Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR027C96194446680.0
Sklu_1752.285854515130.0
KLLA0F18612g81453214620.0
Kwal_27.1094593554914230.0
YBR059C (AKL1)110855713891e-175
Scas_661.27109537713611e-171
CAGL0H10208g102736913421e-169
CAGL0K11990g99134712561e-157
Kwal_27.115427913107891e-91
Scas_601.66613137564e-88
Sklu_2226.77953147541e-86
ADL217W7503187414e-85
KLLA0E08371g7773137425e-85
YNL020C (ARK1)6383137222e-83
YIL095W (PRK1)8103137322e-83
CAGL0G02607g6883137224e-83
Scas_671.167233097212e-82
CAGL0J03432g6223076721e-76
CAGL0J11638g7462842529e-22
KLLA0C06138g7082792519e-22
Sklu_2419.96952842492e-21
ACL006W7082832446e-21
Kwal_56.224766972832421e-20
Scas_644.157263012367e-20
Kwal_55.215458652822341e-19
YMR001C (CDC5)7052832332e-19
Kwal_33.131125052882274e-19
YHR102W (KIC1)10802742305e-19
Sklu_1962.23643702217e-19
YAR019C (CDC15)9742862262e-18
Scas_580.610152742234e-18
Scas_700.288961972181e-17
KLLA0E21780g10162762181e-17
ACL104C9472352162e-17
YPL236C3643372092e-17
YDR523C (SPS1)4902822123e-17
Sklu_2419.105662192124e-17
AFL101C3672362059e-17
Kwal_56.242743463382031e-16
Sklu_2361.38843252091e-16
AFR724C4402902042e-16
CAGL0L11550g10722742072e-16
YPL150W9013032055e-16
CAGL0M02299g8933512037e-16
Scas_598.67903002037e-16
ACR196C5301971982e-15
Kwal_47.1726311272901992e-15
KLLA0C00979g4832971944e-15
Kwal_26.735514463081975e-15
AFR696C11422281965e-15
KLLA0F11319g8431941948e-15
ACR133C8512141948e-15
Scas_707.369152221949e-15
Kwal_26.87518481941931e-14
Scas_693.1710492011931e-14
AEL230W6083141911e-14
YDL159W (STE7)5151981902e-14
CAGL0C05005g10762861903e-14
AGR058W10711931893e-14
Kwal_55.203267502011884e-14
Kwal_56.226939841951884e-14
Kwal_23.632515422701886e-14
YNL298W (CLA4)8423081867e-14
ABL034W14252011868e-14
KLLA0C01650g11122281868e-14
KLLA0A07403g8793071851e-13
AFR335C10331951851e-13
Sklu_1995.27292771841e-13
KLLA0A03806g6022921831e-13
CAGL0K02673g9151991832e-13
YER129W (PAK1)11422031832e-13
KLLA0B13112g7302761822e-13
Kwal_47.182335982921812e-13
CAGL0I07513g10762301822e-13
ABR014W9711951822e-13
Kwal_56.237178581931813e-13
CAGL0K02167g11623221813e-13
CAGL0J03872g6611461803e-13
Kwal_23.52908193071803e-13
Scas_660.286232881794e-13
AEL205W7932021804e-13
Scas_685.245152841784e-13
KLLA0C12485g9252301804e-13
Sklu_2323.34001941764e-13
YDR477W (SNF1)6333001785e-13
CAGL0E05720g3582421737e-13
Scas_564.712101921787e-13
Kwal_26.778812672361779e-13
AER264C14832591779e-13
ABL011C7012231761e-12
YOL100W (PKH2)10812321761e-12
Kwal_56.240913811961721e-12
Scas_627.73492321711e-12
YKL101W (HSL1)15182011752e-12
ACL053C11813011752e-12
CAGL0M03729g8612651742e-12
Scas_668.228931961742e-12
KLLA0C04191g7972451742e-12
CAGL0H01639g5211921722e-12
YGL179C (TOS3)5601951722e-12
Scas_544.64892091712e-12
KLLA0B13607g9891951733e-12
Kwal_26.78619551951733e-12
CAGL0M08910g6122941723e-12
Scas_602.1111863581733e-12
KLLA0F19536g11041941733e-12
KLLA0E17127g8522551724e-12
Sklu_2437.1610712261724e-12
CAGL0K05709g11032281724e-12
YDR507C (GIN4)11422281715e-12
YLR096W (KIN2)11471931715e-12
CAGL0K08514g14892301716e-12
Scas_502.211161941698e-12
KLLA0B02332g3611801658e-12
YDR122W (KIN1)10641941681e-11
Kwal_26.87098292011681e-11
YOL113W (SKM1)6552581671e-11
KLLA0F01276g5192361661e-11
Scas_493.211172341671e-11
CAGL0M10153g8671941662e-11
Scas_477.57032001662e-11
CAGL0I03498g4512251642e-11
CAGL0B01925g9441921662e-11
CAGL0M11396g11921931662e-11
Kwal_56.245844351971642e-11
AFR377C7261961652e-11
Sklu_2073.311822171662e-11
YKL048C (ELM1)6402391642e-11
KLLA0C08525g15512231662e-11
Kwal_27.97638682291652e-11
CAGL0G04609g9653401652e-11
YDR490C (PKH1)7662001643e-11
YHL007C (STE20)9391951643e-11
YOR233W (KIN4)8001431643e-11
Scas_616.1014612011644e-11
CAGL0L03520g14472711634e-11
YLR362W (STE11)7172001625e-11
YJL095W (BCK1)14782621635e-11
Scas_640.14*7282401625e-11
Sklu_2366.54661871605e-11
KLLA0F14190g13382581625e-11
CAGL0F03311g10452351626e-11
KLLA0C18568g7742971617e-11
Sklu_2086.42431241537e-11
YCR073C (SSK22)13312231618e-11
CAGL0G09020g3611861578e-11
Scas_675.25272081571e-10
YPL209C (IPL1)3671991551e-10
Scas_548.613821241582e-10
Scas_633.297893621572e-10
KLLA0C03828g7933091572e-10
YAL017W (PSK1)13561241572e-10
KLLA0C16577g5041861552e-10
YCL024W (KCC4)10372281563e-10
Sklu_1603.24882291543e-10
Scas_458.13673021533e-10
YPR054W (SMK1)3882571533e-10
KLLA0D09328g10461991563e-10
AEL284C4792471543e-10
KLLA0E15378g7242561553e-10
AER223C9022281553e-10
AFR092W14232631563e-10
ACR117W5242441544e-10
YDL028C (MPS1)7643151544e-10
ADR300C8902691545e-10
Sklu_1843.34861771525e-10
Scas_643.2010821241545e-10
CAGL0B02739g6761821535e-10
Kwal_27.119192092241456e-10
Scas_700.348642341536e-10
CAGL0F00913g12061231536e-10
Scas_634.57902261527e-10
Sklu_2066.26392571527e-10
YHR205W (SCH9)8242891528e-10
Kwal_47.167617442851528e-10
Kwal_26.715412133001528e-10
AEL185C5153001501e-09
KLLA0F13552g12672011511e-09
YPL203W (TPK2)3802411481e-09
Scas_720.9416832331511e-09
Sklu_2104.12992281461e-09
ACR119W9312831501e-09
KLLA0B09790g2952341461e-09
KLLA0F07623g12291751501e-09
CAGL0H06259g13361241501e-09
YBR274W (CHK1)5271971491e-09
KLLA0A02717g4322631481e-09
CAGL0L05632g6773071492e-09
ADL389W7112851492e-09
ACR281C12591671502e-09
Scas_711.2515152251492e-09
KLLA0D03190g3722551462e-09
Kwal_33.140815802551482e-09
AFL217C6912541482e-09
YNR047W8933161482e-09
YPL140C (MKK2)5061651472e-09
KLLA0B03586g7342891472e-09
ADR058C2952341433e-09
AEL115C3861561453e-09
Kwal_23.566816892021483e-09
Kwal_27.125594141231453e-09
YHR082C (KSP1)10291891473e-09
Kwal_23.35904992791454e-09
YJL128C (PBS2)6683051464e-09
Scas_584.1110741941464e-09
Scas_703.57492901464e-09
ADR313W5781461454e-09
KLLA0D07304g4652431454e-09
YJL187C (SWE1)8192261464e-09
CAGL0H07535g2982131424e-09
YPR161C (SGV1)6572391454e-09
Kwal_26.87034441811444e-09
CAGL0F09075g7462851455e-09
ADR167W8732541455e-09
Scas_649.306482551446e-09
KLLA0E12177g4552281436e-09
Kwal_27.100047351681446e-09
CAGL0C03509g8952541456e-09
AER232C5691991446e-09
Scas_713.79832861456e-09
YPL141C8651911446e-09
YBR160W (CDC28)2982091407e-09
Kwal_55.201898122271447e-09
Scas_640.165052471428e-09
CAGL0M08404g4621471428e-09
YJL164C (TPK1)3971481418e-09
ACR191C11491431448e-09
Scas_629.169182931438e-09
Scas_651.183711871419e-09
AAR009W4532701429e-09
Kwal_33.138463751471419e-09
AER222C4233281419e-09
CAGL0J03828g4671191429e-09
CAGL0M09361g11441431421e-08
CAGL0I08349g6673561411e-08
YOR231W (MKK1)5081631402e-08
KLLA0B07579g7222271412e-08
YFR014C (CMK1)4463501392e-08
Scas_700.354391831392e-08
Sklu_2436.147841941402e-08
Sklu_2429.54322171392e-08
Scas_582.16383081392e-08
CAGL0D01694g4322981382e-08
Scas_690.133542411372e-08
YDR466W (PKH3)8982561393e-08
KLLA0D07348g9091361393e-08
AFR205C4572671373e-08
Kwal_47.183076211891383e-08
KLLA0B07205g4551481373e-08
Kwal_14.14163651931363e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR027C
         (944 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...  1802   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         587   0.0  
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   567   0.0  
Kwal_27.10945                                                         552   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   539   e-175
Scas_661.27                                                           528   e-171
