Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR031W1401385282e-70
Sklu_2357.71571312792e-32
Scas_718.44266612821e-31
YDR043C (NRG1)231612792e-31
CAGL0K12078g463612902e-31
Kwal_27.10925264612733e-30
Scas_569.2293602735e-30
KLLA0F18524g357632681e-28
CAGL0L07480g314612537e-27
YBR066C (NRG2)220572425e-26
Kwal_47.19045266561624e-14
CAGL0A01628g424551611e-13
Sklu_2351.6548581592e-13
YGL035C (MIG1)504581592e-13
KLLA0B00605g239571529e-13
KLLA0E10989g474551541e-12
Scas_712.42*290551512e-12
Scas_709.32822581522e-12
CAGL0K09372g396571512e-12
AFR471C389551504e-12
Kwal_14.2278463581496e-12
YGL209W (MIG2)382571479e-12
CAGL0L11880g980501471e-11
Scas_575.3455551452e-11
Kwal_56.23453828641452e-11
YER169W (RPH1)796541424e-11
CAGL0C02519g318571415e-11
KLLA0C17710g821501408e-11
KLLA0F11682g374601409e-11
AGR117C799551409e-11
Scas_681.19864551409e-11
YDR096W (GIS1)894501391e-10
CAGL0H04213g1321591372e-10
Sklu_2398.2288591353e-10
CAGL0M01870g315561301e-09
YER028C394581311e-09
Scas_602.9547561311e-09
Scas_703.231341541312e-09
Scas_687.33288571292e-09
Kwal_14.2206254551264e-09
YML081W1251541274e-09
YKL062W (MSN4)630611275e-09
YMR037C (MSN2)704541267e-09
Scas_649.28730611267e-09
AGL207W277571249e-09
Scas_697.35839571251e-08
Kwal_27.10467302561241e-08
YJR127C (ZMS1)1380541241e-08
YOR113W (AZF1)914541241e-08
KLLA0C17072g474521241e-08
Kwal_47.166211178541241e-08
KLLA0B07909g922551232e-08
Scas_717.18354571232e-08
AER159C1191541232e-08
CAGL0E04884g1489531222e-08
CAGL0F05995g597541213e-08
Kwal_47.17888786511204e-08
Kwal_47.16577881501204e-08
KLLA0F26961g694611205e-08
ACR264W769511195e-08
ABR089C571611196e-08
Scas_717.17d350551196e-08
KLLA0B04477g1332541197e-08
Kwal_26.8351698611188e-08
CAGL0M06831g645681171e-07
Scas_710.9505581161e-07
Kwal_47.17241403561161e-07
CAGL0M13189g541521161e-07
KLLA0F23782g782511152e-07
Scas_718.36d330631152e-07
Kwal_14.2543711591142e-07
CAGL0K02145g317521133e-07
Sklu_2181.1410521133e-07
Scas_656.1*102531083e-07
Sklu_2443.22213541123e-07
KLLA0E08679g596681133e-07
CAGL0M00594g1020541134e-07
CAGL0K04631g1013561125e-07
ACL057W520521125e-07
Scas_683.25879591126e-07
AFR580C838551116e-07
YNL027W (CRZ1)678681116e-07
AEL077W336611108e-07
YER130C443521108e-07
Scas_721.921152531101e-06
CAGL0L03916g642511091e-06
AGR172W1057531091e-06
KLLA0F13046g1379531091e-06
Scas_711.56832541082e-06
Scas_713.52620571072e-06
YDR216W (ADR1)1323531055e-06
CAGL0H07557g476571045e-06
YPL230W391441045e-06
KLLA0F01463g781561046e-06
ADL040W330541021e-05
KLLA0F20636g285551011e-05
ADL042W281571011e-05
YJL056C (ZAP1)880591011e-05
Kwal_27.11460531621011e-05
Sklu_2244.3271531002e-05
YGR067C794551002e-05
ADR308C27855992e-05
CAGL0G08107g625501002e-05
Kwal_26.801119054982e-05
Scas_719.681350591002e-05
KLLA0A04609g42355992e-05
Scas_720.3331660983e-05
Scas_695.257165993e-05
CAGL0J05060g71357993e-05
Sklu_2389.276759983e-05
YMR182C (RGM1)21144973e-05
YPR015C24762974e-05
CAGL0L06072g30052966e-05
Scas_717.1752551966e-05
AFL136W40944958e-05
KLLA0C16005g33147959e-05
YPR013C31760931e-04
AEL174W66154932e-04
CAGL0E06116g61347922e-04
Scas_693.3163556913e-04
Scas_707.4633861903e-04
ADL198W54767904e-04
Sklu_2289.129160904e-04
KLLA0D16456g85453905e-04
YMR070W (MOT3)49057895e-04
Scas_707.3128959887e-04
KLLA0B03454g47247888e-04
CAGL0J01595g34460878e-04
Scas_602.426661860.001
CAGL0M04323g70360870.001
CAGL0E01331g68952860.001
Sklu_2436.951770860.002
CAGL0K03003g64751860.002
CAGL0G10021g39446850.002
YDR146C (SWI5)70951830.003
YLR131C (ACE2)77052830.003
CAGL0K02343g116259830.004
KLLA0A10373g20663810.005
AGR186C28757810.005
CAGL0L00583g38841810.006
CAGL0L05786g34861810.006
Scas_378.120856790.008
ADL051W17351790.009
Scas_602.4d25654790.010
Kwal_26.802150757790.011
Scas_712.232761780.012
Scas_627.6120756790.014
AEL278W47657770.019
YDR253C (MET32)19157760.019
Sklu_2359.572254770.019
Kwal_56.2392574554750.036
CAGL0E04312g68871750.036
Sklu_1527.120554740.036
Scas_717.60d16748730.043
AGL197W84444750.044
YGL254W (FZF1)29937730.055
ADL050W14651720.064
YPL038W (MET31)17750710.080
Scas_641.2453264720.092
Kwal_34.1594627959720.093
AGL246W22750710.095
AGL071C39651720.10
YDR463W (STP1)51964720.11
Scas_604.458563720.11
KLLA0F10109g62370720.11
YPR022C113356720.11
Kwal_26.930030460710.11
YHR006W (STP2)54165700.16
Sklu_2126.544849700.17
Kwal_27.1016728549690.20
Kwal_47.1833753668690.21
CAGL0B02651g18953680.21
Kwal_27.1182419954680.28
Sklu_2154.319059680.28
Scas_660.1236766680.29
CAGL0I02838g65536680.29
CAGL0E03762g58463670.44
YPR186C (PZF1)42946660.52
Scas_568.519954650.56
CAGL0I02816g29152660.58
KLLA0E18645g43156650.85
CAGL0L12562g22349631.1
AFR531W27459631.2
AFR190C43253631.4
AFR461C54468621.9
Scas_683.3047858622.2
Kwal_55.2063441968603.2
Kwal_23.540042946603.3
KLLA0D11902g28950603.4
YHL027W (RIM101)62568594.9
Scas_670.243559595.4
CAGL0K04697g51560586.0
KLLA0F07073g55827586.9
KLLA0A02629g55941587.3
Sklu_2206.235825577.8
KLLA0F06875g14128568.8
AFR588W31929578.9
KLLA0F22319g20347569.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR031W
         (138 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   207   2e-70
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       112   2e-32
Scas_718.44                                                           113   1e-31
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   112   2e-31
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   116   2e-31
Kwal_27.10925                                                         109   3e-30
Scas_569.2                                                            109   5e-30
KLLA0F18524g complement(1701498..1702571) some similarities with...   107   1e-28
CAGL0L07480g complement(822240..823184) some similarities with s...   102   7e-27
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    98   5e-26
Kwal_47.19045                                                          67   4e-14
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    67   1e-13
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       66   2e-13
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    66   2e-13
KLLA0B00605g complement(46736..47455) some similarities with sp|...    63   9e-13
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    64   1e-12
Scas_712.42*                                                           63   2e-12
Scas_709.32                                                            63   2e-12
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    63   2e-12
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    62   4e-12
Kwal_14.2278                                                           62   6e-12
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    61   9e-12
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    61   1e-11
Scas_575.3                                                             60   2e-11
Kwal_56.23453                                                          60   2e-11
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    59   4e-11
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    59   5e-11
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    59   8e-11
KLLA0F11682g complement(1068992..1070116) some similarities with...    59   9e-11
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    59   9e-11
Scas_681.19                                                            59   9e-11
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    58   1e-10
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    57   2e-10
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                57   3e-10
CAGL0M01870g complement(219813..220760) some similarities with t...    55   1e-09
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    55   1e-09
Scas_602.9                                                             55   1e-09
Scas_703.23                                                            55   2e-09
Scas_687.33                                                            54   2e-09
Kwal_14.2206                                                           53   4e-09
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    54   4e-09
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    54   5e-09
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    53   7e-09
Scas_649.28                                                            53   7e-09
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    52   9e-09
Scas_697.35                                                            53   1e-08
Kwal_27.10467                                                          52   1e-08
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    52   1e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    52   1e-08
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    52   1e-08
Kwal_47.16621                                                          52   1e-08
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   2e-08
Scas_717.18                                                            52   2e-08
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    52   2e-08
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    52   2e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    51   3e-08
Kwal_47.17888                                                          51   4e-08
Kwal_47.16577                                                          51   4e-08
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    51   5e-08
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    50   5e-08
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    50   6e-08
Scas_717.17d                                                           50   6e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    50   7e-08
Kwal_26.8351                                                           50   8e-08
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    50   1e-07
Scas_710.9                                                             49   1e-07
Kwal_47.17241                                                          49   1e-07
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    49   1e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    49   2e-07
Scas_718.36d                                                           49   2e-07
Kwal_14.2543                                                           49   2e-07
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    48   3e-07
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            48   3e-07
Scas_656.1*                                                            46   3e-07
Sklu_2443.22 , Contig c2443 45390-46027                                48   3e-07
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    48   3e-07
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    48   4e-07
CAGL0K04631g complement(440721..443762) some similarities with s...    48   5e-07
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    48   5e-07
Scas_683.25                                                            48   6e-07
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    47   6e-07
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    47   6e-07
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    47   8e-07
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    47   8e-07
Scas_721.92                                                            47   1e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   1e-06
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    47   1e-06
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    47   1e-06
Scas_711.56                                                            46   2e-06
Scas_713.52                                                            46   2e-06
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    45   5e-06
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    45   5e-06
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    45   5e-06
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    45   6e-06
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    44   1e-05
KLLA0F20636g complement(1914452..1915309) some similarities with...    44   1e-05
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    44   1e-05
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    44   1e-05
Kwal_27.11460                                                          44   1e-05
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                43   2e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    43   2e-05
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    43   2e-05
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    43   2e-05
Kwal_26.8011                                                           42   2e-05
Scas_719.68                                                            43   2e-05
KLLA0A04609g complement(411494..412765) some similarities with s...    43   2e-05
Scas_720.33                                                            42   3e-05
Scas_695.2                                                             43   3e-05
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    43   3e-05
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            42   3e-05
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    42   3e-05
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    42   4e-05
CAGL0L06072g complement(679924..680826) some similarities with s...    42   6e-05
Scas_717.17                                                            42   6e-05
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    41   8e-05
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    41   9e-05
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    40   1e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    40   2e-04
CAGL0E06116g complement(604708..606549) some similarities with t...    40   2e-04
Scas_693.31                                                            40   3e-04
Scas_707.46                                                            39   3e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    39   4e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          39   4e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    39   5e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    39   5e-04
Scas_707.31                                                            39   7e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    39   8e-04
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    38   8e-04
Scas_602.4                                                             38   0.001
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    38   0.001
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    38   0.001
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          38   0.002
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    38   0.002
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    37   0.002
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    37   0.003
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    37   0.003
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    37   0.004
KLLA0A10373g complement(907244..907864) some similarities with c...    36   0.005
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    36   0.005
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    36   0.006
CAGL0L05786g complement(636176..637222) some similarities with t...    36   0.006
Scas_378.1                                                             35   0.008
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    35   0.009
Scas_602.4d                                                            35   0.010
Kwal_26.8021                                                           35   0.011
Scas_712.2                                                             35   0.012
Scas_627.6                                                             35   0.014
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    34   0.019
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    34   0.019
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          34   0.019
Kwal_56.23925                                                          33   0.036
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    33   0.036
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             33   0.036
Scas_717.60d                                                           33   0.043
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    33   0.044
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    33   0.055
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    32   0.064
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    32   0.080
Scas_641.24                                                            32   0.092
Kwal_34.15946                                                          32   0.093
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    32   0.095
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    32   0.10 
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    32   0.11 
Scas_604.4                                                             32   0.11 
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    32   0.11 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    32   0.11 
Kwal_26.9300                                                           32   0.11 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    32   0.16 
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            32   0.17 
Kwal_27.10167                                                          31   0.20 
Kwal_47.18337                                                          31   0.21 
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    31   0.21 
Kwal_27.11824                                                          31   0.28 
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                31   0.28 
Scas_660.12                                                            31   0.29 
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    31   0.29 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    30   0.44 
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    30   0.52 
Scas_568.5                                                             30   0.56 
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    30   0.58 
KLLA0E18645g complement(1648263..1649558) some similarities with...    30   0.85 
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    29   1.1  
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    29   1.2  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    29   1.4  
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    28   1.9  
Scas_683.30                                                            28   2.2  
Kwal_55.20634                                                          28   3.2  
Kwal_23.5400                                                           28   3.3  
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    28   3.4  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    27   4.9  
Scas_670.2                                                             27   5.4  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    27   6.0  
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    27   6.9  
KLLA0A02629g complement(233822..235501) some similarities with s...    27   7.3  
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            27   7.8  
KLLA0F06875g complement(658475..658900) gi|24943209|gb|AAN65373....    26   8.8  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    27   8.9  
KLLA0F22319g complement(2086613..2087224) some similarities with...    26   9.0  

