Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR034W1591568201e-114
CAGL0H10274g1141113401e-41
Kwal_27.10546104983345e-41
YBR062C1151123303e-40
Scas_560.6*1181172922e-34
KLLA0F18458g140902854e-33
Scas_625.11274731425e-11
KLLA0F12166g1528661129e-07
Scas_644.6510661111e-06
CAGL0E02299g545651056e-06
Kwal_56.22522513771012e-05
ACL019C57573986e-05
YOL013C (HRD1)55183986e-05
Sklu_1684.114461912e-04
KLLA0F25674g75785942e-04
KLLA0C05874g55358923e-04
CAGL0L01947g75761924e-04
Sklu_2102.175125907e-04
Sklu_2432.9147549908e-04
Scas_665.139259898e-04
Kwal_56.2311213572868e-04
Scas_573.9150252890.001
CAGL0B05049g147025870.001
KLLA0C14344g151887870.002
Kwal_56.2390058933850.003
YDL008W (APC11)16566830.003
CAGL0I04576g14969830.003
Kwal_14.1287151864850.003
KLLA0E03960g70428840.003
Sklu_2317.249331840.004
Kwal_26.809975025830.005
AGL217W41460830.005
AFR220W1085104830.006
YOL054W40654820.006
KLLA0E17787g16249800.006
AER016C14742800.006
Sklu_1785.333140820.007
AAL030C153947820.008
ABL058C154681820.008
YDR143C (SAN1)61032810.010
YHL010C58545810.010
ABR104W32877790.014
YKL034W (TUL1)75889800.014
Kwal_27.12327157482800.015
KLLA0E07139g11057760.017
Scas_625.476189780.021
Scas_713.4557039780.024
CAGL0K02563g58641770.026
YLR247C155698780.027
Scas_705.4142856770.032
CAGL0E01441g71732770.034
YMR247C156235760.040
AFR275W75384760.044
Scas_719.51647128760.046
Scas_696.17156453730.10
CAGL0I09988g38758730.10
CAGL0J04796g599116720.13
KLLA0C08756g42727720.14
Kwal_27.1041930048710.14
Kwal_26.803066069710.17
AAR049C44330710.18
Sklu_1676.310128680.18
YLR427W (MAG2)67066710.21
KLLA0F25740g51741700.23
YPR093C28829690.28
Scas_585.5*10957670.28
ADL181W10857660.29
CAGL0M08690g328112690.29
KLLA0E18601g65056690.30
CAGL0K08052g30553680.33
Kwal_55.2205411128660.35
Sklu_2416.811028650.42
Scas_718.7712851660.45
CAGL0H02651g154457680.48
AER390W31624670.53
YOL133W (HRT1)12157650.55
Scas_615.1333031660.78
YCR066W (RAD18)48744660.83
Kwal_55.1999915243640.87
CAGL0B02013g112047651.1
Kwal_55.2120627597641.2
Scas_720.8946963641.3
CAGL0J03586g41123641.3
Kwal_27.10723229150631.7
KLLA0E16720g305118631.9
Kwal_23.628545823622.3
Kwal_26.809052060622.3
YDR265W (PEX10)33724622.6
KLLA0E07568g331131613.0
Sklu_2337.232247613.1
AGL079C50624613.5
KLLA0B08679g36392604.0
KLLA0E21043g132150605.7
YLR323C (CWC24)25948587.0
Kwal_34.16121265117587.1
YER116C (SLX8)27495578.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR034W
         (156 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....   320   e-114
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...   135   1e-41
Kwal_27.10546                                                         133   5e-41
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...   131   3e-40
Scas_560.6*                                                           117   2e-34
KLLA0F18458g complement(1697871..1698293) some similarities with...   114   4e-33
Scas_625.11                                                            59   5e-11
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    48   9e-07
Scas_644.6                                                             47   1e-06
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    45   6e-06
Kwal_56.22522                                                          44   2e-05
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    42   6e-05
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    42   6e-05
Sklu_1684.1 YDL008W, Contig c1684 226-660                              40   2e-04
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    41   2e-04
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    40   3e-04
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    40   4e-04
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          39   7e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              39   8e-04
Scas_665.1                                                             39   8e-04
Kwal_56.23112                                                          38   8e-04
Scas_573.9                                                             39   0.001
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    38   0.001
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    38   0.002
Kwal_56.23900                                                          37   0.003
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    37   0.003
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    37   0.003
Kwal_14.1287                                                           37   0.003
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    37   0.003
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            37   0.004
Kwal_26.8099                                                           37   0.005
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    37   0.005
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    37   0.006
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    36   0.006
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    35   0.006
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    35   0.006
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         36   0.007
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    36   0.008
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    36   0.008
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    36   0.010
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    36   0.010
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    35   0.014
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    35   0.014
Kwal_27.12327                                                          35   0.015
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    34   0.017
Scas_625.4                                                             35   0.021
Scas_713.45                                                            35   0.024
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    34   0.026
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    35   0.027
Scas_705.41                                                            34   0.032
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    34   0.034
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    34   0.040
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    34   0.044
Scas_719.51                                                            34   0.046
Scas_696.17                                                            33   0.10 
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    33   0.10 
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    32   0.13 
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    32   0.14 
Kwal_27.10419                                                          32   0.14 
Kwal_26.8030                                                           32   0.17 
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    32   0.18 
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         31   0.18 
YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing ...    32   0.21 
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    32   0.23 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    31   0.28 
Scas_585.5*                                                            30   0.28 
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    30   0.29 
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    31   0.29 
KLLA0E18601g complement(1645113..1647065) some similarities with...    31   0.30 
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    31   0.33 
Kwal_55.22054                                                          30   0.35 
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          30   0.42 
Scas_718.77                                                            30   0.45 
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    31   0.48 
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    30   0.53 
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    30   0.55 
Scas_615.13                                                            30   0.78 
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    30   0.83 
Kwal_55.19999                                                          29   0.87 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    30   1.1  
Kwal_55.21206                                                          29   1.2  
Scas_720.89                                                            29   1.3  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    29   1.3  
Kwal_27.10723                                                          29   1.7  
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    29   1.9  
Kwal_23.6285                                                           28   2.3  
Kwal_26.8090                                                           28   2.3  
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    28   2.6  
KLLA0E07568g 685564..686559 weakly similar to sp|Q04370 Saccharo...    28   3.0  
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         28   3.1  
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    28   3.5  
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    28   4.0  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    28   5.7  
YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein ...    27   7.0  
Kwal_34.16121                                                          27   7.1  
YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of...    27   8.4  

