Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR035C2072039801e-137
Sklu_2357.42041696212e-82
Kwal_27.105452021676193e-82
YDR041W (RSM10)2031775882e-77
CAGL0K12056g2351745791e-75
KLLA0F18436g2071725691e-74
Scas_569.12411795471e-70
YMR076C (PDS5)127748642.6
Kwal_23.5312566125606.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR035C
         (203 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   382   e-137
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           243   2e-82
Kwal_27.10545                                                         243   3e-82
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   231   2e-77
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   227   1e-75
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   223   1e-74
Scas_569.1                                                            215   1e-70
YMR076C (PDS5) [4035] chr13 complement(416195..420028) Protein r...    29   2.6  
Kwal_23.5312                                                           28   6.6  

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  382 bits (980), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/203 (91%), Positives = 186/203 (91%)

Query: 1   MLSVFGLRTVARCNSTLXXXXXXXXXXXXXXXXXQYSALPKSVHALYFQPLKLPVKHHDL 60
           MLSVFGLRTVARCNSTL                 QYSALPKSVHALYFQPLKLPVKHHDL
Sbjct: 1   MLSVFGLRTVARCNSTLASGGARAAAAAGGKAGAQYSALPKSVHALYFQPLKLPVKHHDL 60

Query: 61  VADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLPTRRERWTVIRAPFAHAKSKEN 120
           VADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLPTRRERWTVIRAPFAHAKSKEN
Sbjct: 61  VADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLPTRRERWTVIRAPFAHAKSKEN 120

Query: 121 FERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQRESVQLAQELADVPLAP 180
           FERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQRESVQLAQELADVPLAP
Sbjct: 121 FERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQRESVQLAQELADVPLAP 180

Query: 181 GAPQTADEVVGAKVAELMQSPEF 203
           GAPQTADEVVGAKVAELMQSPEF
Sbjct: 181 GAPQTADEVVGAKVAELMQSPEF 203

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  243 bits (621), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 108/169 (63%), Positives = 140/169 (82%), Gaps = 2/169 (1%)

Query: 37  SALPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPK 96
           +A P +V A+Y  PLKLP+ H DLVADLQLR++DN++LDFF++F LR G+YLG+P+TGPK
Sbjct: 32  NAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFYLGMPLTGPK 91

Query: 97  PLPTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVG 156
           PLPTRRERWTVIR+PFA AKSKENFERHTHKRL+R+WD NPEV+E++LSY+TKHS+ GVG
Sbjct: 92  PLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYLTKHSIPGVG 151

Query: 157 MKCNMFQRESVQLAQEL--ADVPLAPGAPQTADEVVGAKVAELMQSPEF 203
           +KCN++QRE V+L+  +  + +P   G  +T DE VG +V EL+  PEF
Sbjct: 152 IKCNVYQREGVRLSDSIDTSVLPELEGNTKTLDEAVGERVVELLNDPEF 200

>Kwal_27.10545
          Length = 202

 Score =  243 bits (619), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 139/167 (83%), Gaps = 2/167 (1%)

Query: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98
           LP +V A+Y+ PL++P+ H DL+ADLQLR++D+++LDFFA+F LR G+YLG+P+TGPKPL
Sbjct: 32  LPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPL 91

Query: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158
           PTRRERWTVIR+PFA AKSKENFERHTHKRL+R+WD NPEVVE++LSYI+KHS+ GVG+K
Sbjct: 92  PTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIK 151

Query: 159 CNMFQRESVQLAQELADVPL--APGAPQTADEVVGAKVAELMQSPEF 203
           CN+FQ+E +QL+Q L    L  +PG   + DE VG +V EL+ S  F
Sbjct: 152 CNLFQKEGLQLSQNLEQNSLLQSPGKSNSLDEAVGERVLELLNSENF 198

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  231 bits (588), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 133/177 (75%), Gaps = 14/177 (7%)

Query: 40  PKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLP 99
           P +V A+Y+ PLKLP+K+ DLVAD+QLR++DN++LDF+++F LR GYYLGIP+TGPKPLP
Sbjct: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80

Query: 100 TRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKC 159
           TRRERWTVI++PF HAKSKENFERHTHKRL+R WD NPEV++M ++YITKHSMAGVGMKC
Sbjct: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140

Query: 160 NMFQRESVQLAQELADVPLAPGAPQTADEV-------------VGAKVAELMQSPEF 203
           N FQR  + L    +D      +    DE+             VG KV EL+ SP+F
Sbjct: 141 NFFQRSEISLDLG-SDANGLEKSLSNIDELYSLRNDDKAQTSAVGQKVLELLDSPDF 196

