Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR030C32431817060.0
KLLA0F18546g37532013080.0
Sklu_2357.834131612841e-179
Kwal_27.1093534431212661e-176
YDR044W (HEM13)32831212511e-174
CAGL0K12100g32731611771e-163
Scas_569.333331711141e-153
Kwal_23.436473777750.23
Scas_694.2131364700.78
KLLA0D02376g20775625.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR030C
         (318 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   661   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   508   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         499   e-179
Kwal_27.10935                                                         492   e-176
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   486   e-174
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   457   e-163
Scas_569.3                                                            433   e-153
Kwal_23.4364                                                           33   0.23 
Scas_694.21                                                            32   0.78 
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...    28   5.4  

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWERKEGGGGTSCVLQHGTTF 60
           MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWERKEGGGGTSCVLQHGTTF
Sbjct: 1   MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWERKEGGGGTSCVLQHGTTF 60

Query: 61  EKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAAGVRFFACGISLVMHPVNP 120
           EKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAAGVRFFACGISLVMHPVNP
Sbjct: 61  EKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAAGVRFFACGISLVMHPVNP 120

Query: 121 HAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPAL 180
           HAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPAL
Sbjct: 121 HAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPAL 180

Query: 181 YPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLR 240
           YPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLR
Sbjct: 181 YPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLR 240

Query: 241 RKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDH 300
           RKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDH
Sbjct: 241 RKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDH 300

Query: 301 HPAEGTREAALLEVLRHP 318
           HPAEGTREAALLEVLRHP
Sbjct: 301 HPAEGTREAALLEVLRHP 318

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 233/320 (72%), Positives = 270/320 (84%), Gaps = 3/320 (0%)

Query: 1   MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTT 59
           M  +  P +RERME LVRRKQ+EIT   E +DTVKF+ADSW+R   GGGG S VLQ+GTT
Sbjct: 53  MTDSQVP-IRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTT 111

Query: 60  FEKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQP-AAGVRFFACGISLVMHPV 118
           FEK GVNVSVVHG LSP A+ AM+A+HKNLHLP DP TG+P A GV+FFACG+S+V+HP+
Sbjct: 112 FEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPI 171

Query: 119 NPHAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDP 178
           NPHAPT HLNYRYFETW+A G PQ WWFGGG+DLTPSYLYEEDA+LFH  HK ALD+TD 
Sbjct: 172 NPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDV 231

Query: 179 ALYPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIM 238
           ALYP++KKWCDEYF+IKHR E+RGIGGIF+DD DDR+P  +L+M E+C DAF+P+Y  I+
Sbjct: 232 ALYPKYKKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAFLPSYLEII 291

Query: 239 LRRKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEY 298
            RRKDMPYT  E +WQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTA W Y
Sbjct: 292 KRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLY 351

Query: 299 DHHPAEGTREAALLEVLRHP 318
           DHHP   +RE  LL+VL++P
Sbjct: 352 DHHPEVDSREDKLLQVLKNP 371

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  499 bits (1284), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 230/316 (72%), Positives = 266/316 (84%), Gaps = 3/316 (0%)

Query: 5   HTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKA 63
           H P +R++ME+L+ RKQ+EIT   E +DTVKF+ADSW R  +GGGGTS VLQ+GTTFEK 
Sbjct: 23  HLP-IRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQNGTTFEKG 81

Query: 64  GVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHA 122
           GVN SVV+G+LSP A+SAMR +HKNLHLP DP TG+P A GV FFACG+S+V+HP NPHA
Sbjct: 82  GVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVIHPHNPHA 141

Query: 123 PTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYP 182
           PT HLNYRYFETW+  G PQ WWFGGG+DLTPSYLYEEDA LFH  HK ALD+ D  LYP
Sbjct: 142 PTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDKHDTDLYP 201

Query: 183 RFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRK 242
           RFKKWCDEYF+I HRGE+RGIGGIF+DD DDR+P+ +L++ EDC DAF+P+Y TI+ RRK
Sbjct: 202 RFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFDAFLPSYLTIVARRK 261