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 106/138 (76%)

Query: 1   MDNARQAGAHQSIXXXXXXXXXXXXXXXXXLPPLASSHQSMRRLETYLKQALDRGAFGCX 60
           MDNARQAGAHQSI                 LPPLASSHQSMRRLETYLKQALDRGAFGC 
Sbjct: 1   MDNARQAGAHQSIVLAAVAPPGAAGGRRVLLPPLASSHQSMRRLETYLKQALDRGAFGCA 60

Query: 61  XXXXXXXXXXXXXXEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFS 120
                         EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFS
Sbjct: 61  AAPARKRAPAPVPVEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFS 120

Query: 121 RHDNCLQHYRTHLKRTAV 138
           RHDNCLQHYRTHLKRTAV
Sbjct: 121 RHDNCLQHYRTHLKRTAV 138

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  112 bits (279), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 72/131 (54%), Gaps = 28/131 (21%)

Query: 31  LPPLASSHQSMRRLETYLKQALDRGAFGCXXXXXXXX----------------------- 67
           LPPL  S  + + +E  LK+ LDR AF                                 
Sbjct: 25  LPPLVYSGAN-QNIEAQLKKILDRTAFTTAALPPKPEIRPAVTVCAHQLPLSKPKKVSKK 83

Query: 68  ----XXXXXXXEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHD 123
                      E+RR+++C+ C +GFTTSGHLARHNRIHTGEKNH C F GCGQRFSRHD
Sbjct: 84  VSKPATANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHD 143

Query: 124 NCLQHYRTHLK 134
           NC+QHYRTHLK
Sbjct: 144 NCVQHYRTHLK 154

>Scas_718.44
          Length = 266

 Score =  113 bits (282), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (88%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           + RRKH+C+ C  GFTTSGHL+RHNRIHTGEKNH+C F GC Q+FSRHDNCLQHYRTHLK
Sbjct: 205 QNRRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

Query: 135 R 135
           +
Sbjct: 265 K 265

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  112 bits (279), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 55/61 (90%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           E+RRK++C+ C +GFTTSGHLARHNRIHTGEKNH C + GC QRFSRHDNCLQHYRTHLK
Sbjct: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228

Query: 135 R 135
           +
Sbjct: 229 K 229

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  116 bits (290), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/61 (81%), Positives = 55/61 (90%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           E RRK+LC+ CGKGFTTSGHLARHNRIHTGEK H C + GCGQRF+RHDNCLQHY+THLK
Sbjct: 397 ELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

Query: 135 R 135
           R
Sbjct: 457 R 457

>Kwal_27.10925
          Length = 264

 Score =  109 bits (273), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           E+RR+++C+ C KGFTTSGHLARHNRIHTGEKNH C   GCGQRFSRHDNC+QHY+THL+
Sbjct: 196 EQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLR 255

Query: 135 R 135
           R
Sbjct: 256 R 256

>Scas_569.2
          Length = 293

 Score =  109 bits (273), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 46/60 (76%), Positives = 52/60 (86%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           EKRRK++C+ C KGFTTSGHLARHNRIHTGEK H C +PGC  +FSRHDNC+QHYRTH K
Sbjct: 223 EKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score =  107 bits (268), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (82%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           +RRK++C+ C +GFTTSGHLARHNRIHTGEK H C FPGC QRFSRHDN +QHYRTH K 
Sbjct: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339

