +K+    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q QL L ALKL    L  GG FV K+FR +D + L      LFDKV 
Sbjct: 122 PNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQLFDKVE 181

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNI 212
             KP +SR  S E F+VC+G+  P    P +
Sbjct: 182 ATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  166 bits (420), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 144/285 (50%), Gaps = 21/285 (7%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N++F HFL+  + V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +++    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q  L L ALKL V  L  GG FV K+FR +D + L      LF++V 
Sbjct: 122 PNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQLFERVE 181

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWS--IQQPLTPGR 239
             KP +SR  S E F+VC+G+  P    P +     V        QN    +  P    R
Sbjct: 182 ATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEELPDGPQNMEAKVYNPEKKTR 241

Query: 240 PLPMYSEGH-------------RGIAPFISCGGLDSFDSDATYHD 271
               Y+EG              R   P    G L+ F  D   H+
Sbjct: 242 KRDGYAEGDYLLYHVAPIMEFVRTEDPITMLGELNKFTVDKEEHE 286

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  166 bits (420), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 144/285 (50%), Gaps = 21/285 (7%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N+++ HFL+  + V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +K+    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q QL L ALKL V  L   G FV KIFR +D + L      LF+KV 
Sbjct: 122 PNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKVE 181

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWS--IQQPLTPGR 239
             KP +SR  S E F+VC+G+  P    P +     V        QN    I  P    R
Sbjct: 182 ATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEVFEELPDGQQNMESKIYNPEKKVR 241

Query: 240 PLPMYSEGH-------------RGIAPFISCGGLDSFDSDATYHD 271
               Y EG              R   P    G ++ F  D   H+
Sbjct: 242 KRQGYEEGDNLLYHETSILDFVRTEDPISMLGEMNKFTIDENDHE 286

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  165 bits (417), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 141/267 (52%), Gaps = 10/267 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N++F HFL+  + V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +++    K  KAD V  DGA
Sbjct: 67  -LCP----VNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHDGA 121

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q  L L ALKL V  L   G FV KIFR +D + L      LF+KV 
Sbjct: 122 PNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKVE 181

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVXXXXXXXXQNWS--IQQPLTPGR 239
             KP +SR  S E F+VC+G+  P    P +     V        QN    I  P    R
Sbjct: 182 ATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEELPDGPQNMEAKIYNPEKKVR 241

Query: 240 PLPMYSEGHRGIAPFISCGGLDSFDSD 266
               Y EG   +  +  C  LD   S+
Sbjct: 242 KRQGYEEGDHLL--YHECSVLDFVKSE 266

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 124/211 (58%), Gaps = 6/211 (2%)

Query: 3   KSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEF-HFLDGVQRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+G+RARS+FK++Q+N+++ HFL+  + V+DLCAAPGSW QV S 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASN 67

Query: 62  ELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGA 121
            L P        I+ VD+ PM  + +V T Q+DIT     +K+    K  KAD V  DGA
Sbjct: 68  -LCP----VNSLIIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGA 122

Query: 122 PDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVT 181
           P+V      D + Q  L L ALKL V  L  GG FV KIFR +D + L      LF+KV 
Sbjct: 123 PNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQLFEKVE 182

Query: 182 CAKPRSSRGTSLESFIVCQGYTPPLSWAPNI 212
             KP +SR  S E F+VC+ +  P    P +
Sbjct: 183 ATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score =  101 bits (251), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 113/246 (45%), Gaps = 54/246 (21%)

Query: 5   SKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLSRELF 64
           ++ K D + + AKEQ FR+R+AFKL+ ++D++ F    Q+V+DL  APG+WSQV  + + 
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQNQKVLDLGFAPGAWSQVARKRIG 94

Query: 65  PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRT-------LTKIIELFKGEK----- 112
             G      I+ VDL   +  + V +LQA+I   +T         + I+L K ++     
Sbjct: 95  SGG-----MIMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQLHKDH 149

Query: 113 -------------------------------------ADFVCSDGAPDVTGLHDLDEYVQ 135
                                                 D V SD   + TG+   D Y+ 
Sbjct: 150 GYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSKDHYMS 209