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score =  320 bits (820), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%)

Query: 1   MPMCDRLRPRILTLTDDQGTRSELRRQLADMFQEADAHSTALLNVIVRLMPEELQQHLQL 60
           MPMCDRLRPRILTLTDDQGTRSELRRQLADMFQEADAHSTALLNVIVRLMPEELQQHLQL
Sbjct: 1   MPMCDRLRPRILTLTDDQGTRSELRRQLADMFQEADAHSTALLNVIVRLMPEELQQHLQL 60

Query: 61  IGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCV 120
           IGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCV
Sbjct: 61  IGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCV 120

Query: 121 SVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWG 156
           SVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWG
Sbjct: 121 SVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWG 156

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score =  135 bits (340), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 80/111 (72%), Gaps = 4/111 (3%)

Query: 50  MPEELQQHL--QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVE 107
           MPE+LQ+ L   +      G  D ++D+LPR+P+K+L   D C ICC  ++ DEYPLVVE
Sbjct: 1   MPEDLQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDDTCPICCSNFIADEYPLVVE 60

Query: 108 LPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK--PEIDGSAAELEEDWG 156
           LP+CGH FD +CVS+WL+++TTCPMCR DV  +K  PE+D S  ELEEDWG
Sbjct: 61  LPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPELDTSKVELEEDWG 111

>Kwal_27.10546
          Length = 104

 Score =  133 bits (334), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (76%)

Query: 59  QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQ 118
           +L+ E   G PD Y+D+LPRV K +L + + C+ICCC Y +D+YPLVVELP+C H FDL+
Sbjct: 4   ELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLE 63

Query: 119 CVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWG 156
           CV+VWLS+S TCP+CR DVL  KP +D S  E+E+DWG
Sbjct: 64  CVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWG 101

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score =  131 bits (330), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 4/112 (3%)

Query: 49  LMPEELQQH-LQLIGEG-DGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVV 106
           ++PE LQ+  LQ + +G   G PD +  +LPR+ KK+L   DNC+IC   YLEDEYPLVV
Sbjct: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60

Query: 107 ELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK--PEIDGSAAELEEDWG 156
           ELP+C H FDL+C+SVWLSRSTTCP+CR +V+  +   EID + AELEEDWG
Sbjct: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWG 112

>Scas_560.6*
          Length = 118

 Score =  117 bits (292), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 76/117 (64%), Gaps = 4/117 (3%)

Query: 42  LLNVIVRLMPEELQQHL--QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLE 99
           +L ++ +++PE LQ+    Q+  +      + ++ +LPRV  K   + D C ICCC + E
Sbjct: 1   MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKH--KNDECPICCCKFSE 58

Query: 100 DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWG 156
           D+YPL+VELP C H FDL+C+SVWLS+S TCP+CR +VL  K  ID S  E EE WG
Sbjct: 59  DKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWG 115

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score =  114 bits (285), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%)

Query: 67  GVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSR 126
           G+ + Y+D+LPRVP  +L   D CAIC C +L+D YPLV ++P C H FDL+C+S+WL  
Sbjct: 48  GMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQN 107

Query: 127 STTCPMCRSDVLVRKPEIDGSAAELEEDWG 156
           + TCPMCR D+  +K EID S  ELEED+ 
Sbjct: 108 NHTCPMCRDDLRSKKVEIDTSQCELEEDFN 137

>Scas_625.11
          Length = 274

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 72  YMDTLPRVPKKRLAEG-DNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTC 130
           +++ LPR     L+   D C IC   Y +D    +  LPNC H F  +C+ +WL +++ C
Sbjct: 191 FIEQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLPNCSHHFHFECIKLWLQKNSLC 250

Query: 131 PMCRSDVLVRKPE 143
           P+CR +V+  K E
Sbjct: 251 PLCRDNVMECKAE 263

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 9/66 (13%)

Query: 72   YMDTLPRVPKKRLAEGDN--CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT 129
            Y+DTL ++ K  +A G+N  CA+C      D Y     +  CGH F   CV+ W  ++T+
Sbjct: 1189 YLDTLGQL-KTAIANGENISCAVC----YSDIY--TGSILKCGHFFCKDCVTHWFKKNTS 1241

Query: 130  CPMCRS 135
            CPMC++
Sbjct: 1242 CPMCKN 1247

>Scas_644.6
          Length = 510

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 76  LPRVPKKRLAEGDN-CAICCCGYLEDEYPL--VVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           LP +  + L + DN C +C    L +E+       LP CGH   L C+  W+ RS TCP+
Sbjct: 338 LPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPI 396

Query: 133 CRSDVL 138
           CR  V 
Sbjct: 397 CRLPVF 402

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 9/65 (13%)

Query: 88  DNCAICCCGYLEDEYP--------LVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLV 139
           DN  I C   L  E P           +LP CGH   L C+  W+ RS TCP+CR  V  
Sbjct: 347 DNVCIVCMDELVSENPHHHQSDGKKPKKLP-CGHVLHLSCLKNWMERSQTCPICRLPVFD 405