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   521   e-169
CAGL0K11990g complement(1155395..1158370) some similarities with...   488   e-157
Kwal_27.11542                                                         308   1e-91
Scas_601.6                                                            295   4e-88
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          295   1e-86
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   290   4e-85
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   290   5e-85
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   282   2e-83
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   286   2e-83
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   282   4e-83
Scas_671.16                                                           282   2e-82
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   263   1e-76
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   101   9e-22
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   101   9e-22
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                         100   2e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    99   6e-21
Kwal_56.22476                                                          98   1e-20
Scas_644.15                                                            96   7e-20
Kwal_55.21545                                                          95   1e-19
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    94   2e-19
Kwal_33.13112                                                          92   4e-19
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    93   5e-19
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          90   7e-19
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    92   2e-18
Scas_580.6                                                             91   4e-18
Scas_700.28                                                            89   1e-17
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    89   1e-17
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    88   2e-17
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    85   2e-17
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    86   3e-17
Sklu_2419.10 , Contig c2419 14439-16135                                86   4e-17
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    84   9e-17
Kwal_56.24274                                                          83   1e-16
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            85   1e-16
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    83   2e-16
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    84   2e-16
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    84   5e-16
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    83   7e-16
Scas_598.6                                                             83   7e-16
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    81   2e-15
Kwal_47.17263                                                          81   2e-15
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    79   4e-15
Kwal_26.7355                                                           80   5e-15
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    80   5e-15
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    79   8e-15
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    79   8e-15
Scas_707.36                                                            79   9e-15
Kwal_26.8751                                                           79   1e-14
Scas_693.17                                                            79   1e-14
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    78   1e-14
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    78   2e-14
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    78   3e-14
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    77   3e-14
Kwal_55.20326                                                          77   4e-14
Kwal_56.22693                                                          77   4e-14
Kwal_23.6325                                                           77   6e-14
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    76   7e-14
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    76   8e-14
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    76   8e-14
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    76   1e-13
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    76   1e-13
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            75   1e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    75   1e-13
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    75   2e-13
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    75   2e-13
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    75   2e-13
Kwal_47.18233                                                          74   2e-13
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    75   2e-13
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    75   2e-13
Kwal_56.23717                                                          74   3e-13
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    74   3e-13
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    74   3e-13
Kwal_23.5290                                                           74   3e-13
Scas_660.28                                                            74   4e-13
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    74   4e-13
Scas_685.24                                                            73   4e-13
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    74   4e-13
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            72   4e-13
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    73   5e-13
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    71   7e-13
Scas_564.7                                                             73   7e-13
Kwal_26.7788                                                           73   9e-13
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    73   9e-13
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    72   1e-12
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    72   1e-12
Kwal_56.24091                                                          71   1e-12
Scas_627.7                                                             70   1e-12
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    72   2e-12
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    72   2e-12
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    72   2e-12
Scas_668.22                                                            72   2e-12
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    72   2e-12
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    71   2e-12
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    71   2e-12
Scas_544.6                                                             70   2e-12
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    71   3e-12
Kwal_26.7861                                                           71   3e-12
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    71   3e-12
