Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR029W1121105961e-81
KLLA0F18568g1121105153e-69
YDR045C (RPC11)1101104823e-64
Scas_569.4*1101104754e-63
Sklu_2357.91021004641e-61
Kwal_27.109391101104572e-60
CAGL0H08415g1001004206e-55
Scas_673.30*1481221292e-10
AFR417W1251201152e-08
YJR063W (RPA12)125411134e-08
Kwal_27.9972125411118e-08
Sklu_2119.41251271091e-07
KLLA0D03234g1221111091e-07
Scas_621.15307341131e-07
KLLA0F09361g292681131e-07
Sklu_2213.5287341122e-07
YGL043W (DST1)309341122e-07
CAGL0D06160g306341122e-07
Kwal_26.7521301341122e-07
KLLA0B13860g1601201083e-07
AGR011W304341103e-07
CAGL0F00561g1281241022e-06
Kwal_56.240541221111003e-06
YGL070C (RPB9)122111985e-06
CAGL0H03509g122111986e-06
Scas_720.22*122111969e-06
AFL088W122111916e-05
Sklu_1830.3110101750.009
Scas_238.163131670.24
KLLA0C09735g78448602.1
KLLA0F07623g122959592.8
KLLA0E00286g50233575.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR029W
         (110 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   234   1e-81
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   202   3e-69
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   190   3e-64
Scas_569.4*                                                           187   4e-63
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      183   1e-61
Kwal_27.10939                                                         180   2e-60
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   166   6e-55
Scas_673.30*                                                           54   2e-10
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    49   2e-08
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    48   4e-08
Kwal_27.9972                                                           47   8e-08
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         47   1e-07
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    47   1e-07
Scas_621.15                                                            48   1e-07
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    48   1e-07
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            48   2e-07
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    48   2e-07
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    48   2e-07
Kwal_26.7521                                                           48   2e-07
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    46   3e-07
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    47   3e-07
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    44   2e-06
Kwal_56.24054                                                          43   3e-06
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    42   5e-06
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    42   6e-06
Scas_720.22*                                                           42   9e-06
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    40   6e-05
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         33   0.009
Scas_238.1                                                             30   0.24 
KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyce...    28   2.1  
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    27   2.8  
KLLA0E00286g 17100..18608 weakly similar to sp|Q8D522 Vibrio vul...    27   5.5  

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  234 bits (596), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60
           MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA
Sbjct: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60

Query: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR
Sbjct: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  202 bits (515), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 90/110 (81%), Positives = 99/110 (90%)

Query: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60
           MLSFCP CNNML VSK DSG+Y+L C SCPY+F I+G+E+YDR+NLPRKEVDDVLGGEGA
Sbjct: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60

Query: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           WDNVDQTA QCP H+ C GE+AYFFQLQIRSADEPMTTFYKCV CGHKWR
Sbjct: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  190 bits (482), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 95/110 (86%), Gaps = 2/110 (1%)

Query: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60
           MLSFCP CNNML ++ GDSGVY L C SCPYEFPIEG+EIYDR+ LPRKEVDDVLG  G 
Sbjct: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLG--GG 58

Query: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           WDNVDQT  QCP ++TCGGE AYFFQLQIRSADEPMTTFYKCV CGH+W+
Sbjct: 59  WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWK 108

>Scas_569.4*
          Length = 110

 Score =  187 bits (475), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 93/110 (84%), Gaps = 2/110 (1%)

Query: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60
           MLSFCP CNNML ++  DSGVY L C SCPYEFPIEG+EIYDR+ LPRKEVDDVLGG   
Sbjct: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--G 58

Query: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           WDNVDQT VQCP +E CGGE AYFFQLQIRSADEPMTTFYKCV C H+W+
Sbjct: 59  WDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  183 bits (464), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%)

Query: 11  MLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGAWDNVDQTAVQ 70
           ML ++  D+G+Y+L CPSCPYEFPIEG+E+YDR+ L RKEVDDVLGGEGAWDNVDQT  Q
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 71  CPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           CP H+ CGG KAYFFQLQIRSADEPMTTFYKCVTCGHKWR
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100

>Kwal_27.10939
          Length = 110

 Score =  180 bits (457), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 2/110 (1%)

Query: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60
           MLSFCP C+NML VS  +SG Y L C SCPY FPIEGVE+YDR+ LPRKEVDDVLGG   
Sbjct: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--G 58

Query: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           WDNVDQTAVQCP ++ C GE+AYFFQLQIRSADEPMTTFYKCV+CG++WR
Sbjct: 59  WDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWR 108

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  166 bits (420), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 84/100 (84%), Gaps = 2/100 (2%)

Query: 11  MLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGAWDNVDQTAVQ 70
           ML V+  D+GVY L C SCPYEFPIE +EIYDR+ LPRKEVDDVLGG   WDNVDQT VQ
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58