Query: 140 RKPEI 144
              EI
Sbjct: 406 ENGEI 410

>Kwal_56.22522
          Length = 513

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 74  DTLPRVPKKRLAEGDN--CAICCCGYLE-DEYPLVVELPN---CGHTFDLQCVSVWLSRS 127
           + LP V + +LA  D+  C +C    L   E     + P    C H   L C+  W+ RS
Sbjct: 298 EKLPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERS 357

Query: 128 TTCPMCRSDVLVRKPEI 144
            TCP+CR  V  +K  +
Sbjct: 358 QTCPICRVPVFDKKGNV 374

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 74  DTLPRVPKKRLAEGDNCAICCCGYLEDEYPLV--------VELPNCGHTFDLQCVSVWLS 125
           + L  V +++L + D+  I C   ++D  P           ++  CGH     C+  W+ 
Sbjct: 303 EKLSDVSEEQLDDTDSMCIIC---MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWME 359

Query: 126 RSTTCPMCRSDVL 138
           RS TCP+CR  V 
Sbjct: 360 RSQTCPICRLSVF 372

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 74  DTLPRVPKKRL---AEGDNCAICCCGYL---------EDEYPLVVELPNCGHTFDLQCVS 121
           DTL  V  ++L   A  DN  I C   L         +++      LP CGH   L C+ 
Sbjct: 329 DTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLP-CGHILHLSCLK 387

Query: 122 VWLSRSTTCPMCRSDVLVRKPEI 144
            W+ RS TCP+CR  V   K  +
Sbjct: 388 NWMERSQTCPICRLPVFDEKGNV 410

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 29/61 (47%), Gaps = 14/61 (22%)

Query: 86  EGDNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMC 133
           E D C IC          C Y  DE PLVV    C H F + C+  WL  +T+   CPMC
Sbjct: 32  EEDVCGICRVSYNGTCPSCKYPGDECPLVV--GECNHNFHVHCIVQWLDTATSRGLCPMC 89

Query: 134 R 134
           R
Sbjct: 90  R 90

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 20/85 (23%)

Query: 68  VPDGYMDTLPRVPKKRLAE---GDNCAICCCGYLEDEYPLVVE--------------LPN 110
           +PDGY    P VP+  L E    +NC +C    ++   P+ VE              +  
Sbjct: 671 IPDGYHYHRP-VPQSILMEYGSQNNCFVCPICMVD--VPVYVEETEETHKIDAQSYMITP 727

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRS 135
           C H F  +C+  W+S    CP+CR+
Sbjct: 728 CSHIFHTECLENWMSYKLQCPVCRA 752

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 12/58 (20%)

Query: 85  AEGDNCAICCCGYLEDEYPL--------VVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
            E D C +C    +ED  P          V++  C H   L C+  W++RS TCP+CR
Sbjct: 348 GEIDICIVC----MEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICR 401

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 19/61 (31%)

Query: 89  NCAICCCGYLEDEYPLVVE-LPN-------------CGHTFDLQCVSVWLSRSTTCPMCR 134
           +CAIC       E+P+ VE LP              C H F   C+  W+S    CP+CR
Sbjct: 697 DCAICMA-----EFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCR 751

Query: 135 S 135
           S
Sbjct: 752 S 752

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRS 135
           CGH F  QC+  W+S    CP+CR+
Sbjct: 722 CGHIFHTQCLESWMSYKLQCPVCRA 746

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 89   NCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDV 137
            +CA+C           V  +  CGH F   C+  WL    TCP+C+++V
Sbjct: 1164 SCAVCF------NEIFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1206

>Scas_665.1
          Length = 392

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 83  RLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST----TCPMCRSDV 137
           +L E   C IC       EY  V  + +CGH +   C+  W+S ++     CP CRSD+
Sbjct: 23  KLLESAICTICS------EYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDI 75

>Kwal_56.23112
          Length = 135

 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 14/72 (19%)

Query: 82  KRLAEGDNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT--- 129
           K + + D C IC          C +  D  PLV+    C H F + C+  WL  +T    
Sbjct: 26  KEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVI--GECNHNFHVHCIQQWLETATAKGL 83

Query: 130 CPMCRSDVLVRK 141
           CPMCR    +++
Sbjct: 84  CPMCRQQFSLKR 95

>Scas_573.9
          Length = 1502

 Score = 38.9 bits (89), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 111  CGHTFDLQCVSVWLSRSTTCPMCR-----SDVL---VRKPEIDGSAAELEED 154
            CGH F  +C++ WL     CPMC+     S++     ++ +++G  +++ ED
Sbjct: 1206 CGHFFCKRCITSWLKNKKNCPMCKMVTTASEIYNFKFKEEKLEGDTSQMNED 1257

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 38.1 bits (87), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 110  NCGHTFDLQCVSVWLSRSTTCPMCR 134
            NCGH F   C+  WL    TCP+C+
Sbjct: 1178 NCGHLFCTSCIFSWLKNRKTCPLCK 1202

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 59   QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAIC--CCGYLEDEYPLVVELPNCGHTFD 116
            ++I   +G V D  ++ L +  K + +  + CAIC      ++ + P  V  P C + F 
Sbjct: 1434 RIISNMNGSVVDS-LELLSKNVKLQFSGFEECAICYYVLHAIDRKLPTKV-CPTCNNRFH 1491

Query: 117  LQCVSVWLSRS--TTCPMCRSDVLVRK 141
              C+  W   S   TCP+CR +  +RK
Sbjct: 1492 GACLYKWFKSSGNNTCPLCRGEFNLRK 1518

>Kwal_56.23900
          Length = 589

 Score = 37.4 bits (85), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 106 VELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVL 138
           V+LP C H F  +C+  W +   TCP+CR++++
Sbjct: 223 VQLP-CSHVFGRECIRQWTNLHNTCPICRANIV 254