Scas_602.11                                                            71   3e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    71   3e-12
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    71   4e-12
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      71   4e-12
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    71   4e-12
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    70   5e-12
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    70   5e-12
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    70   6e-12
Scas_502.2                                                             70   8e-12
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    68   8e-12
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    69   1e-11
Kwal_26.8709                                                           69   1e-11
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    69   1e-11
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    69   1e-11
Scas_493.2                                                             69   1e-11
CAGL0M10153g complement(1010688..1013291) some similarities with...    69   2e-11
Scas_477.5                                                             69   2e-11
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    68   2e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    69   2e-11
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   2e-11
Kwal_56.24584                                                          68   2e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    68   2e-11
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            69   2e-11
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    68   2e-11
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    69   2e-11
Kwal_27.9763                                                           68   2e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    68   2e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    68   3e-11
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    68   3e-11
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    68   3e-11
Scas_616.10                                                            68   4e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    67   4e-11
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    67   5e-11
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    67   5e-11
Scas_640.14*                                                           67   5e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       66   5e-11
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    67   5e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    67   6e-11
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    67   7e-11
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                64   7e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    67   8e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    65   8e-11
Scas_675.2                                                             65   1e-10
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    64   1e-10
Scas_548.6                                                             65   2e-10
Scas_633.29                                                            65   2e-10
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    65   2e-10
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    65   2e-10
KLLA0C16577g complement(1451181..1452695) some similarities with...    64   2e-10
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    65   3e-10
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         64   3e-10
Scas_458.1                                                             64   3e-10
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    64   3e-10
KLLA0D09328g complement(788565..791705) some similarities with s...    65   3e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    64   3e-10
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    64   3e-10
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    64   3e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    65   3e-10
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    64   4e-10
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    64   4e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    64   5e-10
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         63   5e-10
Scas_643.20                                                            64   5e-10
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    64   5e-10
Kwal_27.11919                                                          60   6e-10
Scas_700.34                                                            64   6e-10
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    64   6e-10
Scas_634.5                                                             63   7e-10
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            63   7e-10
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    63   8e-10
Kwal_47.16761                                                          63   8e-10
Kwal_26.7154                                                           63   8e-10
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    62   1e-09
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    63   1e-09
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    62   1e-09
Scas_720.94                                                            63   1e-09
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             61   1e-09
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    62   1e-09
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    61   1e-09
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    62   1e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    62   1e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    62   1e-09
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    62   1e-09
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    62   2e-09
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    62   2e-09
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    62   2e-09
Scas_711.25                                                            62   2e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    61   2e-09
Kwal_33.14081                                                          62   2e-09
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    62   2e-09
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    62   2e-09
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    61   2e-09
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    61   2e-09
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    60   3e-09
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    60   3e-09
Kwal_23.5668                                                           62   3e-09
Kwal_27.12559                                                          60   3e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    61   3e-09
Kwal_23.3590                                                           60   4e-09
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    61   4e-09
