Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR028C57956827610.0
Kwal_27.1094159546812701e-169
YBR060C (ORC2)62040111041e-144
CAGL0H10230g51440810731e-141
Scas_718.4773043310361e-132
KLLA0F18590g5964569081e-115
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR028C
         (568 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...  1068   0.0  
Kwal_27.10941                                                         493   e-169
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...   429   e-144
CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...   417   e-141
Scas_718.47                                                           403   e-132
KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...   354   e-115

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score = 1068 bits (2761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/568 (91%), Positives = 522/568 (91%)

Query: 1   MRAREIFSARRGPAWSGAEPRMDGQDAEAGAPADIVAHADLGVXXXXXXXXXXKFLRFYX 60
           MRAREIFSARRGPAWSGAEPRMDGQDAEAGAPADIVAHADLGV          KFLRFY 
Sbjct: 1   MRAREIFSARRGPAWSGAEPRMDGQDAEAGAPADIVAHADLGVAPAGAGAPSSKFLRFYR 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXVDSSVDEGATAVPSSRDAAKEESPRRKQPVRVPQTPA 120
                                  VDSSVDEGATAVPSSRDAAKEESPRRKQPVRVPQTPA
Sbjct: 61  AATARSRGASGRRGRASPRRGGAVDSSVDEGATAVPSSRDAAKEESPRRKQPVRVPQTPA 120

Query: 121 KLAAPALEADDSDGFVTARSTPLRSPRRQLTFXXXXXXXXXXXXQDVLLAQVPSFKLDPG 180
           KLAAPALEADDSDGFVTARSTPLRSPRRQLTF            QDVLLAQVPSFKLDPG
Sbjct: 121 KLAAPALEADDSDGFVTARSTPLRSPRRQLTFSSPSKSPRKTRKQDVLLAQVPSFKLDPG 180

Query: 181 FVPAAVPKGYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRLLS 240
           FVPAAVPKGYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRLLS
Sbjct: 181 FVPAAVPKGYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRLLS 240

Query: 241 GALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLSPKL 300
           GALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLSPKL
Sbjct: 241 GALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLSPKL 300

Query: 301 ALSGAPEGADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHAETKYWHNHVHLQI 360
           ALSGAPEGADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHAETKYWHNHVHLQI
Sbjct: 301 ALSGAPEGADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHAETKYWHNHVHLQI 360

Query: 361 QKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHIHAPLL 420
           QKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHIHAPLL
Sbjct: 361 QKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHIHAPLL 420

Query: 421 WYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAARYVLASLTANSKR 480
           WYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAARYVLASLTANSKR
Sbjct: 421 WYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAARYVLASLTANSKR 480

Query: 481 LFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEMSLRSMLRE 540
           LFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEMSLRSMLRE
Sbjct: 481 LFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEMSLRSMLRE 540

Query: 541 FVEHKMAHLAKDKAGQEIVYVNYSFGEM 568
           FVEHKMAHLAKDKAGQEIVYVNYSFGEM
Sbjct: 541 FVEHKMAHLAKDKAGQEIVYVNYSFGEM 568

>Kwal_27.10941
          Length = 595

 Score =  493 bits (1270), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 325/468 (69%), Gaps = 28/468 (5%)

Query: 116 PQTPAKLAAPALEADDSDGFVTARSTPLRSPRRQLTFXXXXXXXXXXXXQDVLLAQVP-S 174
           PQ P KL    LE      FVTA S+P++S                      +L Q P  
Sbjct: 131 PQGPRKLTK--LEPVPESEFVTANSSPIKS--------SHVFSSPAKSPSKPVLKQSPFK 180

Query: 175 FKLDPGFVPAAVPK--GYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVS 232
            +LD  FVP  +P    Y+ P++++LTYFFDGFEGYIDQKKP+RAH+KS N+MA+AP V+
Sbjct: 181 IQLDRHFVPTPIPHEGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVT 240

Query: 233 RDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLV 292
           R+EF LLS  L   +H+  +  L   Q+++FPQYWFE+ QGF+LLFYG+GSKR FLE  V
Sbjct: 241 REEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFV 300

Query: 293 FEYLSPKLALSGA------------PEGADVEGVPCVVINGFNPACNYRDCFQSIAAYML 340
            +YLSP+LALS A             E ++++GVPCVVING+NP CNYRD F SI+  M+
Sbjct: 301 LQYLSPQLALSDALNFGTAEDSEAIDEESEIDGVPCVVINGYNPTCNYRDAFHSISQIMM 360

Query: 341 PDELRHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSL 400
            +EL  +ETKYW NHV LQI KM+E +   PP ++++VLVHNLDGPM+RKDPFQ MLSSL
Sbjct: 361 QEELSKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSL 420