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
           anaphase-promoting complex (APC), has ubiquitin ligase
           activity and is required for the metaphase-anaphase
           transition [498 bp, 165 aa]
          Length = 165

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query: 88  DNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRS 135
           D C IC          C +  D+ PLV+ L  C H F   C+  WL   T+   CPMCR 
Sbjct: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96

Query: 136 DVLVRK 141
              ++K
Sbjct: 97  TFQLQK 102

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 88  DNCAICCCGYLED----EYP---LVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDV 137
           D C IC   Y        YP     + L  CGH F + C+S W+   T+   CPMCR   
Sbjct: 35  DVCGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKF 94

Query: 138 -LVRKPEID 145
            L+++ +I+
Sbjct: 95  QLLQRTKIN 103

>Kwal_14.1287
          Length = 1518

 Score = 37.4 bits (85), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 72   YMDTLPRVPKKRLAEGD-NCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTC 130
            Y++TL R+ +    E   +C IC    L + Y  +  +  CGH F   C+  WL   ++C
Sbjct: 1170 YLETLLRLKENLNGEHKFSCTIC----LGEIY--MGSVIKCGHFFCQDCICSWLKNHSSC 1223

Query: 131  PMCR 134
            P+C+
Sbjct: 1224 PLCK 1227

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 37.0 bits (84), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVL 138
           CGH F  +C+  W +   +CP+CR+ +L
Sbjct: 219 CGHVFGRECLYKWTTEHNSCPICRAPIL 246

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 37.0 bits (84), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK 141
           CGH F   C+  W     +CP+CR++++ R+
Sbjct: 141 CGHRFGRMCIYQWTKEHNSCPICRAEIVGRE 171

>Kwal_26.8099
          Length = 750

 Score = 36.6 bits (83), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRS 135
           C H F  QC+  W+S    CP+CR+
Sbjct: 721 CSHIFHTQCLESWMSYKLQCPVCRA 745

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 36.6 bits (83), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 82  KRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT----CPMCRSDV 137
           ++L E   C IC       +Y  V  +  CGH +   C+S WL+ +++    CP CRS +
Sbjct: 30  RKLLETTICTIC------HDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSI 83

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 36.6 bits (83), Expect = 0.006,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 14/104 (13%)

Query: 54  LQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLV-VELPNCG 112
           L +  Q  G    G+PD   D   + P     +   C+IC C   E   PL  V    CG
Sbjct: 796 LGEDSQSPGSSSEGMPDFIEDFKTKYPNSDALKDLECSICTC---EAISPLTSVVFTRCG 852

Query: 113 HTFDLQCVSVWLS------RSTTCPMCRSDV----LVRKPEIDG 146
           H F   C+  ++         T CP CR+ V    L++  +I+G
Sbjct: 853 HPFCESCLLEYIQFQNKKGSETICPNCRAAVESRYLLKLEDING 896

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 10/54 (18%)

Query: 90  CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST----TCPMCRSDVLV 139
           C+IC       +Y  V  +  CGH +   C++ W + +T     CP CRSD+  
Sbjct: 30  CSICH------DYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDITT 77

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 95  CGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVR 140
           C Y     P+V+ L  C H F + C+  WLS  T+   CP+CR    +R
Sbjct: 73  CDYPGSGCPIVLGL--CNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLR 119

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
           (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 5/42 (11%)

Query: 103 PLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVRK 141
           PL+V   +C H F + C+  WL+ ST+   CPMCR    +R+
Sbjct: 60  PLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRE 99

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 104 LVVELPNCGHTFDLQCVSVWLSRST----TCPMCRSDVLV 139
           LV  + +CGH +   C+S WL+ +     TCP CR+ V V
Sbjct: 2   LVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSV 41

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 36.2 bits (82), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 89   NCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRS 135
            NC IC C   +        +   GH +  +C+S WL    +CP+C++
Sbjct: 1218 NCTICLCDICDGA------IIGRGHFYCQECISSWLETKQSCPLCKT 1258

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 36.2 bits (82), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 65   DGGVPDGYMDTLPRVPKKRLAEGDNCAIC--CCGYLEDEYPLVVELPNCGHTFDLQCVSV 122
            +G V D  ++   +  + + A+ + CAIC      ++ + P  V  P C + F   C+  
Sbjct: 1468 NGSVVDS-LELFTKNVRLQFADFEECAICYSILHVVDRKLPSKV-CPTCSNRFHGACLYK 1525

Query: 123  WLSRS--TTCPMCRSDVLVRK 141
            W   S   TCP+CR ++  R+
Sbjct: 1526 WFKSSGNNTCPLCRGEIPFRR 1546

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 35.8 bits (81), Expect = 0.010,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 106 VELPNCGHTFDLQCVSVWLSRSTTCPMCRSDV 137
           ++LP CGH F  +C+  W     +CP+CR  +
Sbjct: 253 IKLP-CGHIFGRECIYKWSRLENSCPLCRQKI 283

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 35.8 bits (81), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 94  CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVL 138
           C   ++ E   +V +P C HTF  QC++ W  +++ CP+CR   L
Sbjct: 243 CLERMDSETTGLVTIP-CQHTFHCQCLNKW--KNSRCPVCRHSSL 284

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 12/77 (15%)

Query: 88  DNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWL---SRSTTCPMCRSDVLV----- 139
           D C+IC     E     V  L  CGH + L C+  W    S + +CP+CR++  V     
Sbjct: 16  DECSIC----WESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDTD 71

Query: 140 RKPEIDGSAAELEEDWG 156
            + +ID S  +L + +G
Sbjct: 72  HEVKIDLSVGQLLDFYG 88

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 35.4 bits (80), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 26/89 (29%)