Scas_584.11                                                            61   4e-09
Scas_703.5                                                             61   4e-09
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    60   4e-09
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    60   4e-09
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    61   4e-09
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    59   4e-09
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    60   4e-09
Kwal_26.8703                                                           60   4e-09
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    60   5e-09
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    60   5e-09
Scas_649.30                                                            60   6e-09
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    60   6e-09
Kwal_27.10004                                                          60   6e-09
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    60   6e-09
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    60   6e-09
Scas_713.7                                                             60   6e-09
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    60   6e-09
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    59   7e-09
Kwal_55.20189                                                          60   7e-09
Scas_640.16                                                            59   8e-09
CAGL0M08404g complement(836791..838179) some similarities with s...    59   8e-09
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    59   8e-09
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    60   8e-09
Scas_629.16                                                            60   8e-09
Scas_651.18                                                            59   9e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    59   9e-09
Kwal_33.13846                                                          59   9e-09
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    59   9e-09
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    59   9e-09
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    59   1e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    59   1e-08
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    59   2e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    59   2e-08
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    58   2e-08
Scas_700.35                                                            58   2e-08
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         59   2e-08
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        58   2e-08
Scas_582.1                                                             58   2e-08
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    58   2e-08
Scas_690.13                                                            57   2e-08
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    58   3e-08
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    58   3e-08
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    57   3e-08
Kwal_47.18307                                                          58   3e-08
KLLA0B07205g complement(624606..625973) some similarities with s...    57   3e-08
Kwal_14.1416                                                           57   3e-08
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    57   3e-08
Kwal_14.2497                                                           57   3e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    57   3e-08
Kwal_27.10581                                                          58   4e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    58   4e-08
Scas_619.5*                                                            57   4e-08
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    57   5e-08
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    57   5e-08
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          57   5e-08
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         57   5e-08
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    57   5e-08
Scas_715.34                                                            57   5e-08
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    57   5e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   5e-08
Kwal_56.24059                                                          56   5e-08
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    57   5e-08
Scas_673.20*                                                           57   6e-08
Kwal_0.96                                                              57   6e-08
Kwal_33.14192                                                          57   6e-08
Kwal_47.17868                                                          56   6e-08
Scas_688.14                                                            57   6e-08
Scas_660.20                                                            57   7e-08
Kwal_23.6458                                                           57   7e-08
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    57   7e-08
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    56   7e-08
Scas_613.13*                                                           55   8e-08
Scas_721.46                                                            55   9e-08
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    57   9e-08
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    55   9e-08
Scas_623.11                                                            55   1e-07
Scas_689.25*                                                           56   1e-07
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    56   1e-07
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    56   1e-07
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         55   1e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    55   1e-07
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    56   1e-07
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    56   1e-07
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    55   1e-07
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    55   1e-07
Scas_610.7                                                             55   1e-07
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    54   2e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   2e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    55   2e-07
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    55   2e-07
Kwal_33.13681                                                          55   2e-07
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    55   2e-07
Scas_713.21                                                            55   2e-07
Scas_720.103                                                           55   2e-07
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    55   3e-07
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    55   3e-07
Scas_667.18                                                            54   3e-07
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    54   3e-07