Query: 401 ARIRQIAIVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQ 460
           +R+RQIA++AS D+++APLLW  +RAQ +NF+FHD+TNY+ YA+E++F + ++L RS   
Sbjct: 421 SRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGT 480

Query: 461 AGSIDAARYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQ 520
            G+ + ARYVL SLT+NSKR+++LL+ET ++NM S    K   ++R   +FG+ F  FY 
Sbjct: 481 TGA-EGARYVLESLTSNSKRMYKLLIETQLSNMDSQG--KAVANKRGSHAFGIEFKQFYH 537

Query: 521 ACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEM 568
            CAA F+ASNE+SLRSML EF+EHKMA +++D+ G E +Y+ Y   EM
Sbjct: 538 MCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEM 585

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score =  429 bits (1104), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/401 (48%), Positives = 281/401 (70%), Gaps = 12/401 (2%)

Query: 177 LDPGFVPAAVPKG---YRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSR 233
           L   F P  VPK    Y+  E ++ + F D FEGY DQ+K +R + KSR++M++AP V+R
Sbjct: 212 LSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTR 271

Query: 234 DEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVF 293
           +EF L+S   N    + PR  L   Q+++FPQYWFE+ QGF+LLFYG+GSKR FLE    
Sbjct: 272 EEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAI 331

Query: 294 EYLSPKLALSGAP------EGADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHA 347
           +YLSPK+A S         +   V  +PC+++NG+NP+CNYRD F+ I   ++P EL  +
Sbjct: 332 DYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRS 391

Query: 348 ETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIA 407
           ETKYW NHV LQIQKM++ +  QP  ++++++VHNLDGP +RK+ FQ MLS L+ IRQIA
Sbjct: 392 ETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIA 451

Query: 408 IVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAA 467
           IVAS DHI+APLLW +++AQ YNFVFHD++N+EP  +E+ FQ+ +++ +S+  +G+ + A
Sbjct: 452 IVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGA-EGA 510

Query: 468 RYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFV 527
           +YVL SLT NSK++++LL+ET + NM +      T  +R     GV    F   CAA F+
Sbjct: 511 KYVLQSLTVNSKKMYKLLIETQMQNMGNLS--ANTGPKRGTQRTGVELKLFNHLCAADFI 568

Query: 528 ASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEM 568
           ASNE++LRSMLREF+EHKMA++ K+ +G EI++V Y++ E+
Sbjct: 569 ASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAEL 609

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score =  417 bits (1073), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 281/408 (68%), Gaps = 15/408 (3%)

Query: 175 FKLDPGFVPAAVPKG---YRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSV 231
            KL   FV   VP+     +L  +R +T F D FEGY +QK+ +R  K S+NS+ +AP V
Sbjct: 98  LKLSRDFVNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHV 157

Query: 232 SRDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETL 291
           +R+EF L+S   +  +H+  R  L   Q++L+PQYWFEV+QGF+LLFYGIGSK+ FLE  
Sbjct: 158 TREEFGLISNIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDF 217

Query: 292 VFEYLSPKLALSGAPE-------GADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDEL 344
           VF+YLSPKLALS A E        +  EG+P VV+NG+NP CNYRD F+ I + + P EL
Sbjct: 218 VFKYLSPKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAEL 277

Query: 345 RHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIR 404
             +E+K+W NHV + IQK+++++  +P  ++++V +HN+DGP +R+     +LS L+ IR
Sbjct: 278 TQSESKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIR 337

Query: 405 QIAIVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSI 464
           Q+AIVAS DHI+AP LW +LRAQ YNFVFHDVTNY PY  E++FQ+ +RL +SE   G+ 
Sbjct: 338 QVAIVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGA- 396

Query: 465 DAARYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTN----SRRAGISFGVPFSAFYQ 520
           + A+YVL SLT NSK++++LL+ET + +M+     K T     S+R  +S GV F     
Sbjct: 397 EGAKYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVH 456

Query: 521 ACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEM 568
            CAA F+ASNEM+LRSML EF+EHKMA ++K+  G E V+V Y++ EM
Sbjct: 457 LCAADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEM 504

>Scas_718.47
          Length = 730

 Score =  403 bits (1036), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/433 (45%), Positives = 285/433 (65%), Gaps = 35/433 (8%)

Query: 165 QDVLLAQVPSFKLDPGFVPAAVPKGYRL------PEDRNLTYFFDGFEGYIDQKKPIRAH 218
           +D LL+      L+  FVP  VPK  +        E+++   FFD FEGY DQ    R+H
Sbjct: 292 EDSLLSS-KKLVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQ----RSH 346