Query: 68  VPDGYMDTLPRVPKKRLAEGD--------NCAICCCGYLEDEYPLVVELPN--------- 110
           +PDGY    P +  + ++E          +CAIC    + D    + E+P          
Sbjct: 670 IPDGYSYFKP-LSNEYISEHGGGTAEHTVDCAIC----MSDVPIYIEEIPETHKVDQHSY 724

Query: 111 ----CGHTFDLQCVSVWLSRSTTCPMCRS 135
               C H F   C+  W++    CP+CRS
Sbjct: 725 MVTPCNHVFHTSCLENWMNYKLQCPVCRS 753

>Kwal_27.12327
          Length = 1574

 Score = 35.4 bits (80), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 8/82 (9%)

Query: 67   GVPDGYMDTLPRVPKK---RLAEGDNCAIC--CCGYLEDEYPLVVELPNCGHTFDLQCVS 121
            G+    MD+L    K      +  + CAIC      ++ + P  V  P C + F   C+ 
Sbjct: 1494 GMNGSVMDSLELFTKNVNLHFSGFEECAICYSILHAVDRKLPSKV-CPTCNNRFHGACLY 1552

Query: 122  VWLSRS--TTCPMCRSDVLVRK 141
             W   S   TCP+CRS++  R+
Sbjct: 1553 KWFRSSGNNTCPLCRSEIPFRR 1574

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 33.9 bits (76), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 12/57 (21%)

Query: 88  DNCAICCCGYLE------------DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           DNCAIC    +E             E+  V     C H F L C++ W+     CP+
Sbjct: 42  DNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>Scas_625.4
          Length = 761

 Score = 34.7 bits (78), Expect = 0.021,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 27/89 (30%)

Query: 68  VPDGYMDTLPRVPKKRLAEGD-------NCAICCCGYLEDEYPLVVE------------- 107
           +P+GY+   P V    LA+ +       +CAIC       E P+ +E             
Sbjct: 674 IPEGYIYFKP-VSLAHLAKHEGASKHTADCAICM-----SEVPVYIEEAEETHNIDQHSY 727

Query: 108 -LPNCGHTFDLQCVSVWLSRSTTCPMCRS 135
            +  C H F   C+  W+     CP+CR+
Sbjct: 728 MVTPCDHIFHTDCLENWMGYKLQCPVCRT 756

>Scas_713.45
          Length = 570

 Score = 34.7 bits (78), Expect = 0.024,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 99  EDEYPLVVELPN---CGHTFDLQCVSVWLSRSTTCPMCR 134
           E+ +P     P    CGH F  +C+  W     TCP+CR
Sbjct: 220 EEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 34.3 bits (77), Expect = 0.026,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 94  CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
           C   ++ E   ++ +P C HTF  QC+  W  +++ CP+CR
Sbjct: 250 CLERMDSETTGLITIP-CQHTFHCQCLDKW--KNSKCPVCR 287

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 34.7 bits (78), Expect = 0.027,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 19/98 (19%)

Query: 49   LMPEELQQHLQLIGEGDGGVPDG----------YMDTLPRVPKKRLAEGD--NCAICCCG 96
            L   +L   ++ I +  GG  D           Y+  L R+ K  L +    +C+IC  G
Sbjct: 1187 LSAPQLSHLIRTINKSLGGTLDAKINNIESRLIYLKNLSRL-KDTLNDNQILSCSICL-G 1244

Query: 97   YLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
             +E     +  +  CGH F   C+  WL   + CP+C+
Sbjct: 1245 EVE-----IGAIIKCGHYFCKSCILTWLRAHSKCPICK 1277

>Scas_705.41
          Length = 428

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 81  KKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVW--LSRSTTCPMCR 134
           K    EGDN    C   L D   L  +L  C H +   C+  W   S ++ CP+CR
Sbjct: 2   KSSALEGDNICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 34.3 bits (77), Expect = 0.034,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 106 VELPNCGHTFDLQCVSVWLSRSTTCPMCRSDV 137
           V++P CGH F   C+  W     +CP+CR  +
Sbjct: 291 VKIP-CGHIFGRSCLYEWTRLENSCPLCRKKI 321

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 33.9 bits (76), Expect = 0.040,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 109  PNCGHTFDLQCVSVWLSRS--TTCPMCRSDVLVRK 141
            P C + F   C+  W   S   TCP+CRS++  R+
Sbjct: 1528 PTCKNKFHGACLYKWFRSSGNNTCPLCRSEIPFRR 1562

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 33.9 bits (76), Expect = 0.044,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 31/84 (36%), Gaps = 15/84 (17%)

Query: 67  GVPDGYMDTLPRVPKKRLAEGDNCAICC-CGYLEDEYPLVVE-LPN-------------C 111
            +P+GY    P      L  G N   C  C     E  + VE +P              C
Sbjct: 665 AIPEGYSYHKPLNSTCLLEHGANDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPC 724

Query: 112 GHTFDLQCVSVWLSRSTTCPMCRS 135
            H F   C+  W+S    CP+CR+
Sbjct: 725 SHLFHTGCLENWMSYKLQCPVCRA 748

>Scas_719.51
          Length = 647

 Score = 33.9 bits (76), Expect = 0.046,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 50/128 (39%), Gaps = 29/128 (22%)

Query: 33  QEADAHSTALLNVIVRLMPEELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAI 92
           Q A  H  + +N   +L   +   + +   + +  VP+       ++ +  + +G NC I
Sbjct: 126 QHAHLHGDSFINANYKLFVNDRADYREQSNDPNKLVPE------EKIIRVVVPKGQNCPI 179

Query: 93  CCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT----------------CPMCRSD 136
           C       E P+   +  CGH F + C+  + S   T                CP+C S 
Sbjct: 180 CL-----SEEPIAPRMITCGHIFCMSCLINFFSIEETIKNPETGYVKKKKYKECPLCGS- 233