Query: 136 QQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVTCAKPRSSRGTSLES 195
             L  +AL + + LL PGG F  K++ G +  +L  +L  +F KV   KP +SR  S E 
Sbjct: 210 MDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRNESKEL 269

Query: 196 FIVCQG 201
           + V +G
Sbjct: 270 YFVARG 275

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 84.7 bits (208), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 103/240 (42%), Gaps = 52/240 (21%)

Query: 6   KDKRDLYYRKAKEQGFRARSAFKLLQLNDEFH-FLDGV-QRVVDLCAAPGSWSQVLSREL 63
           + K+D Y R++K    R+R+ FKL QL+D +H F   V QR++DL  APG+WSQV  +  
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 64  FPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGE------------ 111
            PD       ++ VD+ P      V+++QA+I   RT   I + F  +            
Sbjct: 92  HPDSI-----VLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVESMA 146

Query: 112 ------------KADFVCSD---------------------GAPDVTGLHDLDEYVQQQL 138
                         + + SD                        + +GL+  D      L
Sbjct: 147 RNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNSIDL 206

Query: 139 ILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVTCAKPRSSRGTSLESFIV 198
             +AL   V LL P G F+ K F G +  +   ++  +FD+V   KP +SR  S E + +
Sbjct: 207 CDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEIYFI 266

>Kwal_56.24158
          Length = 307

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 71/135 (52%), Gaps = 14/135 (10%)

Query: 6   KDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFL--DGVQRVVDLCAAPGSWSQVLSREL 63
           + K D + R AK QG R+R+AFKL+Q++D+ H    +  Q V+DL  APG+WSQV     
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQVAFDRT 94

Query: 64  FPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSDGAPD 123
            PDG      I+ VD+ P +    V+++QA+I   +T  ++I LF   +      D    
Sbjct: 95  GPDGV-----ILGVDILPCAPPRGVSSIQANILSRKT-HELIRLFFSRQFQLYYED---- 144

Query: 124 VTGLHDLDEYVQQQL 138
              LH  + Y Q  L
Sbjct: 145 --RLHKDNGYFQHML 157

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%)

Query: 119 DGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFD 178
           D   + +G+   D Y    L  +AL   + LL PGG FV K++ G++  +L ++L  +F+
Sbjct: 210 DRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKEDRILENRLKQVFN 269

Query: 179 KVTCAKPRSSRGTSLESFIV 198
           +V   KP +SR  S E + V
Sbjct: 270 EVQRFKPTASRDESKELYFV 289

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 64/104 (61%), Gaps = 6/104 (5%)

Query: 5   SKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLSRELF 64
           S+ +RD Y R+AK Q  R+R+AFKL++++++F      QRV+DL  APG+WSQV  +   
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAQQRTQ 91

Query: 65  PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELF 108
           P GK     ++ VD+ P      V+++QA+    +T  +++ L+
Sbjct: 92  PGGK-----VMGVDVLPCKPPTGVSSIQANALSRKT-HELVRLY 129

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%)

Query: 123 DVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVTC 182
           + +G+   D Y+   L  +AL   ++LL PGG FV K++ G++  +L  +L  +F KV  
Sbjct: 212 NTSGVAVKDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRR 271

Query: 183 AKPRSSRGTSLESFIV 198
            KP + R  S E + V
Sbjct: 272 FKPEACRSESKELYFV 287

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 8/105 (7%)

Query: 6   KDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFL--DGVQRVVDLCAAPGSWSQVLSREL 63
           + + D Y ++AK Q  R+R+AFKL++L+D F F   +  QRV+DL  APG+WSQV     
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQVAFDRT 95

Query: 64  FPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELF 108
            P+G      ++ VD+ P      V+++QA+I   +T  ++I LF
Sbjct: 96  KPNGM-----VLGVDILPCKPPRGVSSIQANILSRKT-HELIRLF 134

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (55%)