Query: 136 TAV 138
             +
Sbjct: 340 NPM 342

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score =  102 bits (253), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (81%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           E+RRKH+CQ C  GFTTSGHL+RH +IHTGEK+H C   GC Q FSRHDNCLQHYRTH K
Sbjct: 247 EQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSK 306

Query: 135 R 135
           +
Sbjct: 307 K 307

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 97.8 bits (242), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +R +H C+ C  GFTTSGHL+RHNRIHTGEKNH C   GCGQRFSRHDNC QHYRTH
Sbjct: 149 QRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

>Kwal_47.19045
          Length = 266

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 36/56 (64%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           R   C  CGKGF    H  RH R HTGEK H+C+FPGC +RFSR D   +H RTH+
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 66.6 bits (161), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 34/55 (61%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           R H+C  CG+ F    H  RH R HTGEK HAC FPGC +RFSR D   +H R H
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +  R ++C  C + F    H  RH R HTGEK HAC FPGCG+RFSR D   +H R H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 2/29 (6%)

Query: 77  RRKHLCQ--TCGKGFTTSGHLARHNRIHT 103
            + H C+   CGK F+ S  L RH RIHT
Sbjct: 59  EKPHACEFPGCGKRFSRSDELTRHTRIHT 87

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (58%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           E  R H C  C + F    H  RH RIHTGEK HAC FPGC +RFSR D   +H R H
Sbjct: 33  EAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 63.2 bits (152), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 35/57 (61%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           R +LC+ CG  F    H  RH R HTGEK  AC  PGC +RFSR+D   +H +TH K
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFK 66

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 34/55 (61%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           R ++C  C +GF    H  RH R HTGE+ HAC FPGC +RFSR D   +H R H
Sbjct: 24  RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>Scas_712.42*
          Length = 290

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 34/55 (61%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           R   C+TC +GF    H  RH R HTGEK H C FPGCG+ FSR D   +H RTH
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

 Score = 27.7 bits (60), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%)

Query: 85  CGKGFTTSGHLARHNRIHT 103
           CGKGF+ S  L RH R HT
Sbjct: 53  CGKGFSRSDELKRHLRTHT 71

>Scas_709.32
          Length = 822

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/58 (51%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAV 138
           C+TCGK F  S HL RH R +H+ E+  AC  P C ++FSR DN  QH +TH KR  V
Sbjct: 767 CETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKRGDV 822

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 34/57 (59%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           K R   C+ C +GF    H  RH R HTGEK H C FPGCG+ FSR D   +H RTH
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

 Score = 31.2 bits (69), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 14/20 (70%)

Query: 85  CGKGFTTSGHLARHNRIHTG 104
           CGK F+ S  L RHNR HTG
Sbjct: 52  CGKSFSRSDELKRHNRTHTG 71

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           R ++C  C + F    H  RH R HTGEK HAC F GCG+RFSR D   +H R H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>Kwal_14.2278
          Length = 463

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (56%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           E  R ++C  C + F    H  RH R HTGEK HAC F GC +RFSR D   +H R H
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 61.2 bits (147), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 34/57 (59%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + R   C TC +GF    H  RH R HTGEK H C FPGCG+ FSR D   +H RTH
Sbjct: 13  ENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 85  CGKGFTTSGHLARHNRIHTGE 105
           CGK F+ S  L RH R HTG+
Sbjct: 52  CGKSFSRSDELKRHMRTHTGQ 72

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           ++CQ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949

>Scas_575.3
          Length = 455

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           R H+C  C + F    H  RH R HTGEK H C FPGC ++FSR D   +H R H
Sbjct: 66  RPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>Kwal_56.23453
          Length = 828

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +K + ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH    +
Sbjct: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 787

Query: 134 KRTA 137
             TA
Sbjct: 788 PCTA 791

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 3/54 (5%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K + ++C+ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 705 KNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +R   C+ C +GF    H  RH R HTGEK H C FP C + FSR D   +H RTH+
Sbjct: 17  KRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTHM 73

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 58.5 bits (140), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 58.5 bits (140), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAV 138
           K+ C  CGK F     L+ H  IHTG+K + C +P C ++F+   N L+HY+ HLK   V
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTPKV 362

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 58.5 bits (140), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 38/55 (69%), Gaps = 3/55 (5%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K + ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779

>Scas_681.19
          Length = 864

 Score = 58.5 bits (140), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           E  + ++C  C + FT+  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           ++C+ C + F++  HL RH + +H+GEK H+C  P CG+RF R D+ LQH
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH-YRTH 132
           +K R HLC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H Y+ H
Sbjct: 28  DKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYKLH 84

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           + +HLC  CGK F     L  H+ IH G   +AC + GC +RF+   N L+HYR H K+
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKK 273

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 14/22 (63%)

Query: 85  CGKGFTTSGHLARHNRIHTGEK 106
           C K F   G+L RH RIHT +K
Sbjct: 253 CSKRFNVKGNLLRHYRIHTKKK 274

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%)

Query: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           K +C+ C K F     L+ H  IHTGEK + C F  C + F+   N L+HY+ H K
Sbjct: 172 KFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 32/58 (55%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +R   C+ C +GF    H  RH R HTGEK H C   GC + FSR D   +H RTH K
Sbjct: 14  QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>Scas_602.9
          Length = 547

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++  C  C + F    HL RH R +H GEK +ACH   C + FSR DN  QH +TH
Sbjct: 493 KQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>Scas_703.23
          Length = 1341

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC TC +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 67  DKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>Scas_687.33
          Length = 288

 Score = 54.3 bits (129), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 31/57 (54%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +R   C  C +GF    H  RH R HTGEK H C F  CG+ FSR D   +H R HL
Sbjct: 14  QRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

 Score = 26.9 bits (58), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 12/20 (60%)

Query: 85  CGKGFTTSGHLARHNRIHTG 104
           CGK F+    L RH RIH G
Sbjct: 52  CGKSFSRGDELKRHIRIHLG 71

>Kwal_14.2206
          Length = 254

 Score = 53.1 bits (126), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           H C+ CGK F+    L+ H  IHTG + +AC  P CG+RF+   N ++H + H K
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 53.5 bits (127), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 56  DKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 53.5 bits (127), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +K +   C+ C K F  S HL RH R +H+ E+  AC F  C ++FSR DN  QH +TH 
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHK 625

Query: 134 K 134
           K
Sbjct: 626 K 626

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 53.1 bits (126), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C  C K F  S HL RH R +H+ E+  ACH   C ++FSR DN  QH +TH K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>Scas_649.28
          Length = 730

 Score = 53.1 bits (126), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +K +   C  C K F  S HL RH R +H+ E+  AC F  C ++FSR DN  QH +TH 
Sbjct: 668 DKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHK 725

Query: 134 K 134
           K
Sbjct: 726 K 726

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 52.4 bits (124), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           ++++C  CGKGF  +  L  H  IHTG++   C F  CG+ F+   N L+H++ H +
Sbjct: 181 QRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>Scas_697.35
          Length = 839

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           + + C  CGK FT  G+L  H R+HTGEK + C    C ++FSR  N   H  TH K
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQK 595

 Score = 44.7 bits (104), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           E  ++H C  C + F  S HL  H R H G K + C +  CG+RF++  N   H R H
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

 Score = 33.1 bits (74), Expect = 0.059,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHY-RTHL 133
           C+ C K F+  G+LA H   H   K   C    C + F++  N   H  R HL
Sbjct: 573 CELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHL 625

 Score = 27.3 bits (59), Expect = 4.3,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 93  GHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           G + +   +H G K H C  P C + F++  +   H R+HL
Sbjct: 500 GGVEKPKTLHEGSKQHKC--PYCHRLFAQSTHLEVHIRSHL 538

>Kwal_27.10467
          Length = 302

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           ++ C  CGK F     LA HN  HTG+K + C F  C ++F+   N  +HY+ H K
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFK 252

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC TC +GF    HL RH   HT EK + C F  CG+ F+R D  L+H
Sbjct: 146 DKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +C  CGK FT  G+L  H R+HTGEK ++C    C ++FSR  N   H  TH K
Sbjct: 622 VCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +KH C  C + F+ + HL  H R H G K   C +  CG+RF++  N   H R H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 32.3 bits (72), Expect = 0.091,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 24/59 (40%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           + + C  C K F+  G+LA H   H   K   C    C + F++  N   H     K T
Sbjct: 647 KPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKET 705