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  227 bits (579), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 135/174 (77%), Gaps = 11/174 (6%)

Query: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98
           LP +V ALY+ PLK PV H  LVADLQLRA+DN++LDFF +F LR GYYLG+PMTGPKPL
Sbjct: 57  LPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPL 116

Query: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158
           PTRRERWTVIR+PF HAKSKENFERHTHKRL+R+WD+NPEVV+M + YITK+S+AGVG+K
Sbjct: 117 PTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLK 176

Query: 159 CNMFQRESV-----QLAQELADV----PLAPGAPQTADEVVGAKVAELMQSPEF 203
           C  +QR +V     +++  + ++     + P   +  +E +GAKV EL+ +P F
Sbjct: 177 CTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKE--NEEIGAKVVELLNTPTF 228

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  223 bits (569), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 133/172 (77%), Gaps = 6/172 (3%)

Query: 37  SALPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPK 96
           + +PK V A+Y  PLK+   H DL+AD+QLR++DN++LDFF++F LR GYYLGIPM GPK
Sbjct: 32  TPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPK 91

Query: 97  PLPTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVG 156
           PLPT+R+RWTVIRAPF  AKSKENFERHTH RL+RL+D N E+VE  LSYI+KH ++GVG
Sbjct: 92  PLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVG 151

Query: 157 MKCNMFQRESVQL-----AQELADVPLAPGAPQTADEVVGAKVAELMQSPEF 203
           +KCN++QRE + L       EL ++ ++    Q  D+VVGAKV EL+ +PEF
Sbjct: 152 IKCNLYQREPIDLDSKKDGPELENIDIS-SQLQGLDDVVGAKVVELLNNPEF 202

>Scas_569.1
          Length = 241

 Score =  215 bits (547), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 94/179 (52%), Positives = 133/179 (74%), Gaps = 14/179 (7%)

Query: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98
           +P ++ A+Y  PL+ P+K+ DLVA++QLR++DN++LDF+++FALRVG+YLGIP+TGPKPL
Sbjct: 59  VPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPL 118

Query: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158
           PTRRERWTVI++PF HAKSKENFERHTHKR++++WD N E++EM++SYITKH+MAGVGMK
Sbjct: 119 PTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMK 178

Query: 159 CNMFQRESVQLAQELAD--------------VPLAPGAPQTADEVVGAKVAELMQSPEF 203
           C +FQR  +   ++  +              V        T +++V  K+ EL+   EF
Sbjct: 179 CTVFQRSPIASKEDATNGVSSSDSSSVLKSIVNQKDDVKLTDNDLVNEKIVELLGREEF 237

>YMR076C (PDS5) [4035] chr13 complement(416195..420028) Protein
           required for sister chromatid cohesion and chromosome
           condensation functions [3834 bp, 1277 aa]
          Length = 1277

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 126 HKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQRESVQLAQEL 173
           HK +LRLW+  PE++   + +I  H ++    +  +F++E+ +L  ++
Sbjct: 263 HKLVLRLWETVPELINAVIGFIY-HELSS---ENELFRKEATKLIGQI 306

>Kwal_23.5312
          Length = 566

 Score = 27.7 bits (60), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 50/125 (40%), Gaps = 18/125 (14%)

Query: 94  GPKPLPTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYI------ 147
           GP P  TR +  T++     +  +K  F+    + L+   D N +++  F  ++      
Sbjct: 426 GPLPPLTRNDLLTILMKSIMNNTAKVYFKLDLTQDLVYFGDENRKLLTPFSKHLYLGTRN 485

Query: 148 ----TKHSMA----GVGM----KCNMFQRESVQLAQELADVPLAPGAPQTADEVVGAKVA 195
                 HS+      VG+     C +    SVQ   EL    +A   P++  +    K +
Sbjct: 486 ISPSASHSLKEWVDNVGVFETTPCRLKDMSSVQFLHELQQSRVASTVPESNSQTKSFKYS 545

Query: 196 ELMQS 200
           +L+ S
Sbjct: 546 QLLTS 550

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,755,815
Number of extensions: 217310
Number of successful extensions: 445
Number of sequences better than 10.0: 10
Number of HSP's gapped: 439
Number of HSP's successfully gapped: 10
Length of query: 203
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 106
Effective length of database: 13,238,163
Effective search space: 1403245278
Effective search space used: 1403245278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)