Query: 123 DVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVTC 182
           + TG+   D Y+   L  +AL + + LL PGG F  K++ G++  +L  ++ ++F KV  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 183 AKPRSSRGTSLESFIVCQG 201
            KP SSR  S E + V  G
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>Scas_720.46
          Length = 321

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 58/93 (62%), Gaps = 7/93 (7%)

Query: 10  DLYYRKAKEQGFRARSAFKLLQLNDEFHFLD--GVQRVVDLCAAPGSWSQVLSRELFPDG 67
           D Y R+AK   FR+R+AFKL +++D+FH  +   +QRV+DL  APG+WSQV +RE     
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQV-ARE----R 96

Query: 68  KNTKKRIVAVDLQPMSRIEHVTTLQADITHPRT 100
            + +  I+ VD+ P      V+ +QA+I   +T
Sbjct: 97  TSKESMILGVDILPCDPPHGVSAIQANILSKKT 129

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 123 DVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDKVTC 182
           + +GL   D      L  +AL   + LL P G FV K+F G +  +   ++ ++F K   
Sbjct: 230 NTSGLTVRDHQHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIR 289

Query: 183 AKPRSSRGTSLESFIV 198
            KP+SSR  S E +I+
Sbjct: 290 FKPKSSRNESKEVYII 305

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 9   RDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGV---QRVVDLCAAPGSWSQVLSRELFP 65
           +D Y ++AK Q  R+R+AFKL+Q++D++         QR++DL  APG+WSQV  +   P
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSP 96

Query: 66  DGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELF 108
           +       I+ VD+ P      V ++QA+I   RT   +I LF
Sbjct: 97  NSM-----ILGVDILPCEPPHGVNSIQANILAKRT-HDLIRLF 133

>ADL215W [1526] [Homologous to ScYNL022C - SH]
           complement(326586..328040) [1455 bp, 484 aa]
          Length = 484

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 45  VVDLCAAPGSWSQVLSRELFPDGKNTKKRIVAVDLQP 81
           ++D CAAPG+ +  ++  +FP+G     +I A +  P
Sbjct: 243 IIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDP 279

>YMR106C (YKU80) [4063] chr13 complement(478300..480189) Component
           of DNA end-joining repair pathway, involved in
           protecting telomeres from homologous recombination, acts
           in a complex with Yku70p [1890 bp, 629 aa]
          Length = 629

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 18  EQGFRARSAFK-LLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLSRELFPDGKNTKKR--- 73
           +Q F+AR   K ++   D    LD     +DL     S ++++  +   D +  +K+   
Sbjct: 118 KQQFQARKILKQIVVFTDNLDDLDITDEEIDLLTEELS-TRIILIDCGKDTQEERKKSNW 176

Query: 74  IVAVDLQPMSRIEHVTTLQADITHPRT-LTKIIELFKGE 111
           +  V+  P SRI ++  L  +IT P T + K + +F GE
Sbjct: 177 LKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGE 215

>CAGL0H06369g 627708..628883 highly similar to sp|P31373
           Saccharomyces cerevisiae YAL012w CYS3, start by
           similarity
          Length = 391

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 243 MYSEGHRGIAPFISCGGLDSFDSDATYHDLPK---SATALDPVQSPTNPPYK 291
           +Y   HR      +  G+D+  ++    DLPK     T L  ++SPTNP  K
Sbjct: 103 VYGGTHRYFTKVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLK 154

>YBR158W (AMN1) [343] chr2 (556505..558154) Protein involved in the
           AMEN pathway (Antagonist of Mitotic Exit Network) in
           daughter cells required for exit from mitotic exit and
           cell cycle reset [1650 bp, 549 aa]
          Length = 549

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 12/19 (63%)

Query: 196 FIVCQGYTPPLSWAPNIEK 214
           F VC   TPPLSW  N+ K
Sbjct: 319 FYVCPRITPPLSWFDNLHK 337

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,700,178
Number of extensions: 385966
Number of successful extensions: 830
Number of sequences better than 10.0: 30
Number of HSP's gapped: 784
Number of HSP's successfully gapped: 37
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)