Query: 137 VLVRKPEI 144
            +VR+  +
Sbjct: 234 -IVRRERV 240

>Scas_696.17
          Length = 1564

 Score = 32.7 bits (73), Expect = 0.10,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%)

Query: 88   DNCAIC-CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRS--TTCPMCRSDV 137
            + CAIC    +  D        P C + F   C+  W   S   TCP+CRS++
Sbjct: 1508 EECAICYSILHAVDRKLPTKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1560

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 32.7 bits (73), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 12/58 (20%)

Query: 90  CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST-----TCPMCRSDVLVRKP 142
           C+IC       +Y  V     CGH++   C+  W S  T     +CP CR+ ++ R P
Sbjct: 30  CSIC------HDYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECRA-IVNRIP 80

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 32.3 bits (72), Expect = 0.13,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 46/116 (39%), Gaps = 27/116 (23%)

Query: 38  HSTALLNVIVRLMPEELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGY 97
           H  + +NV  RL+  +   +     E D   P+ ++D   ++ +  +  G NC IC    
Sbjct: 106 HGESFINVNYRLLVSDRYDYKD--QEND---PNKFVDK-EKIVRVIVPRGQNCPICL--- 156

Query: 98  LEDEYPLVVELPNCGHTFDLQCVSVWLS----------------RSTTCPMCRSDV 137
             +E P+   +  CGH F + C+  +                  +   CP+C S V
Sbjct: 157 --NEIPVAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLCGSIV 210

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDV 137
           CGH+F   C+  +L + + CP+C SD+
Sbjct: 47  CGHSFCSICIRKYLQKESKCPLCLSDL 73

>Kwal_27.10419
          Length = 300

 Score = 32.0 bits (71), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 5/48 (10%)

Query: 108 LPNCGHTFDLQCVSVWLSRST----TCPMCRSDVLVRKPEIDGSAAEL 151
           +  CGH +   C+S WL  +     TCP CRS  L  +P ++ +   L
Sbjct: 6   MTTCGHNYCYDCISNWLVSNNANELTCPQCRS-PLKEQPSLNSALQNL 52

>Kwal_26.8030
          Length = 660

 Score = 32.0 bits (71), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 1/69 (1%)

Query: 85  AEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEI 144
           A   +C IC         P+V   P CGH     C   +   S  CP C+  VL  + + 
Sbjct: 381 ATMSSCPICGDFMFTSVKPVVYMSP-CGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEAQF 439

Query: 145 DGSAAELEE 153
                E+EE
Sbjct: 440 RVLDKEIEE 448

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 32.0 bits (71), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 108 LPNCGHTFDLQCVSVWLSRSTTCPMCRSDV 137
           L  CGHTF   C+  +L++ + CP+C +++
Sbjct: 44  LTQCGHTFCSLCIREYLNKESRCPLCLAEL 73

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 30.8 bits (68), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVL 138
           CGH F   C+  W    + CP+CR   L
Sbjct: 66  CGHIFCWNCIINWCKERSECPLCRQKCL 93

>YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.6916p [2013 bp, 670 aa]
          Length = 670

 Score = 32.0 bits (71), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 26/66 (39%), Gaps = 21/66 (31%)

Query: 86  EGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---------------- 129
           +G NC+IC       E P+   +  CGH F L C+  + S   T                
Sbjct: 191 KGQNCSICL-----SEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKKKKYKE 245

Query: 130 CPMCRS 135
           CP+C S
Sbjct: 246 CPLCGS 251

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 31.6 bits (70), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 94  CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
           C   L+ E   +V  P C HTF  +C+  W  ++  CP+CR
Sbjct: 218 CLEKLDSEVTGLVTTP-CQHTFHCKCLDQW--KNGNCPVCR 255

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 31.2 bits (69), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%)

Query: 108 LPNCGHTFDLQCVSVWLSRSTT--CPMCR 134
           L  CGH F L C+  W   S    CP+CR
Sbjct: 20  LNVCGHKFHLNCIREWHKYSINLKCPICR 48

>Scas_585.5*
          Length = 109

 Score = 30.4 bits (67), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 12/57 (21%)

Query: 88  DNCAICCCGYLE------------DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           DNCAIC    +E             +   V     C H F L C++ W+     CP+
Sbjct: 41  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPL 97

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 30.0 bits (66), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 22/57 (38%), Gaps = 12/57 (21%)

Query: 88  DNCAICCCGYLE------------DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           +NCAIC    +E             E   V     C H F L C++ WL     CP+
Sbjct: 40  ENCAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 31.2 bits (69), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 25/112 (22%)

Query: 42  LLNVIVRLMP---EELQQHLQLIGEGDGGVPDGYMDTLPRVPK------------KRLA- 85
           ++N ++ ++P   E L      +G  +G  P      L  VP+            K LA 
Sbjct: 210 IINKVLSILPQTKETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAF 269

Query: 86  ---EGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
              E  NC +C    +E   P    LP CGH F   C++ W   +  CP+CR
Sbjct: 270 IPTESRNCILCL---MEMTDPSC--LP-CGHVFCWDCITDWTKENPECPLCR 315

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 31.2 bits (69), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 1/56 (1%)

Query: 89  NCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEI 144
           NC IC   Y+      VV +  CGH     C   ++  S  CP C   V+  + E 
Sbjct: 370 NCPICR-EYMFTSTMAVVYMDPCGHAIHQHCFDEYIKHSYKCPNCNVSVINMEREF 424

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 30.8 bits (68), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 10/53 (18%)

Query: 90  CAIC---CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST--TCPMCRSDV 137
           CAIC    CG     Y     L  CGH +   C+  W   +    CPMCR D 
Sbjct: 6   CAICLEDICGKSSTSY-----LKPCGHEYHSDCIRKWHGHAEDLKCPMCRIDA 53