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    54   3e-07
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    55   3e-07
Scas_683.12                                                            54   3e-07
Kwal_26.8347                                                           54   3e-07
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    54   4e-07
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    54   4e-07
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    54   4e-07
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    53   4e-07
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         54   4e-07
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    54   5e-07
Kwal_26.7552                                                           54   5e-07
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    53   6e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    54   6e-07
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    53   6e-07
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            53   7e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    54   7e-07
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    53   7e-07
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    54   8e-07
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    52   8e-07
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    52   9e-07
Kwal_33.14434                                                          53   9e-07
Kwal_56.23841                                                          52   1e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    53   1e-06
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    53   1e-06
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    53   1e-06
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    52   1e-06
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             53   1e-06
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    53   1e-06
Kwal_47.17252                                                          53   1e-06
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    52   1e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    52   1e-06
KLLA0C03938g complement(358851..360632) some similarities with s...    52   1e-06
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    52   1e-06
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    52   1e-06
Scas_683.6                                                             52   2e-06
Kwal_26.8941                                                           52   2e-06
Scas_678.24                                                            52   2e-06
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    52   2e-06
Scas_336.1                                                             52   2e-06
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    52   2e-06
Kwal_55.21900                                                          52   2e-06
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    51   2e-06
Scas_653.25                                                            52   2e-06
Scas_568.9*                                                            51   2e-06
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          52   2e-06
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    51   2e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    52   3e-06
Scas_613.5                                                             51   3e-06
Kwal_26.7682                                                           51   3e-06
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    51   3e-06
Kwal_33.13222                                                          48   3e-06
Kwal_33.14167                                                          51   3e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    51   4e-06
Kwal_23.5576                                                           51   4e-06
Kwal_17.2687                                                           50   4e-06
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    51   4e-06
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    50   4e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    51   5e-06
Scas_593.14d                                                           50   5e-06
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    50   5e-06
Scas_692.24                                                            50   5e-06
Scas_628.9                                                             50   6e-06
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    50   6e-06
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    50   6e-06
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    50   7e-06
Scas_201.1*                                                            49   7e-06
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    50   8e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    50   8e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    49   8e-06
Scas_718.90                                                            50   8e-06
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    50   9e-06
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    49   9e-06
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        50   9e-06
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    49   1e-05
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    49   1e-05
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    50   1e-05
Kwal_27.11830                                                          50   1e-05
Kwal_27.9773                                                           49   1e-05
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    49   1e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    50   1e-05
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         49   1e-05
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    49   1e-05
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    49   1e-05
Kwal_55.22001                                                          49   1e-05
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   1e-05
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    49   1e-05
Scas_717.69                                                            49   1e-05
Scas_710.28                                                            49   1e-05
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    49   1e-05
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    49   1e-05
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    49   1e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    49   1e-05
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    49   1e-05
Kwal_14.1273                                                           49   1e-05
Scas_635.1                                                             49   2e-05
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    49   2e-05
Scas_707.3                                                             49   2e-05
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    49   2e-05
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            49   2e-05