Query: 243 DMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHP 302
           DMPYT  E +WQ +RRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTA W YDHHP
Sbjct: 262 DMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHP 321

Query: 303 AEGTREAALLEVLRHP 318
             G+RE  LLEVL+HP
Sbjct: 322 DAGSREDQLLEVLKHP 337

>Kwal_27.10935
          Length = 344

 Score =  492 bits (1266), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 228/312 (73%), Positives = 264/312 (84%), Gaps = 2/312 (0%)

Query: 9   MRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKAGVNV 67
           +R++MEEL+RRKQREIT   E +DTVKF+ DSW R  +GGGGTS VLQ+GTTFEK GVNV
Sbjct: 29  IRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQNGTTFEKGGVNV 88

Query: 68  SVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHAPTVH 126
           SVV+G+LSPAA+SAM+ +HKNL LPTDP TG P A GV+FFACG+S+V+HP NPHAPT H
Sbjct: 89  SVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVIHPSNPHAPTTH 148

Query: 127 LNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYPRFKK 186
           LNYRYFETW+  G PQTWWFGGG+DLTPSYLYEEDARLFH  HK ALD+ D +LYPR+KK
Sbjct: 149 LNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDKHDTSLYPRYKK 208

Query: 187 WCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRKDMPY 246
           WCDEYF+IKHR E+RGIGGIF+DD DDR+P+ +L + EDC DAF+P+Y  I+ RRKDMP+
Sbjct: 209 WCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAFLPSYLPIIARRKDMPF 268

Query: 247 TAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHPAEGT 306
           T  E +WQ IRRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSLPVTA W YDHHP  G+
Sbjct: 269 TEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTACWFYDHHPEPGS 328

Query: 307 REAALLEVLRHP 318
           RE  LL+VL  P
Sbjct: 329 REEKLLKVLESP 340

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 261/312 (83%), Gaps = 2/312 (0%)

Query: 9   MRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKAGVNV 67
           +R++ME L+RRKQ EIT   E+IDTVKF AD+W R  +GGGGTS V+Q GTTFEK GVNV
Sbjct: 12  IRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQDGTTFEKGGVNV 71

Query: 68  SVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHAPTVH 126
           SVV+G+LSPAAVSAM+A+HKNL LP DP TG P   GV+FFACG+S+V+HPVNPHAPT H
Sbjct: 72  SVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAPTTH 131

Query: 127 LNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYPRFKK 186
           LNYRYFETW+  G PQTWWFGGG+DLTPSYLYEED +LFH  HK ALD+ D ALYPRFKK
Sbjct: 132 LNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDKHDTALYPRFKK 191

Query: 187 WCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRKDMPY 246
           WCDEYF+I HR E+RGIGGIF+DD D+R+P+ +L+M EDC DAF+P+Y TI+ RRKDMPY
Sbjct: 192 WCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPY 251

Query: 247 TAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHPAEGT 306
           T  E +WQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  A W Y+HHPA G+
Sbjct: 252 TKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAPGS 311

Query: 307 REAALLEVLRHP 318
           REA LLEV   P
Sbjct: 312 REAKLLEVTTKP 323

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  457 bits (1177), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 257/316 (81%), Gaps = 4/316 (1%)

Query: 5   HTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKA 63
           H P +R++ME L+RRKQ+EIT   E+IDTVKF AD+WER  +GGGGTS V+Q+G+TFEK 
Sbjct: 9   HLP-IRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQNGSTFEKG 67

Query: 64  GVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHA 122
           GVNVSVV+GEL+P AV AM+ EHK+L LP +   G P + GV+FFACG+S+V+HPVNP A
Sbjct: 68  GVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVIHPVNPLA 126

Query: 123 PTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYP 182
           PT HLNYRYFETW+  G PQTWWFGGG+DLTP YL+EEDA  FH  HKAALD+ D ALYP
Sbjct: 127 PTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKHDTALYP 186