>Kwal_55.22054
          Length = 111

 Score = 30.0 bits (66), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 13/28 (46%)

Query: 105 VVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           V     C H F L C++ WL     CP+
Sbjct: 72  VAAWGTCNHAFHLHCINKWLQTRNACPL 99

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 29.6 bits (65), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 13/28 (46%)

Query: 105 VVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           V     C H F L C++ WL     CP+
Sbjct: 71  VAAWGTCNHAFHLHCINKWLQTRNACPL 98

>Scas_718.77
          Length = 128

 Score = 30.0 bits (66), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 5/51 (9%)

Query: 87  GDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST---TCPMCR 134
           G N     C +     P+VV    C H F + CV  WL+ +     CPMCR
Sbjct: 52  GYNAVCPSCSHPGVTCPVVVG--TCQHAFHVHCVVPWLATAAARGACPMCR 100

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 30.8 bits (68), Expect = 0.48,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 88   DNCAIC-CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRS--TTCPMCRSDVLVRK 141
            + CAIC    +  D          C + F   C+  W   S   TCP+CRS++  R+
Sbjct: 1488 EECAICYSILHAVDRKLPTKTCSTCKNKFHGACLYKWFRSSGNNTCPLCRSEINFRR 1544

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 30.4 bits (67), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 13/24 (54%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCR 134
           CGH F   CV  W +    CP+CR
Sbjct: 281 CGHMFCWACVMQWCNERNECPLCR 304

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 29.6 bits (65), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 12/57 (21%)

Query: 88  DNCAICCCGYLE------------DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPM 132
           DNCAIC    +E             +   V     C H F L C++ W+     CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPL 109

>Scas_615.13
          Length = 330

 Score = 30.0 bits (66), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCRSDVLVRK 141
           CGH F  +C+  W      CP+CR +  +++
Sbjct: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQ 325

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 30.0 bits (66), Expect = 0.83,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 90  CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMC 133
           C IC       ++  V  L  CGHTF   C+   L+    CP+C
Sbjct: 28  CHIC------KDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

>Kwal_55.19999
          Length = 152

 Score = 29.3 bits (64), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 5/43 (11%)

Query: 92  ICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
           I C G++ D          CGH F  +C+  W +    CP+CR
Sbjct: 103 ILCLGFMLDP-----SCAPCGHVFCWKCLLSWCNERPECPLCR 140

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 29.6 bits (65), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 86   EGDN-CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCP 131
            EG N C  C   +L+ +Y + V   NC H   L+C   W + S  CP
Sbjct: 1064 EGLNRCTYC---HLKAQYSIFV-CGNCQHVLHLKCSKEWWNVSKECP 1106

>Kwal_55.21206
          Length = 275

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 25/97 (25%)

Query: 40  TALLNVIVRLMPEELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLE 99
           T  L+V  R+ P +    ++ +G G                         CAIC     E
Sbjct: 89  TLTLDVFHRIFPTQQYSKVESLGPGADS-------------------RTTCAIC----QE 125

Query: 100 DEYPLV-VELPNCGHTFDLQCVSVWLSRSTT-CPMCR 134
           D   L  V L  C H F   C+  W+ R++  CP+C+
Sbjct: 126 DFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162

>Scas_720.89
          Length = 469

 Score = 29.3 bits (64), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 78  RVPKKRLAEGDN---CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
           ++PK  L E D    C IC       ++  V  L  C HTF   C+  +L  ++ CP+C 
Sbjct: 15  KIPK--LQEIDTLLRCHIC------KDFLKVPVLTPCSHTFCSLCIREYLKDNSKCPLCL 66

Query: 135 SDV 137
           +++
Sbjct: 67  NEL 69

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMC 133
           CGHTF   C+  +LS    CP+C
Sbjct: 42  CGHTFCSLCIRGYLSNEPKCPLC 64

>Kwal_27.10723
          Length = 229

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 56/150 (37%), Gaps = 34/150 (22%)

Query: 18  QGTRSELRRQLADMFQE------ADAH-STALLNVIVRLMPEELQQHLQLIGEGDGG--- 67
           Q   SELRR+LAD   E       ++H    L+N      P+     ++++G  +     
Sbjct: 72  QRLESELRRELADNTGENRPLVRTESHVDEVLVNADSERDPDASSDVIEILGGSNSNSDL 131

Query: 68  -----------VPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFD 116
                      + D      PR P+ + A    C IC       E P    +  CGH F 
Sbjct: 132 ENEAKSQQVVEISDDEAVASPR-PQHKRALDYKCPICF------EPPEAALVTPCGHVFC 184

Query: 117 LQCV------SVWLSRSTTCPMCRSDVLVR 140
            +C+      S   SR+  C +CR  V  R
Sbjct: 185 TECLFQMVNSSRGQSRAGHCALCRRGVHFR 214

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 41/118 (34%), Gaps = 20/118 (16%)

Query: 32  FQEADAHSTALLNVIV------RLMPEELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLA 85
           F++  + +  +L  I+      +L+P+  +     IG  DG           +   K L+
Sbjct: 181 FKKKSSQNYKILGFILGMQLASKLLPQIAEYIADRIGTDDGKSHKSLSALAKKHTSKDLS 240

Query: 86  ---------EGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
                    E     + C  Y+ D          CGH F   C+  W      CP+CR
Sbjct: 241 DLEVLPFIKEDSRKCVLCLNYMLDP-----SATPCGHLFCWDCIMEWTLERQECPLCR 293

>Kwal_23.6285
          Length = 458

 Score = 28.5 bits (62), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMC 133
           C HTF   C+  +L+R   CP+C
Sbjct: 52  CAHTFCSLCIREYLNRELRCPLC 74