Query: 219 ------KKSRNSMAIAPSVSRDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQ 272
                 K S+N+M++ PSVS+DEF + +   N    + PRA L   Q+++FPQYWFE+ Q
Sbjct: 347 SLKYTTKLSKNTMSMGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQ 406

Query: 273 GFTLLFYGIGSKRRFLETLVFEYLSPKL------ALSGAPE-------GADVEGVPCVVI 319
           GF+LLFYGIGSKR FLE L  +Y+SPKL      AL    E          ++G+PC++I
Sbjct: 407 GFSLLFYGIGSKRNFLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLII 466

Query: 320 NGFNPACNYRDCFQSIAAYMLPDELRHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVL 379
           NG+NP C+YR+ FQ I   M PD L   ETK+W N   LQ+QKM+E ++ QP  ++++++
Sbjct: 467 NGYNPTCSYREIFQDITDIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILV 526

Query: 380 VHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHIHAPLLWYSLRAQLYNFVFHDVTNY 439
           +HNLDGP LRK+ FQ + SSLA+I+QI ++ASVDHI+AP+L+ + +AQ YNFVFHDVTNY
Sbjct: 527 IHNLDGPALRKEIFQTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNY 586

Query: 440 EPYAIEAAFQESVRLNRSELQAGSIDAARYVLASLTANSKRLFRLLLETVVANMQ----S 495
           E   +E++FQ+ + L +S   +G+ + A+YVL SLT N+K++++LLL+  + NM     S
Sbjct: 587 ESNEVESSFQDKMNLGKSSSSSGA-EGAKYVLESLTLNAKKMYKLLLDLQLNNMDLASGS 645

Query: 496 AKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAG 555
             +   + S+R G+S GV F +F   CA++F+ASNE+SLR+ML EF+EHKM  L++  +G
Sbjct: 646 KNKSASSVSKRGGLSTGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSG 705

Query: 556 QEIVYVNYSFGEM 568
            E +YV Y + EM
Sbjct: 706 TEYLYVPYRYSEM 718

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score =  354 bits (908), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 176/456 (38%), Positives = 278/456 (60%), Gaps = 26/456 (5%)

Query: 137 TARSTPLRSPRRQLTFXX----------XXXXXXXXXXQDVLLAQVPSFK-----LDPGF 181
           +  S+P +SPRR+LTF                       D+    +  +K     L+P F
Sbjct: 131 SNESSPNKSPRRKLTFNAEPSPQRKTTRNTVQRNKIIDDDLAYDDIQQYKHLKLNLNPNF 190

Query: 182 VPAAVPK---GYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRL 238
            P  +PK     +  ++++  YFFDGFEG+IDQ K ++  K+S+NSM+ APS+SRDE+ +
Sbjct: 191 KPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSAPSISRDEYNI 250

Query: 239 LSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLSP 298
           LS   N   H++    +    + LF Q+ FE++QGFTLLFYGIGSK++FLE+  F +LS 
Sbjct: 251 LSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFLESFAFNFLSM 310

Query: 299 KLALSGAPE-GADVEGVPCVVINGFNPACN--YRDCFQSIAAYMLPDELRHAETKYWHNH 355
           K+AL   P+   D   +P  V+NG+       + D F+ +      D+    ++ YW N 
Sbjct: 311 KIALLQNPDIQKDDPCIPVFVMNGYTTLSKNIFLDIFKILVEGETIDD--QGQSNYWDNR 368

Query: 356 VHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHI 415
           + LQ+ ++ +++  +PP V+M++L+HNLDGP  R++ FQ  +S LA+I+QI +VASVDHI
Sbjct: 369 IDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQIKQICVVASVDHI 428

Query: 416 HAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQES-VRLNRSELQAGSIDAARYVLASL 474
            AP LW   RAQ +NFV+HD+TN+EPY +E    ++ +  ++      + + A+YVL SL
Sbjct: 429 QAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANGAKYVLESL 488

Query: 475 TANSKRLFRLLLETVVA--NMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEM 532
           T NSKR++++LL+ ++   N ++  + +  +S    I+ G+ FS  ++ C  QFV S+EM
Sbjct: 489 TDNSKRMYKILLQLLMGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTEQFVVSSEM 548

Query: 533 SLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEM 568
            LR++L EF++HKMA   K+K G+EI+ V YS+G+M
Sbjct: 549 GLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDM 584

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,609,178
Number of extensions: 598709
Number of successful extensions: 1481
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1502
Number of HSP's successfully gapped: 11
Length of query: 568
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 461
Effective length of database: 12,891,983
Effective search space: 5943204163
Effective search space used: 5943204163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)