Query: 183 RFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRK 242
           RFKKWCDEYF+I HRGE+RGIGGIF+DD ++++P+ +L++ EDC DAF+P+Y TIM RRK
Sbjct: 187 RFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLTIMKRRK 246

Query: 243 DMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHP 302
           D+PY   +  WQ IRRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ A W Y+HHP
Sbjct: 247 DLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASWVYNHHP 306

Query: 303 AEGTREAALLEVLRHP 318
             G+ EA LLEV   P
Sbjct: 307 EPGSEEAKLLEVTTKP 322

>Scas_569.3
          Length = 333

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/317 (67%), Positives = 256/317 (80%), Gaps = 3/317 (0%)

Query: 4   AHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEK 62
            H P +R++ME L+RRKQ EIT   E++DTVKF ADSW R  +GGGGTS V+ +G+TFEK
Sbjct: 14  THLP-IRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIANGSTFEK 72

Query: 63  AGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPH 121
            GVNVSVV+G L+P AV AM+ +HKNL LP DP TG P   GV+FFACG+S+V+HP NPH
Sbjct: 73  GGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVIHPKNPH 132

Query: 122 APTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALY 181
           APT HLNYRYFETW+  G PQ+WWFGGG+DLTP YLYEEDA+ FH  HK ALD+ D  LY
Sbjct: 133 APTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDKHDKTLY 192

Query: 182 PRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRR 241
           P++KKWCDEYF+I HR E+RGIGGIF+DD DDR+P+ +L++ EDC DAF+P+Y  I+ +R
Sbjct: 193 PKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPSYLPIIEKR 252

Query: 242 KDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHH 301
           KDMPYT  E +WQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  A W Y+HH
Sbjct: 253 KDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHH 312

Query: 302 PAEGTREAALLEVLRHP 318
           PA G+REA LLEV  +P
Sbjct: 313 PAPGSREAKLLEVTTNP 329

>Kwal_23.4364
          Length = 737

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 26/77 (33%), Gaps = 3/77 (3%)

Query: 136 DAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYPRFKKWCDEYFWIK 195
           D  G  Q+W       L P   YE   R+F     A L R            CD + W+ 
Sbjct: 533 DVVGLLQSWLLELPDSLIPMPCYE---RVFQGQGIAGLRRAPQVHLTNLAAMCDHFHWLA 589

Query: 196 HRGESRGIGGIFYDDAD 212
              ES  I   F D  D
Sbjct: 590 SHCESDHINHAFGDRTD 606

>Scas_694.21
          Length = 313

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 30  AIDTVKFKADSWERKEGGGGTSCVLQHGTTFEKAGVNVSVVHGELSPAAVSAMRAEHKNL 89
           A+ T K     W+   G G  + +L+      + G+++ V   ++SPAA+   R   K L
Sbjct: 104 AMQTKKPILTIWDLCTGSGCIALLLRK--ELSQQGIDLEVTAVDVSPAAIQLTRENSKKL 161

Query: 90  HLPT 93
            +P 
Sbjct: 162 KIPI 165

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 18/75 (24%)

Query: 122 APTVHLNYRY------FETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDR 175
           + T+ L+  Y      FE WD AG+ +         L P Y    +A L         D 
Sbjct: 42  SQTIKLSEEYDEQVLKFEIWDTAGQERY------KSLAPMYYRNANAAL------VVYDV 89

Query: 176 TDPALYPRFKKWCDE 190
           T+P   P+ K W DE
Sbjct: 90  TEPDSLPKAKLWVDE 104

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,600,447
Number of extensions: 449688
Number of successful extensions: 837
Number of sequences better than 10.0: 12
Number of HSP's gapped: 825
Number of HSP's successfully gapped: 12
Length of query: 318
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 216
Effective length of database: 13,065,073
Effective search space: 2822055768
Effective search space used: 2822055768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)