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    49   2e-05
CAGL0K01661g complement(146952..148400) some similarities with t...    49   2e-05
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         48   2e-05
Scas_680.20                                                            48   2e-05
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    48   2e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   2e-05
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            49   2e-05
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    49   3e-05
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    48   3e-05
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    48   3e-05
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    49   3e-05
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    48   3e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    48   3e-05
Scas_713.38                                                            48   3e-05
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    48   3e-05
Kwal_26.7276                                                           48   4e-05
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    47   4e-05
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    47   4e-05
Scas_655.2                                                             48   4e-05
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 47   5e-05
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    47   5e-05
CAGL0M08360g complement(833220..835520) some similarities with s...    48   5e-05
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    47   5e-05
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    47   5e-05
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    47   6e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    47   6e-05
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    47   6e-05
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    47   6e-05
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    47   6e-05
Scas_721.124                                                           47   7e-05
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    47   7e-05
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    47   7e-05
KLLA0E11979g complement(1060048..1061892) some similarities with...    47   8e-05
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    47   8e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    47   9e-05
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    47   9e-05
Scas_707.34                                                            47   9e-05
Kwal_33.13831                                                          47   1e-04
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    47   1e-04
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    46   1e-04
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    46   1e-04
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    46   1e-04
Kwal_23.3471                                                           45   1e-04
Scas_651.19                                                            46   1e-04
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      46   1e-04
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    46   1e-04
Kwal_56.22788                                                          46   1e-04
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    46   1e-04
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    46   1e-04
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    46   1e-04
Scas_711.15                                                            46   1e-04
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         45   1e-04
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    46   2e-04
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    46   2e-04
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      45   2e-04
Scas_22.1                                                              45   2e-04
Scas_618.8                                                             45   2e-04
KLLA0A06820g complement(615686..618004) some similarities with s...    46   2e-04
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    45   2e-04
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           45   2e-04
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    46   2e-04
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    45   2e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    45   2e-04
Scas_654.12                                                            45   2e-04
Scas_721.61                                                            45   2e-04
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    45   2e-04
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       45   2e-04
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    45   2e-04
Kwal_26.7635                                                           45   2e-04
Kwal_33.14554                                                          45   3e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    45   3e-04
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    45   3e-04
Scas_689.24                                                            45   3e-04
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    44   3e-04
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    45   3e-04
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    44   4e-04
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    44   4e-04
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    44   4e-04
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    44   5e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    44   5e-04
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    44   5e-04
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    44   5e-04
Scas_584.8                                                             44   5e-04
Scas_721.132                                                           44   6e-04
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    44   7e-04
Kwal_14.1159                                                           44   7e-04
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         44   8e-04
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    43   8e-04
Kwal_14.1249                                                           43   8e-04
Scas_721.110                                                           43   9e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    43   0.001
KLLA0D12100g complement(1031728..1033161) some similarities with...    43   0.001
Kwal_33.13825                                                          43   0.001
Kwal_55.20221                                                          43   0.001
Kwal_27.11777                                                          43   0.001
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    42   0.002
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    42   0.002
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    42   0.002
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    42   0.002