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ C + F    HL RH R +H  EK + CH   CG++FSR DN  QH +TH
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

 Score = 30.4 bits (67), Expect = 0.43,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 6/55 (10%)

Query: 57  FGCXXXXXXXXXXXXXXXEKRRKHLCQT------CGKGFTTSGHLARHNRIHTGE 105
           FGC                 R  H+C+       CGK F+ S +L++H + HT E
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLKTHTHE 472

>Kwal_47.16621
          Length = 1178

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           ++ R  LC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 73  DRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +RK++C  C K F+ S H ARH R HTG K  +C    C   F R D   +H RT
Sbjct: 5   QRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRT 57

>Scas_717.18
          Length = 354

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 30/57 (52%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           R H C  C K  T S  L  H  IHTGEK + C +P C    S   N  +HY++HLK
Sbjct: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 75  DKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K R  +CQTC + F    HL RH R HT EK + C    C +RF+R D  L+H
Sbjct: 26  KPRLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRH 76

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C  C K F  S HL RH R +H+ ++  +CH   C ++FSR DN  QH +TH K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ CGK FT  G+L  H R+HTGEK + C    CG+RFSR  N   H  TH
Sbjct: 533 CEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 581

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++H C  C K FT S HL  H R H G K   C +  CG+RF++  N   H R H
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 33.5 bits (75), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHY-RTHLK 134
            + + C+ CG+ F+  G+LA H   H   K   C   GC + F++  N   H  R HL+
Sbjct: 556 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 614

>Kwal_47.16577
          Length = 881

 Score = 50.8 bits (120), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C K F+ S HL RH   H+ EK + C +P CG+ FSR D   +H+  HL+
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLR 68

 Score = 30.4 bits (67), Expect = 0.43,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 110 CHFPGCGQRFSRHDNCLQHYRTH 132
           C FPGC + FSR D+  +H   H
Sbjct: 15  CPFPGCSKSFSRSDHLGRHKANH 37

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           E+ +   C  C K F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH 
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHK 673

Query: 134 K 134
           K
Sbjct: 674 K 674

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 50.4 bits (119), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ CGK FT  G+L  H R+HTGE+ + C    CG+RFSR  N   H  TH
Sbjct: 517 CEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTH 565

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++H C  C K FT S HL  H R H G K   C +  CG+RF++  N   H R H
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 34.3 bits (77), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHY-RTHLK 134
            R + C  CGK F+  G+LA H   H   K   C    C + F++  N   H  R HL+
Sbjct: 540 ERPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 598

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           E+ +   CQ C K F  S HL RH R +H+ ++   C +  C ++FSR DN  QH +TH 
Sbjct: 499 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHR 556

Query: 134 K 134
           K
Sbjct: 557 K 557

>Scas_717.17d
          Length = 350

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           H+C  CGK  T S  L  H  IHTG +   C +P C    S   N  +H+++HLK
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 50.4 bits (119), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           ++ R  LC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 78  DRPRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Kwal_26.8351
          Length = 698

 Score = 50.1 bits (118), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           E+ +   CQ C K F  S HL RH R +H+ E+   C +  C ++FSR DN  QH +TH 
Sbjct: 636 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHK 693

Query: 134 K 134
           K
Sbjct: 694 K 694

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHAC-------HFPGCGQRFSRHDNCLQHYR 130
           + + C  CGK F       RH  +HTG+K + C        F GCG++F+R D   +H++
Sbjct: 547 KPYQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFK 606

Query: 131 THLKRTAV 138
           T   R  +
Sbjct: 607 TSSGRKCI 614

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++C+ CGK F+   +L  H R HT EK + C    CG+ F+R  +  +H   H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH 571

>Scas_710.9
          Length = 505

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           ++RK  C+ CGK  T +  L  H  IHTG +  +C +PGC + F+   N  +H + HL
Sbjct: 443 RKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>Kwal_47.17241
          Length = 403

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++  C  C + F    HL RH R +H GEK   CH   CG++FSR DN  QH +TH
Sbjct: 344 KQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH
Sbjct: 486 CADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTH 535

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ CGK FT  G+L  H R+HTGEK + C    CG++FSR  N   H  TH
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTH 601

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K FT S HL  H R H G K  +C F  CG+RF++  N   H R H
Sbjct: 525 CPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 33.5 bits (75), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHY-RTHLK 134
            + + C+ CG+ F+  G+LA H   H   K   C    C + F++  N   H  R HL+
Sbjct: 576 EKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQ 634

>Scas_718.36d
          Length = 330

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +++  + C  CGKGF     L  H+ I +G + + C +  C + F+   N L+HY+ H +
Sbjct: 234 DEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

Query: 135 RTA 137
            T+
Sbjct: 294 LTS 296

>Kwal_14.2543
          Length = 711

 Score = 48.5 bits (114), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
            + + C  CGKGF TS  L  H R HTGEK   C    CG+RF+   N  +H RTH ++
Sbjct: 631 EKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 687

 Score = 33.5 bits (75), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F+T   L +H R H+GEK + C    CG+ F+   +   H RTH
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTH 656

 Score = 30.4 bits (67), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 83  QTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + CG+  T    L RH R+HT  K   C    C + FS  D   QH RTH
Sbjct: 581 ENCGRVITQRQKLLRHLRVHTRYK--PCKCVHCLKTFSTQDILQQHMRTH 628

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 78  RKHLC--QTCGKGFTTSGHLARH---NRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +KH+C    C + F++   L  H     I  G+ ++ C +  CG+  ++    L+H R H
Sbjct: 541 QKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKLLRHLRVH 600

Query: 133 LK 134
            +
Sbjct: 601 TR 602

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 48.1 bits (113), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ C + F    HL RH R +H GEK + CH   C ++FSR DN  QH +TH
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 48.1 bits (113), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ C + F    HL RH R +H GEK + C    CG++FSR DN  QH +TH
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

 Score = 27.3 bits (59), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGE 105
           C+ CGK F+ S +L +H + H G+
Sbjct: 385 CEICGKKFSRSDNLNQHIKTHGGD 408

>Scas_656.1*
          Length = 102

 Score = 46.2 bits (108), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C  CGK  T S  L  H  +HTG++   C +  CG+ F+   N  +HY+ HLK
Sbjct: 42  CPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC  C +GF    HL RH R HT EK   C F  CG+ F+R D  L+H
Sbjct: 43  DKPRPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 48.1 bits (113), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHAC-------HFPGCGQRFSRHDNCLQHYR 130
           R ++C  CGK F       RH  +HTG++ + C       +  GCG++F+R D   +H++
Sbjct: 495 RPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFK 554

Query: 131 THLKRTAV 138
           T L +  +
Sbjct: 555 TELGKKCI 562

 Score = 35.0 bits (79), Expect = 0.013,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + C  C K FT   +L  H R HT E+ + C    CG+ F+R  +  +H   H
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH 519

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 48.1 bits (113), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           +K R  LC  C +GF    HL RH   HT EK   C    CG+ F+R D  L+H
Sbjct: 22  DKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRH 73

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           K ++H C  C K F+ S H  RH R H G K   C    C   F R D   +H RT
Sbjct: 8   KTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHIRT 61

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ C + F    HL RH R +H GEK + C    CG++FSR DN  QH +TH
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>Scas_683.25
          Length = 879

 Score = 47.8 bits (112), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           +++ +C  C KGF+ + H  RH R HTG K + C    C   F R D  L+H +T  K+
Sbjct: 12  QKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCFVRSDLALRHIKTVHKK 68

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 47.4 bits (111), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +RK++C  C + F+ S H  RH R HTG K  +C    C   F R D   +H RT
Sbjct: 5   QRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRT 57

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 47.4 bits (111), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFP-------GCGQRFSRHDNCLQHYR 130
           R  +C  CGK F       RH  +HTG+K + C          GCG++F+R D   +H++
Sbjct: 595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654

Query: 131 THLKRTAV 138
           T   R  +
Sbjct: 655 TESGRRCI 662

 Score = 38.5 bits (88), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  CGK FT   +L  H R HT E+   C    CG+ F+R  +  +H   H
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 75  EKRRKHL---CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +KR+K +   C  CGK       L  H  IHTG +   C +PGC +RF+   N ++HYR 
Sbjct: 266 DKRQKGVRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 325

Query: 132 H 132
           H
Sbjct: 326 H 326

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ C + F    HL RH R +H  EK   CH   C + FSR DN  QH +TH
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Scas_721.92
          Length = 1152

