Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR033W25324910101e-140
KLLA0C01936g64376626.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR033W
         (249 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR033W [4343] [Homologous to NOHBY] complement(771818..772579) ...   393   e-140
KLLA0C01936g 153971..155902 similar to sp|P53835 Saccharomyces c...    28   6.9  

>AGR033W [4343] [Homologous to NOHBY] complement(771818..772579)
           [762 bp, 253 aa]
          Length = 253

 Score =  393 bits (1010), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 197/249 (79%)

Query: 1   MIEDIKLSVAWATFLSVFQKVARFFRQYHTERLRYNYALDPPQMVYSLVPPHGSRHAPDV 60
           MIEDIKLSVAWATFLSVFQKVARFFRQYHTERLRYNYALDPPQMVYSLVPPHGSRHAPDV
Sbjct: 1   MIEDIKLSVAWATFLSVFQKVARFFRQYHTERLRYNYALDPPQMVYSLVPPHGSRHAPDV 60

Query: 61  HYRAARNSNFMLEALQLFVLSVLVGTMMTLARCMHRAGSVLHRKGFDLPLAALQPRAIGP 120
           HYRAARNSNFMLEALQLFVLSVLVGTMMTLARCMHRAGSVLHRKGFDLPLAALQPRAIGP
Sbjct: 61  HYRAARNSNFMLEALQLFVLSVLVGTMMTLARCMHRAGSVLHRKGFDLPLAALQPRAIGP 120

Query: 121 KXXXXXXXXXXXXXXXXXXXXTPQNTXXXXXXXXXXXCERXXXXXXXXXXXXXXXXXXXX 180
           K                    TPQNT           CER                    
Sbjct: 121 KPPQRSTSRRAAARPDSAPCSTPQNTAASIADPAPAACERAGPAPASARAPAGCARAPAS 180

Query: 181 XNEGLFLSYVDDVDDELSGVENSFAEYYGVSQFAESDIFDLGNLSVRLNSIRSLGINNSP 240
            NEGLFLSYVDDVDDELSGVENSFAEYYGVSQFAESDIFDLGNLSVRLNSIRSLGINNSP
Sbjct: 181 PNEGLFLSYVDDVDDELSGVENSFAEYYGVSQFAESDIFDLGNLSVRLNSIRSLGINNSP 240

Query: 241 TSKAVKASG 249
           TSKAVKASG
Sbjct: 241 TSKAVKASG 249

>KLLA0C01936g 153971..155902 similar to sp|P53835 Saccharomyces
           cerevisiae YNL279w PRM1 singleton, start by similarity
          Length = 643

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 10/76 (13%)

Query: 184 GLFLSYVDDVDDELSG----VENSFAEYYGVSQF-----AESDIFD-LGNLSVRLNSIRS 233
           G   S  D++DD LSG    V    +    +  F      ESDI D +  +++ +N +R+
Sbjct: 144 GTVSSVADEIDDGLSGLTKVVNKVLSAVNDIQNFFKGNDDESDINDQVKKVNLTINGLRT 203

Query: 234 LGINNSPTSKAVKASG 249
           L I +S   K VK S 
Sbjct: 204 LSIPSSIDDKLVKLSA 219

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,002,942
Number of extensions: 202479
Number of successful extensions: 471
Number of sequences better than 10.0: 4
Number of HSP's gapped: 470
Number of HSP's successfully gapped: 5
Length of query: 249
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 150
Effective length of database: 13,168,927
Effective search space: 1975339050
Effective search space used: 1975339050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)