>Kwal_26.8090
          Length = 520

 Score = 28.5 bits (62), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 77  PRVPKKRLAEGD--NCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCR 134
           P   KK + + +   C +C    L+ E   +  +P C HTF   C++ W      CP+CR
Sbjct: 212 PFTAKKEVQDTELPTCPVCL-ERLDSEVTGLATIP-CQHTFHCVCLNKW--GDNRCPVCR 267

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 12/24 (50%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCR 134
           CGH F   C+  W      CP+CR
Sbjct: 301 CGHLFCWSCLMSWCKERPECPLCR 324

>KLLA0E07568g 685564..686559 weakly similar to sp|Q04370
           Saccharomyces cerevisiae YMR026c PEX12 required for
           biogenesis of peroxisomes - peroxin singleton, start by
           similarity
          Length = 331

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 53/131 (40%), Gaps = 15/131 (11%)

Query: 8   RPRILTLTDDQGTRSELRRQLADMFQEADAHSTALLNVIVRLMPEELQ--QHLQLIGEGD 65
           R   LTL++ +  R+ L R LA      ++ ST  L+   +L P  L   + LQ+I +  
Sbjct: 192 RKNTLTLSERRRKRTNLPRILAMTKDAVESTSTMFLD---KLFPSFLVMIRILQIINQRP 248

Query: 66  GGVPDGYMDTLPRVP-----KKRLAEGDNCAIC-CCGYLEDEYPLVVELPNCGHTFDLQC 119
                      P+ P        +   D   +C  CG    E  ++    + G+  +L+C
Sbjct: 249 ELFKKEIRVKRPKPPVLPGVASEVDNNDTTDVCPLCGEEITEPAMI----SSGYVANLEC 304

Query: 120 VSVWLSRSTTC 130
              W+S   TC
Sbjct: 305 AKKWVSTENTC 315

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 90  CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRST--TCPMCR 134
           C+IC    LE     +  L  C H + L+C+  W + S    CP CR
Sbjct: 6   CSIC----LEALGQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCR 48

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%)

Query: 111 CGHTFDLQCVSVWLSRSTTCPMCR 134
           C HTF  QC+  W  +   CP+CR
Sbjct: 231 CQHTFHCQCLDKW--KDGRCPVCR 252

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 27.7 bits (60), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 25/92 (27%)

Query: 70  DGYMDTLPRVPKK----------RLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQC 119
           +G++ T+  +PKK          R+ +   C IC       +Y  V  + +CGH +  +C
Sbjct: 2   NGHLHTV--IPKKSNADHLRIVGRVLDSTVCTIC------HDYMFVPVMTSCGHNYCYEC 53

Query: 120 VSVWLSRST------TCPMCRSDVLVRKPEID 145
           ++ WL+ +       TCP CR +V+  +P ++
Sbjct: 54  LNNWLNNNRSNVSELTCPQCR-NVITNEPSLN 84

>KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomyces
            cerevisiae YOL138c, hypothetical start
          Length = 1321

 Score = 27.7 bits (60), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 5/50 (10%)

Query: 88   DNCA---ICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWL--SRSTTCPM 132
            D+C+     CC   +    L + + NCGH    +C+  W        CP+
Sbjct: 1265 DSCSKRNTLCCFCNKPMKSLAISMLNCGHEGHFECLKKWFFDENMDVCPL 1314

>YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein
           containing a CCCH-type zinc finger domain, which bind
           DNA or RNA, and a C3HC4 type (RING) zinc finger, which
           may mediate protein-protein interactions, has low
           similarity to uncharacterized zinc finger protein 183
           (human ZNF183) [780 bp, 259 aa]
          Length = 259

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 6/48 (12%)

Query: 90  CAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDV 137
           C +C   Y   + P+V    NCGH F   C +  + + T C +C  + 
Sbjct: 199 CTLCKEDY---KSPVVT---NCGHYFCGSCFAKDMKKGTKCFICHKET 240

>Kwal_34.16121
          Length = 265

 Score = 26.9 bits (58), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 26/117 (22%)

Query: 27  QLADMF----------QEADAHSTALLNVIVRLMPEELQQHLQLIGEGDGGVPDGYMDTL 76
           +LAD+F          Q++D+  T  L+++ R +P        +       +PD   D  
Sbjct: 118 KLADVFSDIVRDSETTQDSDSSPTDELSLLFRALP-------HISANPQCMLPDELNDDD 170

Query: 77  PRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT--CP 131
            ++   ++    +C I C  +   E P++     CGH FD   +  +LS +T+  CP
Sbjct: 171 VQIEGGKIEL--SCPITCRPF---ENPMISR--KCGHVFDKAGIDQYLSNATSRDCP 220

>YER116C (SLX8) [1547] chr5 complement(395344..396168) Subunit of
           Hex3p-Slx8p complex, required for cell growth in the
           absence of SGS1 or TOP3 [825 bp, 274 aa]
          Length = 274

 Score = 26.6 bits (57), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 20/95 (21%)

Query: 53  ELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGD-NCAICCCGYLEDEYPLVVELPNC 111
           E QQ LQ+         D + +     PK+  A  D  C IC       E P    +  C
Sbjct: 175 EEQQVLQISD-------DDFQEETKEAPKEYGAAKDYRCPICF------EPPETALMTLC 221

Query: 112 GHTFDLQCVSVWLSRSTT------CPMCRSDVLVR 140
           GH F   C+   ++ S T      C +CRS V ++
Sbjct: 222 GHVFCCPCLFQMVNSSRTCRQFGHCALCRSKVYLK 256

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,237,222
Number of extensions: 211111
Number of successful extensions: 560
Number of sequences better than 10.0: 105
Number of HSP's gapped: 555
Number of HSP's successfully gapped: 105
Length of query: 156
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 63
Effective length of database: 13,376,635
Effective search space: 842728005
Effective search space used: 842728005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)