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K R  +C  C + F    HL RH R HT EK + C    C ++F+R D  L+H
Sbjct: 74  KPRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C+ CGK FT +G+L  H R+HTGE+   C    C + F+R  N   H  TH
Sbjct: 510 CEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTH 558

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F+ S HL  H + H G K   C F  CG+RF++  N   H R H
Sbjct: 482 CAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K R  +C TC + F    HL RH R HT EK + C    C +RFSR D  L+H
Sbjct: 45  KPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K R  +C+ C + F    HL RH R HT EK + C    C +RF+R D  ++H
Sbjct: 121 KPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>Scas_711.56
          Length = 832

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           C  CGK F  S  L  H R HTGEK   C    CG+ F+   N  +H +THLKR
Sbjct: 756 CDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKR 807

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F+    L +H R H+GEK   C    CG+RF+   +   H RTH
Sbjct: 728 CSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 33.1 bits (74), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C K F+    L RH R+H+G K   C    C + FS  +   QH RTH
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 748

>Scas_713.52
          Length = 620

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTA 137
           L + CGK F    ++  H + H  +K +AC FPGC + F R+ + ++H ++H  RT+
Sbjct: 483 LYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTS 539

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           K R  +C+ C + F    HL RH R HT EK + C    C + F+R D  ++H
Sbjct: 100 KLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 78  RKHLCQT--CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           RK++CQ   C + F+    LA+H   HT E+ + C  P CG+RF R  +   H  TH
Sbjct: 55  RKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTH 111

 Score = 32.7 bits (73), Expect = 0.081,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 4/62 (6%)

Query: 78  RKHLCQ--TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           R ++C    CGK F    HL  H   H   K   C +  C +RF  +    +H  TH +R
Sbjct: 85  RPYVCDEPNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERR 142

Query: 136 TA 137
            A
Sbjct: 143 IA 144

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C   FT + HLARH R HTGEK   C  P C + FSR DN  QH
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQC--PACLKFFSRVDNLKQH 90

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 44.7 bits (104), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
            R   C  C K ++TS  L  H R HTGEK  +C  P C +RF+   N  +H RTH
Sbjct: 717 ERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSC--PICNKRFNESSNLAKHIRTH 770

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C K F     L RH ++H+  K   C    CG+ F+  D   QH R H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVH 714

 Score = 26.9 bits (58), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 85  CGKGFTTSGHLARHNR---IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C K F ++  L  H     + +G  ++ C + GC + F +    ++H + H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           C  CG+  T    L  H  IHTGE    C +PGC +RF+   N  +H  +H +R
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +  +C  CGK FT    L  H  +H+G+K   C + GC ++F+   N ++H + H
Sbjct: 230 KADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           K+   +C+ CGK F     L  H  +H  +K + C   GC +RF+   N L+H R H
Sbjct: 221 KKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
            + + C  C K F  S  L  H R HTGEK   C    CG+RF+   N  +H +TH K+
Sbjct: 793 EKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQKK 849

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           K + + C+TC + F++   L +H R H+GEK + CH   C ++F+   +   H RTH
Sbjct: 764 KYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           L   C + F     L RH ++H+  K + C    C + FS  +  +QH RTH
Sbjct: 741 LWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 790

>Kwal_27.11460
          Length = 531

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFP-------GCGQRFSRHDNCLQHYR 130
           R   C  CGK F       RH  +HTG+K + CH         GCG++F+R D   +H++
Sbjct: 439 RPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK 498

Query: 131 TH 132
           T 
Sbjct: 499 TE 500

 Score = 33.5 bits (75), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRH 122
           + C+ C K FT   +L  H R HT E+  +C    CG+ F+R 
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQ 453

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + C  C K F     L  H  IH G     C +P C ++F+   N L+HYR+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           ++K++C  C K F+ S H  RH R H G K   C    C   F R D   +H RT
Sbjct: 5   QKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQV--CKHSFVRRDLLQRHIRT 57

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +K++C+ CG+       L  H   HTG++  +C  PGC + F+   N L+H R H
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 82  CQTCGKGFTTSGHLARH-NRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           C+ C   F +S HL RH N +H+ EK + C  P C + F R D+  QH +
Sbjct: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611

>Kwal_26.8011
          Length = 190

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           K+ CQ C K F+ S  L  H   HTG +   C F  C + F+   N ++H +TH
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>Scas_719.68
          Length = 1350

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +K R  LC  C    T + HL RH R HT EK   C F  CG+ F+R D  L+ Y+T L
Sbjct: 36  DKPRPFLCPIC----TRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLR-YQTKL 87

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +K+ C  CG+  +    L  H  IHTG+K + C    C +RF+   N L+HY+ H
Sbjct: 339 KKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>Scas_720.33
          Length = 316

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 75  EKRRKHLCQ---TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           ++R+   CQ    C   FT   HLARH R HTGEK   C+   C + FSR DN  QH  T
Sbjct: 10  KERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDT 67

>Scas_695.2
          Length = 571

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHAC------HFP-GCGQRFSRHDNCLQHYRTHL 133
           +C  CGK F       RH  +HTG+K + C        P GC ++F+R D   +H++T  
Sbjct: 481 VCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKTDS 540

Query: 134 KRTAV 138
            R  +
Sbjct: 541 GRKCI 545

 Score = 37.0 bits (84), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + C+ C K FT   +L  H R HT E    C+   CG+ F+R  +  +H   H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLH 502

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           K + + C  C K F+T   L +H R+H+GEK + CH   C +RF+  ++   H RTH
Sbjct: 593 KYKPYQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 39.3 bits (90), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
            + + C  C K F  S  L  H R HTGEK   C    CG+ F+   N  +H +TH+K+
Sbjct: 622 EKPYECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKK 678

 Score = 32.3 bits (72), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C K F+    L RH ++H+  K + C  P C + FS  D   QH R H
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 85  CGKGFTTSGHLARH-NRIH--TGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C + F ++G L  H   +H   G+  + C + GC + FS+    ++H + H K
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
            R   C  C K F TS  L  H R HTGEK   C    CG+RF+   N  +H +TH ++
Sbjct: 683 ERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 84  TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           TC K FT    L RH ++H+G K   C  P C ++FS  D   QH RTH
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTH 680

 Score = 32.7 bits (73), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F+T   L +H R H+GE+   C +  C ++F+   +   H RTH
Sbjct: 660 CPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 42.0 bits (97), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C   F  + HLARH R HTGEK   C+   C + FSR DN  QH
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQH 68

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 42.0 bits (97), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H RTH K+
Sbjct: 182 KLRKQ-CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240

Query: 136 TA 137
            A
Sbjct: 241 IA 242

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 82  CQTCGKGFTTSGHLARH-NRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C + F    HL RH + +H GE+ ++C    C + FSR DN  QH RTH
Sbjct: 220 CDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>Scas_717.17
          Length = 525

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           ++C  C K F     L RH   H+ E+++ C  P C  R  R DN LQH +
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C + FT + HLARH R  TGEK   C    C + FSR DN  QH
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQCEV--CNRFFSRIDNLKQH 69

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           C   FT   HLARH R HTGE+   CH   C + FSR DN  QH  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQHVES 72

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           K RK  C  CGK  +    L  H  IHTG+    C + GC + F+   N L+H ++H ++
Sbjct: 251 KLRKQ-CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           C  C K F+TS  L  H R HTGEK  +C    CG+RF+   N  +H + H ++
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERK 625

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K F+T   LA+H R H+GE+   CH+  C ++FS   +   H RTH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           C   F+ + HLARH R HTGEK   C    C + FSR DN  QH  T
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDT 77

 Score = 28.1 bits (61), Expect = 3.0,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 105 EKNHACH-FPGCGQRFSRHDNCLQHYRTH 132
           EKN  C  +PGC   FSR ++  +H R H
Sbjct: 22  EKNFKCTGYPGCEMSFSRAEHLARHIRRH 50

>Scas_693.31
          Length = 635

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           L   CGK F    +   H + H  ++ +AC FP C + F R+ + ++H + H +++
Sbjct: 492 LYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEKS 547

 Score = 37.7 bits (86), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 78  RKHLCQ--TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           R + C    C K F  +  L RH ++H+ EK++AC    CG++F+R D  + H
Sbjct: 517 RPYACDFPNCDKAFVRNHDLVRHKKVHS-EKSYAC---PCGKKFNREDALIVH 565

>Scas_707.46
          Length = 338

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           R +  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H ++H K+ 
Sbjct: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326

Query: 137 A 137
           A
Sbjct: 327 A 327

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 39.3 bits (90), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHAC-------HFPGCGQRFSRHDNCLQH 128
             R   C  CGK F       RH  +H+G+K + C          GCG++F+R D   +H
Sbjct: 450 DERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRH 509