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score = 1802 bits (4668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 877/944 (92%), Positives = 877/944 (92%)

Query: 1   MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVS 60
           MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVS
Sbjct: 1   MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVS 60

Query: 61  FVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSN 120
           FVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSN
Sbjct: 61  FVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSN 120

Query: 121 ASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQR 180
           ASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQR
Sbjct: 121 ASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQR 180

Query: 181 TPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSP 240
           TPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSP
Sbjct: 181 TPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSP 240

Query: 241 EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLIN 300
           EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLIN
Sbjct: 241 EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLIN 300

Query: 301 LVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYD 360
           LVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYD
Sbjct: 301 LVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYD 360

Query: 361 MLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVD 420
           MLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVD
Sbjct: 361 MLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVD 420

Query: 421 MQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVAETHMHMYADAQKNYIQVPRKEV 480
           MQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVAETHMHMYADAQKNYIQVPRKEV
Sbjct: 421 MQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVAETHMHMYADAQKNYIQVPRKEV 480

Query: 481 MMQHTDRSVLSDHSGNGTSTPSLPGSCPVQHEQLANTPKSKQYKKNNPFPKMAKQDFVHD 540
           MMQHTDRSVLSDHSGNGTSTPSLPGSCPVQHEQLANTPKSKQYKKNNPFPKMAKQDFVHD
Sbjct: 481 MMQHTDRSVLSDHSGNGTSTPSLPGSCPVQHEQLANTPKSKQYKKNNPFPKMAKQDFVHD 540

Query: 541 TYDESDEHSPGDDPAPASKPVDSMIPSVPATVTPMVSVQRDRSFQHIQPGQIPENVRECE 600
           TYDESDEHSPGDDPAPASKPVDSMIPSVPATVTPMVSVQRDRSFQHIQPGQIPENVRECE
Sbjct: 541 TYDESDEHSPGDDPAPASKPVDSMIPSVPATVTPMVSVQRDRSFQHIQPGQIPENVRECE 600

Query: 601 PESEVEMDLSHKIQNCNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL 660
           PESEVEMDLSHKIQNCN                                          L
Sbjct: 601 PESEVEMDLSHKIQNCNLDQQQSLQAQDLKLQQILLHQQQLQHRQYQQQNDNRQQHAQRL 660

Query: 661 HDQMPHQQRQQLPLQMHLRPQHPCSNNVPLHKTLAEQAYQLSDSTXXXXXXXXXXXXVDR 720
           HDQMPHQQRQQLPLQMHLRPQHPCSNNVPLHKTLAEQAYQLSDST            VDR
Sbjct: 661 HDQMPHQQRQQLPLQMHLRPQHPCSNNVPLHKTLAEQAYQLSDSTQPQPQPQYQAYYVDR 720

Query: 721 KTAVPFQTYSNAYTQNQHVFPQQSSRGTYGTSDRIQNGSNQLIEFSSPDKSANDAQLDLT 780
           KTAVPFQTYSNAYTQNQHVFPQQSSRGTYGTSDRIQNGSNQLIEFSSPDKSANDAQLDLT
Sbjct: 721 KTAVPFQTYSNAYTQNQHVFPQQSSRGTYGTSDRIQNGSNQLIEFSSPDKSANDAQLDLT 780