Query: 71  CPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           CP ++TCGGE AYFFQLQIRSADEPMTTFYKCV C H+W+
Sbjct: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98

>Scas_673.30*
          Length = 148

 Score = 54.3 bits (129), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 2   LSFCPYCNNML--PVSKGDSGVYRLGCPSCPYEFP------IEGVEIYDRRNLPR--KEV 51
           L FC  C N+L  P   G S    + C  C  ++P      ++ V        P   +  
Sbjct: 27  LIFCLDCGNLLDTPHQTGSSKHDDIECSQCQAKYPKSEFSNLKVVTATAEDAFPSALRSK 86

Query: 52  DDVLGGEGAWDNVDQTAV---QCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHK 108
             V+      D +++ AV   +CPQ   CG ++ ++  LQ+RSADE  T FY C  CG+K
Sbjct: 87  KSVVKTTLKKDELEEGAVIKEKCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTKCGYK 143

Query: 109 WR 110
           +R
Sbjct: 144 FR 145

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 48.9 bits (115), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 15/120 (12%)

Query: 2   LSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFP------IEGVEIYDRRNLP-----RKE 50
           L FC YC N+L      +G + + C  C  ++       ++ V        P     ++ 
Sbjct: 7   LIFCVYCGNLLDNPSAVAGDH-VACALCDAQYDKATFSNLKVVTATADDAFPSALRAKRS 65

Query: 51  VDDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           V      +G  ++      +CPQ   CG ++  +  LQ+RSADE  T FY C +CG+++R
Sbjct: 66  VVKTTLRKGELEDGATIREKCPQ---CGHDEMQYHTLQLRSADEGATVFYTCTSCGYRFR 122

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 48.1 bits (113), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 3/41 (7%)

Query: 70  QCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           +CPQ   CG E+  +  LQ+RSADE  T FY C +CG+K+R
Sbjct: 85  KCPQ---CGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR 122

>Kwal_27.9972
          Length = 125

 Score = 47.4 bits (111), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%), Gaps = 3/41 (7%)

Query: 70  QCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           +CPQ   CG ++ ++  LQ+RSADE  T FY C +CG+++R
Sbjct: 85  KCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 46.6 bits (109), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 54/127 (42%), Gaps = 29/127 (22%)

Query: 2   LSFCPYCNNML----PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDD---- 53
           L FC  C N+L     VS  D     + C  C   +P      +    +     DD    
Sbjct: 7   LIFCLDCGNLLDNPSTVSSPD-----IECSQCQATYPKSK---FSNLKVVTSTADDAFPS 58

Query: 54  -------VLGGEGAWDNVDQTAV---QCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCV 103
                  V+      D +D+ A    +CPQ   CG ++  +  LQ+RSADE  T FY C 
Sbjct: 59  TLRSKKSVVKTSLKKDELDEGATIKEKCPQ---CGNDEMRYHTLQLRSADEGATVFYTCT 115

Query: 104 TCGHKWR 110
           +CG+++R
Sbjct: 116 SCGYRFR 122

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 46.6 bits (109), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    ++      C +CPY     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKETHKLLFECRTCPY-VEEAGTPLVYRHELKTNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C   +  FFQ Q R  D  M  FY C+ C H +
Sbjct: 63  GSDPTLPRSDKECPK---CHSRENVFFQSQQRRKDTSMVLFYVCLHCSHIF 110

>Scas_621.15
          Length = 307

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 272 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 43  RRNLPRKEVDDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKC 102
           ++ +   E  ++   +GA   V+++     Q   C   K  ++QLQ RSADEP+TTF  C
Sbjct: 225 KKKIEEIEKQNLFNAQGA--TVERSVTDRFQCGKCKQRKVSYYQLQTRSADEPLTTFCTC 282

Query: 103 VTCGHKWR 110
             CG++W+
Sbjct: 283 ENCGNRWK 290

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 252 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 271 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>Kwal_26.7521
          Length = 301

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 266 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 46.2 bits (108), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 2   LSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFP------IEGVEIYDRRNLPRK--EVDD 53
           L FC  C ++L   +   G  R  C  C   +       ++ V   + ++ P K      
Sbjct: 43  LIFCLECGDLLDGQESSQGKIR--CNQCNASYNSSKFQNLKVVTSTNDKSFPSKIRSKKS 100

Query: 54  VLGGEGAWDNVDQTAV---QCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           ++    A + +   A+   +CP+   C  +K ++  LQ+RSADE  T FY C  CG+++R
Sbjct: 101 LVKTSIAKNELKDGAIINEKCPK---CANDKMHYHTLQLRSADEGATVFYTCTACGYRFR 157

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 77  CGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 110
           C  +K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 269 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 43.9 bits (102), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 55/124 (44%), Gaps = 20/124 (16%)

Query: 2   LSFCPYCNNML--PVSK-GDSGVYRLGCPSCPYEFP---IEGVEIYDRRN---------L 46
           L FC  C N+L  P  K  +S V  + C  C  E+       +++    +         L
Sbjct: 7   LIFCDDCGNLLDNPEDKINNSNV--IECSQCQAEYAKSQFTNLKVVTSTSEDAFPSSLRL 64