Query: 129 YRTHLKR 135
           ++T   R
Sbjct: 510 FKTESGR 516

 Score = 32.3 bits (72), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSR-HD 123
           C  C K FT   +L  H R HT E+  +C    CG+ F+R HD
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHD 468

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 39.3 bits (90), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 75  EKRRKHLCQT--CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           ++ +K+LC    CGK ++    L +H R HT E+   C  PGCG+ F R  +   H  +H
Sbjct: 3   KRPKKYLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSH 62

 Score = 33.1 bits (74), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 77  RRKHLCQT--CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
            R  +C+   CGKGF  + HL  H   H+  K  AC  P C + F+ +    +H +TH
Sbjct: 35  ERPFVCEEPGCGKGFLRASHLKVHKWSHSQVKPLAC--PVCSKGFTTNQQLSRHKKTH 90

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 83  QTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           + C K F    +   H + H  ++ + C FPGC + F R+ + L+H ++HL++
Sbjct: 698 KDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

 Score = 30.8 bits (68), Expect = 0.36,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 101 IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           +  G K   C F  C +RF+R  N   H +THL
Sbjct: 686 LEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHL 718

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 38.9 bits (89), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           H CQ C K F     L RH   H+ +++  C  P C  R  R DN LQH +  LK T
Sbjct: 346 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK--LKHT 398

>Scas_707.31
          Length = 289

 Score = 38.5 bits (88), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           +  +++ C  C K F    HL RH R IH   +   C    C +RFSR+DN  QH R H
Sbjct: 218 DDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIH 274

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 38.5 bits (88), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C  CGKG TT   L RH   HT  K+  C + GC + F +H     H
Sbjct: 167 CSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKHPQLRSH 211

 Score = 35.4 bits (80), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           C TCGK F    HL RH   HT +K   C    CG+  +      +H  TH K
Sbjct: 139 CDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 38.1 bits (87), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           R +  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H ++H K +
Sbjct: 281 RLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNS 340

>Scas_602.4
          Length = 266

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H + H K+
Sbjct: 197 KLRKQ-CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255

Query: 136 T 136
            
Sbjct: 256 V 256

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 38.1 bits (87), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +K  + L   CGK F    ++  H + H  +K + C F GC + F R+ +  +H +TH K
Sbjct: 520 DKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

 Score = 32.3 bits (72), Expect = 0.099,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 83  QTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + C K F  +  LARH + H  +K+ +C    CG++FS   + ++H   H
Sbjct: 558 EGCTKAFVRNHDLARHKKTH--DKHFSC---PCGKKFSSEQSMMKHKNRH 602

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 37.7 bits (86), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           CGK F    ++  H + H  ++ + C + GC + F R+ + ++H +TH +++
Sbjct: 563 CGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEKS 614

 Score = 30.4 bits (67), Expect = 0.39,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 105 EKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           ++ + C +P CG+ F R  N   H +THL+
Sbjct: 553 DRMYECLYPQCGKTFKRRYNIRSHIQTHLE 582

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 37.7 bits (86), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHF--------PGCGQR--FSRHDN 124
           E+R K++C  C   F   G+L RH + H  EK + C F          C     FSR D 
Sbjct: 157 EQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDT 216

Query: 125 CLQHYRTHLK 134
               Y+THLK
Sbjct: 217 ----YKTHLK 222

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 37.7 bits (86), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           H C  C K F     L RH   H+ +++  C  P C  R  R DN LQH +
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLC--PWCNSRHKRRDNLLQHMK 582

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRH 122
            R   C  CGKG  T   L RH   HT  K+  C + GC + F +H
Sbjct: 92  ERPFYCSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESFYKH 135

 Score = 32.7 bits (73), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 4/51 (7%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCG----QRFSRHD 123
           R+   C  C   FT   HL RH   HT E+   C F G G    Q+  RH+
Sbjct: 64  RKPWKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCGKGLITRQQLKRHE 114

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 36.6 bits (83), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 29/51 (56%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           C K F    ++  H + H  ++ ++C  PGC + F R+ + ++H ++H ++
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEK 607

 Score = 33.1 bits (74), Expect = 0.060,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C K F  +  L RH + H  EK +AC    CG++F+R D  + H
Sbjct: 587 CDKAFVRNHDLIRHKKSHQ-EKAYAC---PCGKKFNREDALVVH 626

 Score = 32.7 bits (73), Expect = 0.063,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 105 EKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +K   C FPGC + F R  N   H +THL+
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLE 576

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 36.6 bits (83), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           L   C K F    ++  H + H  ++ ++C FPGC + F R+ + ++H  +H
Sbjct: 606 LYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 657

 Score = 29.3 bits (64), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C K F  +  L RH   H  +K    +   CG+RF+R D  + H
Sbjct: 640 CTKAFVRNHDLIRHKISHNAKK----YICPCGKRFNREDALMVH 679

 Score = 27.7 bits (60), Expect = 4.1,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 105 EKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +K   C +P C + F R  N   H +THL+
Sbjct: 600 DKLFECLYPNCNKVFKRRYNIRSHIQTHLQ 629

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 36.6 bits (83), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 6/59 (10%)

Query: 84  TCGKGFTTSGHLARHNRIHTGEKNHACHFPG------CGQRFSRHDNCLQHYRTHLKRT 136
           TC K F+   HL+RH   H  ++   CH+        CG+ F R D   +H + H  ++
Sbjct: 51  TCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKRHENKS 109

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 35.8 bits (81), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 75  EKRRK-HLC--QTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           EKR K ++C  ++CGK ++    L +H R HT EK   C  PGC + F R  +   H  +
Sbjct: 2   EKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLS 61

Query: 132 HLK 134
           H K
Sbjct: 62  HSK 64

 Score = 31.6 bits (70), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKN----HACHFPGC 115
           K + + C  CGKGF T     RH + HT  ++    + C + GC
Sbjct: 64  KVKPYNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGYYGC 107

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 35.8 bits (81), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTA 137
           +C  CGK FT    L  H  IHT  K   C F  C + F+   N  +H R H ++ +
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQKAS 222

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 88  GFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
            FT + H ARH R HTGEK   C    C + FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQCDI--CMKFFSRIDNLKQH 40

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
            K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H + H +
Sbjct: 281 SKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHER 339

Query: 135 R 135
           +
Sbjct: 340 K 340

>Scas_378.1
          Length = 208

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTA 137
           C  C K F     L RH   H+ +++++C  P C  +  R DN LQH +  LK TA
Sbjct: 86  CHMCVKSFRRHSWLKRHLLAHSSQRHYSC--PKCVSKHKRKDNLLQHLK--LKHTA 137

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 35.0 bits (79), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K FT    L  H  IHT  K + C +  C + F+   N  +H R H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIH 168

>Scas_602.4d
          Length = 256

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135
           C  CGK  +    L  H  IHTG+    C + GC + F+   N  +H + H ++
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250

>Kwal_26.8021
          Length = 507

 Score = 35.0 bits (79), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAV 138
           C  C K F       RH   H+  K ++C  P C  R  R DN  QH +T   R  V
Sbjct: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKTKHVRHVV 445

>Scas_712.2
          Length = 327

 Score = 34.7 bits (78), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 76  KRRKHLCQT--CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           K++ + CQ   C + FT    L +H   HT E+ + C   GCG+RF R  +   H  TH 
Sbjct: 9   KKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHS 68

Query: 134 K 134
           K
Sbjct: 69  K 69

 Score = 29.3 bits (64), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 4/62 (6%)

Query: 77  RRKHLCQT--CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
            R ++C    CGK F    HL  H   H+  K   C F  C + F  +    +H  TH K
Sbjct: 40  ERPYICDVEGCGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAK 97

Query: 135 RT 136
           ++
Sbjct: 98  KS 99

>Scas_627.6
          Length = 1207

 Score = 35.0 bits (79), Expect = 0.014,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 6/56 (10%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACH--FPG----CGQRFSRHDNCLQHYRTHLK 134
           C K FT   HL+RH   H  ++   C   FP     C + F R D  ++H + H K
Sbjct: 49  CNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTK 104

 Score = 26.6 bits (57), Expect = 9.6,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 17/38 (44%)

Query: 84  TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSR 121
           TC K F     L RH + HT  KN        G+R S+
Sbjct: 84  TCNKTFVRKDLLIRHQKRHTKSKNRLHGKNSQGERESK 121

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 34.3 bits (77), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           R + C+ CG+GFT   HL RH   H+  K  +C    CG+  +      +H  TH K
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRHEITHTK 202

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 33.9 bits (76), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           EKR K  C  C   F+ S  L RH + H     + C  P CG+ F+R D   +HY T
Sbjct: 95  EKRFK--CAKCSLEFSRSSDLRRHEKTHFAILPNIC--PQCGKGFARKDALKRHYDT 147

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 34.3 bits (77), Expect = 0.019,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHF------PGCGQRFSRHDNCLQHYRTH 132
           C K FT   HL+RH   H  ++   CH+        C + F R D  ++H + H
Sbjct: 23  CSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRH 76

>Kwal_56.23925
          Length = 745

 Score = 33.5 bits (75), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAV 138
           CGK F    ++  H + H  ++ + C F GC + F R+ + ++H +TH ++  V
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEKCYV 645

 Score = 30.0 bits (66), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 78  RKHLC--QTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           R + C  + C K F  +  L RH + H  EK + C    CG++F R D  L H
Sbjct: 613 RPYFCDFEGCHKAFVRNHDLIRHKKTH-AEKCYVC---PCGKKFVREDALLVH 661

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 105 EKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           +K   C  P CG+ F R  N   H +THL+
Sbjct: 582 DKTFECLHPDCGKTFRRRYNIRSHIQTHLE 611

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 33.5 bits (75), Expect = 0.036,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 16/71 (22%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR-----------FSRHD 123
           +  ++ +C  C   F   G+L RH + H  EK + C F   GQ            FSR D
Sbjct: 193 DDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYN-GQEVPSKRCHNSGGFSRRD 251

Query: 124 NCLQHYRTHLK 134
                Y+TH+K
Sbjct: 252 T----YKTHMK 258

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 33.1 bits (74), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +K+ C  C   F  S  L RH R H     + C    CG+ F+R D   +HY T
Sbjct: 123 KKYQCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHYDT 174

>Scas_717.60d
          Length = 167

 Score = 32.7 bits (73), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHY 129
           C+ C K F TS  L +H +    ++   C +  CG+ F R D    HY
Sbjct: 101 CKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAFKRKDQRKSHY 147

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 33.5 bits (75), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           C K F  +  L RH + H  EK   C    CG++FSR D  L H
Sbjct: 711 CTKAFVRNHDLIRHKKTH-AEKTFTCP---CGKKFSREDALLTH 750

 Score = 32.0 bits (71), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           L   CGK F    ++  H + H  ++   C   GC + F R+ + ++H +TH ++T
Sbjct: 677 LYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEKT 732

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 32.7 bits (73), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSR 121
           C K +     L +H   HT +K + C  PGCG++F R
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIR 55

 Score = 26.9 bits (58), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAV 138
           CGK F    HL  H   H+  K  AC    C +RF  +    +H  +H +++ +
Sbjct: 49  CGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERKSKL 100

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 32.3 bits (72), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           C  C K FT    L  H  IH   + + C +  C + F+   N  +H R H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

 Score = 26.9 bits (58), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%)

Query: 78  RKHLCQ--TCGKGFTTSGHLARHNRIHTGEKNH 108
           R +LC    C K F    +L RH RIH G + H
Sbjct: 102 RPYLCDYANCNKSFNVKSNLNRHLRIHRGHELH 134

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 32.0 bits (71), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           C  C   F+ S  L RH ++H+    H C    CG+ F+R D   +H  T
Sbjct: 97  CAKCQLKFSRSSDLRRHEKVHSLVLPHICS--NCGKGFARKDALKRHSNT 144

 Score = 29.3 bits (64), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKN 107
           H+C  CGKGF     L RH+   T ++N
Sbjct: 123 HICSNCGKGFARKDALKRHSNTLTCQRN 150

>Scas_641.24
          Length = 532

 Score = 32.3 bits (72), Expect = 0.092,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 14/64 (21%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHF--------PGCGQR--FSRHDNCLQHYR 130
           +C  C   F   G+L RH + H  EK + C F          C     FSR D     Y+
Sbjct: 184 ICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDT----YK 239

Query: 131 THLK 134
           THLK
Sbjct: 240 THLK 243

>Kwal_34.15946
          Length = 279

 Score = 32.3 bits (72), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR------FSRHDNCLQHYRTHLK 134
           C  C   F   G+L RH + H   K+  C F     R      FSR D     Y+THLK
Sbjct: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 32.0 bits (71), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           C  C   F  SG L RH ++H     + C    CG+ F+R D   +H+ T
Sbjct: 149 CTKCELVFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGT 196

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 32.3 bits (72), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           H C  C K F     L RH   H+  K ++C  P C  R  R DN  QH +
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 233

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 14/64 (21%)

Query: 81  LCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR----------FSRHDNCLQHYR 130
           +C  C   F   G+L RH + H  EK + C F                FSR D     Y+
Sbjct: 161 ICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDT----YK 216

Query: 131 THLK 134
           THLK
Sbjct: 217 THLK 220

>Scas_604.4
          Length = 585

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 76  KRRKHLCQTC--GKGFTTS---GHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           K  K+L   C  G  FT +    H+  H R+H   K  AC    C ++F R  +  +H R
Sbjct: 210 KSEKNLQLNCHWGSCFTKTVKRDHITSHLRVHVPLKPFACK--KCTKKFKRPQDLKKHLR 267

Query: 131 THL 133
           THL
Sbjct: 268 THL 270

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 14/70 (20%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHF--------PGCGQR--FSRHDN 124
           E   K +C  C   F   G+L RH + H  EK + C F          C     FSR D+
Sbjct: 237 ETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDS 296

Query: 125 CLQHYRTHLK 134
               Y+THL+
Sbjct: 297 ----YKTHLR 302

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 6/56 (10%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHF------PGCGQRFSRHDNCLQHYRTHLK 134
           C K F+   HL+RH   H  ++ + C +        C + F R D  ++H + H K
Sbjct: 38  CNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSK 93

>Kwal_26.9300
          Length = 304

 Score = 32.0 bits (71), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           + RRK  C  C   +    +L+ H   H   +N     P CG+ F+RH++ L+H + H K
Sbjct: 141 KPRRKKECPICHNFY---ANLSTHRSSHLQPENKPHKCPVCGRGFTRHNDLLRHRKRHWK 197

 Score = 31.2 bits (69), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHAC 110
           + + H C  CG+GFT    L RH + H  +++++C
Sbjct: 169 ENKPHKCPVCGRGFTRHNDLLRHRKRHWKDEDNSC 203

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 31.6 bits (70), Expect = 0.16,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 14/65 (21%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHF--PGCGQR--------FSRHDNCLQHY 129
           ++C  C   F   G+L RH + H   K + C F      Q         FSR D     Y
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT----Y 259

Query: 130 RTHLK 134
           +THLK
Sbjct: 260 KTHLK 264

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 31.6 bits (70), Expect = 0.17,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 85  CGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           C        H+  H R+H   K   C    CG++F R  +  +H R HL
Sbjct: 95  CNTKTVKRDHITSHLRVHVPLKPFGC--STCGKKFKRPQDLKKHLRVHL 141

 Score = 26.9 bits (58), Expect = 6.7,   Method: Composition-based stats.
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 82  CQTCGKGFTTSGHLARHNRIH 102
           C TCGK F     L +H R+H
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVH 140

>Kwal_27.10167
          Length = 285

 Score = 31.2 bits (69), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 75  EKRRKHLCQ--TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSR 121
           E  +K++C   +C K +     L  H   H   +  AC  P CG+RF R
Sbjct: 30  ECDKKYICPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLR 78

 Score = 27.7 bits (60), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 82  CQTCGKGFTTSGHLARHNRIH 102
           C+ C KGFTT   L+RH   H
Sbjct: 97  CEECSKGFTTKQQLSRHLATH 117

>Kwal_47.18337
          Length = 536

 Score = 31.2 bits (69), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 14/68 (20%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR----------FSRHDNCL 126
           +++ +C  C   F   G+L RH + H  EK + C F                FSR D   
Sbjct: 154 QKRFVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDT-- 211

Query: 127 QHYRTHLK 134
             Y+THL+
Sbjct: 212 --YKTHLR 217

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 30.8 bits (68), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 82  CQTCGKGFTTSGHLARHNRI-HTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133
           C  CG  +     L +H R  H  ++ + C    CG++F+R D   +H+ T L
Sbjct: 122 CNICGISYDKLTDLRKHERASHEPKQENVCM--NCGKKFARKDALKRHFDTVL 172

>Kwal_27.11824
          Length = 199

 Score = 30.8 bits (68), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +K  C  C   F  S  L RH R H     + C    CG+ F+R D   +H+ T
Sbjct: 117 KKFPCAKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHFDT 168