Query: 47  PRKEVDDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCG 106
            R  V   L  +   D+      +CP+   CG ++  +  LQ+RSADE  T FY C+ C 
Sbjct: 65  KRSVVKTHLKRDELKDDGATIKEKCPK---CGHDEMRYQTLQLRSADEGATVFYTCIKCN 121

Query: 107 HKWR 110
           +K+R
Sbjct: 122 YKYR 125

>Kwal_56.24054
          Length = 122

 Score = 43.1 bits (100), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    D+      C +C Y     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKDNQRLLFECRTCTYA-EEAGTPMVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C   +  FFQ Q R +D  M  F+ C+ C H +
Sbjct: 63  GSDPTLPRSDRECPK---CHSHENVFFQSQQRRSDTSMVLFFVCLGCSHIF 110

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 42.4 bits (98), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    ++      C +C Y     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSY-VEEAGSPLVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C   +  FFQ Q R  D  M  F+ C++C H +
Sbjct: 63  GSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIF 110

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 42.4 bits (98), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    ++      C +C Y     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSY-IEEAGSPLVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C   +  FFQ Q R  D  M  F+ C+ C H +
Sbjct: 63  GSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLACSHIF 110

>Scas_720.22*
          Length = 122

 Score = 41.6 bits (96), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    ++      C +C Y     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSY-VEEAGAPLVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 63  GSDPTLPRSDRECPR---CHARDNVFFQSQQRRKDTSMVLFFVCLQCSHIF 110

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 39.7 bits (91), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 44/111 (39%), Gaps = 7/111 (6%)

Query: 2   LSFCPYCNNML-PVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGE 58
             FC  CNNML P    +       C +C Y     G  +  R  L     E   V+   
Sbjct: 4   FRFCRDCNNMLYPREDKEEQRLLFECRTCTYA-EEAGTPLVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
           G+   + ++  +CP+   C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 63  GSDPTLPRSDRECPR---CHSHDNVFFQSQQRRRDTSMVLFFVCLGCSHIF 110

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 33.5 bits (75), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 40/101 (39%), Gaps = 6/101 (5%)

Query: 11  MLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRK--EVDDVLGGEGAWDNVDQTA 68
           + P    D+      C +C Y     G  +  R  L     E   V+   G+   + ++ 
Sbjct: 2   LYPREDKDNQRLLFECRTCTYA-EEAGTPLVYRHELITNIGETAGVVQDIGSDPTLPRSD 60

Query: 69  VQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKW 109
            +CP+   C   +  FFQ Q R  D  M  F+ C+ C H +
Sbjct: 61  RECPK---CHSHENVFFQSQQRRKDTSMVLFFVCLACSHIF 98

>Scas_238.1
          Length = 631

 Score = 30.4 bits (67), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 41  YDRRNLPRKEVDDVLG-GEGAWDNVDQTAVQ 70
           ++ R LP++ +D+V+   EG WD +D+T+ Q
Sbjct: 483 FEVRILPKQRMDEVISTDEGVWDLIDETSKQ 513

>KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyces
           cerevisiae YOR256c, start by similarity
          Length = 784

 Score = 27.7 bits (60), Expect = 2.1,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 13/48 (27%)

Query: 52  DDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTF 99
           +++ G EGAW+ V  T +             Y +++ +R  DEP+  F
Sbjct: 592 EEIKGTEGAWEQVADTLI-------------YTYEMLLRLIDEPLLPF 626

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
           cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 27.3 bits (59), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 30/59 (50%)

Query: 45  NLPRKEVDDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCV 103
           NL    +++V+GGEG   +    +++ PQ     G+K+  F+ Q+   +    + ++ V
Sbjct: 544 NLEDYSIENVVGGEGLQYDTKNFSMKEPQEVDGTGKKSVKFEHQLPDVESISKSLWQVV 602

>KLLA0E00286g 17100..18608 weakly similar to sp|Q8D522 Vibrio
           vulnificus Arylsulfatase A, start by similarity
          Length = 502

 Score = 26.6 bits (57), Expect = 5.5,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 27  PSCPYEFPIEGVEIYDRRNLP-RKEVDDVLGGE 58
           P CP+E   +   +Y R ++P R +++   GGE
Sbjct: 200 PHCPFEVEEKWYNMYSREDVPARVKIETKTGGE 232

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.141    0.480 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,855,021
Number of extensions: 147388
Number of successful extensions: 298
Number of sequences better than 10.0: 35
Number of HSP's gapped: 293
Number of HSP's successfully gapped: 35
Length of query: 110
Length of database: 16,596,109
Length adjustment: 80
Effective length of query: 30
Effective length of database: 13,826,669
Effective search space: 414800070
Effective search space used: 414800070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)