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 30.8 bits (68), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHF--PGC----GQRFSRHDNCLQHYRTHLK 134
           C  C   F   G+L RH + H   K++ C +  P C       FSR D     ++THLK
Sbjct: 80  CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 134

>Scas_660.12
          Length = 367

 Score = 30.8 bits (68), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 14/66 (21%)

Query: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR----------FSRHDNCLQH 128
           +++C  C   F   G+L RH + H  EK + C F                FSR D     
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDT---- 150

Query: 129 YRTHLK 134
           Y+THLK
Sbjct: 151 YKTHLK 156

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 30.8 bits (68), Expect = 0.29,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQ 117
           CQ C + F    HL  H R H G+K + C +  CG+
Sbjct: 616 CQYCHRCFAQVTHLDVHIRSHLGKKPYQCEY--CGK 649

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 30.4 bits (67), Expect = 0.44,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 7/63 (11%)

Query: 76  KRRKHL---CQ--TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           K +K+L   CQ   C        H+  H R+H   K  AC    C +RF R  +  +H +
Sbjct: 182 KSQKNLQLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFAC--STCSKRFKRPQDLKKHLK 239

Query: 131 THL 133
            HL
Sbjct: 240 IHL 242

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 4/46 (8%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCG----QRFSRHD 123
           C  C K F    HL RH   H+  K   C + G G    Q+  RH+
Sbjct: 82  CDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHE 127

>Scas_568.5
          Length = 199

 Score = 29.6 bits (65), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           +++ C  C   F  S  L RH + H     H C    CG+ F+R D   +H+ T
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKAHLLVLPHICS--QCGKGFARKDALKRHFNT 167

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKN 107
           H+C  CGKGF     L RH    T ++N
Sbjct: 146 HICSQCGKGFARKDALKRHFNTQTCQRN 173

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 30.0 bits (66), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
            + + C  C K F+  G+LA H   H   +   C    C + FS+  N   H
Sbjct: 8   EKPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

 Score = 27.3 bits (59), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 103 TGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           TGEK + C    C +RFSR  N   H  TH K
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGK 35

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 29.6 bits (65), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 2/56 (3%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           E    + C  C K F     L RH   H+  K   C  P C     R DN LQH +
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLK 354

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQH 128
           H C  C   F  S  L RH R H     + C    CG+ F+R D   +H
Sbjct: 142 HYCSQCSLKFNRSSDLRRHERAHLLVLPYIC--TQCGKGFARKDALKRH 188

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 20/45 (44%)

Query: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDN 124
           ++C  CGKGF     L RH+   T ++N        G+  S   N
Sbjct: 170 YICTQCGKGFARKDALKRHSGTMTCKRNRRKLMEAAGREVSELIN 214

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 28.9 bits (63), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 10/59 (16%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPG------CGQRFSRHDNCLQHYRTHLK 134
           C  C   F   G+L RH + H   K+  C +            FSR D     +RTHLK
Sbjct: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 84  TCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           +C        H+  H R+H   K  +C    C ++F R  +  +H + H++ T
Sbjct: 112 SCTTKTVKRDHITSHLRVHVPLKPFSCS--TCSRKFKRPQDLKKHLKVHMEDT 162

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 14/68 (20%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHAC-----HFPG-----CGQRFSRHDNCL 126
           + + +C  C   F   G+L RH + H  EK + C     H P          FSR D   
Sbjct: 149 KERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDT-- 206

Query: 127 QHYRTHLK 134
             Y+THL+
Sbjct: 207 --YKTHLR 212

>Scas_683.30
          Length = 478

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           RRK  C TC   +    +L+ H   H   ++     P C + F+R+++ ++H + H K
Sbjct: 284 RRKKQCPTCLNYY---ANLSTHKSTHLTPEDRPHKCPICERGFARNNDLIRHKKRHWK 338

>Kwal_55.20634
          Length = 419

 Score = 27.7 bits (60), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 7/68 (10%)

Query: 76  KRRKHLCQTCGKGFTTS-----GHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           K +K+L   C  G  T+      H+  H R+H   K  AC    C + F R  +  +H +
Sbjct: 85  KSQKNLQLNCRWGKCTAKTVKRDHITSHLRVHVPLKPFAC--STCTKTFKRPQDLKKHLK 142

Query: 131 THLKRTAV 138
            HL+   +
Sbjct: 143 VHLEDETI 150

>Kwal_23.5400
          Length = 429

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 4/46 (8%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCG----QRFSRHD 123
           C  C + F+   HL RH   H+ +K   C + G G    Q+  RH+
Sbjct: 83  CTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRHE 128

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 27.7 bits (60), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131
           C+ C   F  S  L RH R H     + C    CG+ F+R D   +H+ T
Sbjct: 206 CEKCHMVFRRSSDLRRHERQHLPILPNICTL--CGKGFARKDALKRHFDT 253

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 27.3 bits (59), Expect = 4.9,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 7/68 (10%)

Query: 76  KRRKHLCQTCGKGFTTS-----GHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130
           K  K+L   C  G  T+      H+  H R+H   K   C    C ++F R  +  +H +
Sbjct: 175 KSHKNLQLNCHWGDCTTKTEKRDHITSHLRVHVPLKPFGC--STCSKKFKRPQDLKKHLK 232

Query: 131 THLKRTAV 138
            HL+   +
Sbjct: 233 IHLESGGI 240

>Scas_670.2
          Length = 435

 Score = 27.3 bits (59), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134
           KRRK  C  C   +    +L  H   H   ++     P C + F R+++ ++H + H K
Sbjct: 248 KRRKKQCPICSGYY---ANLTTHKATHLVPEDRPHKCPICQRGFGRNNDLIRHQKRHWK 303

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 26.9 bits (58), Expect = 6.0,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 22/60 (36%), Gaps = 10/60 (16%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIH----------TGEKNHACHFPGCGQRFSRHDNCLQ 127
           R H C  C  GF  +  L RH + H           G  N  C     GQR  + +  +Q
Sbjct: 349 RPHKCIICQSGFARNNDLIRHRKRHWKDDIQNIANLGNTNQQCQNTIQGQRALKKNQLIQ 408

 Score = 26.6 bits (57), Expect = 9.6,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIH--TGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           + ++K  C  C K F    +L+ H   H  + ++ H C    C   F+R+++ ++H + H
Sbjct: 319 KTKKKRQCPICHKYF---ANLSTHKSTHLTSQDRPHKCII--CQSGFARNNDLIRHRKRH 373

Query: 133 LK 134
            K
Sbjct: 374 WK 375

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 26.9 bits (58), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 76  KRRKHLCQTCGKGFTTSGHLARHNRIH 102
           + R   C+ C +GF  S  L RH ++H
Sbjct: 407 ETRPFKCEVCSRGFARSNDLIRHKKLH 433

>KLLA0A02629g complement(233822..235501) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c RME1
           zinc-finger transcription factor singleton, hypothetical
           start
          Length = 559

 Score = 26.9 bits (58), Expect = 7.3,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGC 115
           +KR  + C  C + F T    A+H   +  E+ + C FP C
Sbjct: 408 QKRGAYKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPFPLC 448

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 26.6 bits (57), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIH 102
           R H C  C +GF  S  L RH + H
Sbjct: 186 RPHKCSVCSRGFARSNDLLRHKKRH 210

>KLLA0F06875g complement(658475..658900) gi|24943209|gb|AAN65373.1
           Kluyveromyces lactis hypothetical protein, hypothetical
           start
          Length = 141

 Score = 26.2 bits (56), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 13/28 (46%)

Query: 109 ACHFPGCGQRFSRHDNCLQHYRTHLKRT 136
           A  F   G   S   N LQ Y+THL  T
Sbjct: 26  AVQFQSQGMEESMDYNVLQQYQTHLNNT 53

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 26.6 bits (57), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEK 106
           R H C  C +GF  S  L RH + H  ++
Sbjct: 152 RPHKCDICSRGFARSNDLQRHKKRHWKDE 180

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 26.2 bits (56), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 21/47 (44%)

Query: 86  GKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTH 132
           GK F+    L  H  +H+  K   C +  C + ++   N  +H + H
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.134    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,305,746
Number of extensions: 93228
Number of successful extensions: 757
Number of sequences better than 10.0: 207
Number of HSP's gapped: 587
Number of HSP's successfully gapped: 312
Length of query: 138
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 47
Effective length of database: 13,445,871
Effective search space: 631955937
Effective search space used: 631955937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 56 (26.2 bits)