Query: 781 YNQINLSKPNSVGGGDPSENASVELNGSGSSVLTNESIAMELPNAEERPVPPSTSGATQP 840
           YNQINLSKPNSVGGGDPSENASVELNGSGSSVLTNESIAMELPNAEERPVPPSTSGATQP
Sbjct: 781 YNQINLSKPNSVGGGDPSENASVELNGSGSSVLTNESIAMELPNAEERPVPPSTSGATQP 840

Query: 841 AENIHSRQESDSYHDREDSRHVTGHVPRRSLELDFQEIDLSSSPTPVSASKTSSKAHLQP 900
           AENIHSRQESDSYHDREDSRHVTGHVPRRSLELDFQEIDLSSSPTPVSASKTSSKAHLQP
Sbjct: 841 AENIHSRQESDSYHDREDSRHVTGHVPRRSLELDFQEIDLSSSPTPVSASKTSSKAHLQP 900

Query: 901 NRSGTANCGTXXXXXXXXXXXXXFHRGRKSVDLDVSKKESKEEP 944
           NRSGTANCGT             FHRGRKSVDLDVSKKESKEEP
Sbjct: 901 NRSGTANCGTSNSSSVVSGVRKSFHRGRKSVDLDVSKKESKEEP 944

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/545 (55%), Positives = 376/545 (68%), Gaps = 47/545 (8%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85
           LE L  G+ ++VG H+VE+++YLAEGGFAHIY V FV ++NEL+     L+ GD  CLKR
Sbjct: 29  LEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKR 88

Query: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145
           V V+DENGLNELRNEVEVMK+L+N  NIVQYYDSNASR  DG PGYEVLLLMELCPN SL
Sbjct: 89  VLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSL 148

Query: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
           LDYMNQRLATKLSE EVLKIMYD+T  ++ MH+  TPLIHRDIKIENVLVD++NNFKLCD
Sbjct: 149 LDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCD 208

Query: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265
           FGSTS C P + +HQ+IA+L NNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALGIFLY
Sbjct: 209 FGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLY 268

Query: 266 KLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICS 325
           KLLFYTTPFELTGQFAILHSKY+IP N++SSKLINL+IIMLAENP LRPN+YQV+Y +C+
Sbjct: 269 KLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCA 328

Query: 326 MMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFIST 385
           +M+ +V  +D Y  GPY+FD Y +YQEKLQ  QY + +S+   Q    + D +NDLFI+ 
Sbjct: 329 IMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQ----DVDTLNDLFINC 384

Query: 386 FECAPKQPMVMGQNAVAQQ----QIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLD 441
           FE APKQPM MG+  +A++    +       +   +P+  ++ +     H          
Sbjct: 385 FEIAPKQPMDMGKRDLAEKPENLEKIQNQQDSRKQIPIRDEEDIKMVQQH---------- 434

Query: 442 SLQKLPKSADVGNYPVAE-THMHMYADAQKNYIQVPRKEVMMQHTDRSVLSDHS-GNGTS 499
                P   D+  Y  +E TH    +D   +     R + +   +  S ++D S G+G S
Sbjct: 435 ----FPSVEDLEIYLHSEATHFENKSDRLSSLAVPNRSKSLGSSSHASSVTDLSNGSGNS 490

Query: 500 ----TPSLPGSCPVQHEQLANTPKSKQYKKNNPFPKMAKQ---------------DFVHD 540
               +P +  S P       +T   KQ+K NNPFPKM +Q               D+ HD
Sbjct: 491 PEEVSPGVMSSNPTA----KSTASIKQHKSNNPFPKMQQQQQPQQQQPQFYQQNIDYFHD 546

Query: 541 TYDES 545
           T  E+
Sbjct: 547 TSKEA 551

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/532 (55%), Positives = 365/532 (68%), Gaps = 26/532 (4%)

Query: 1   MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVS 60
           MSK  T  + +       T A+     +L   + V+VG H+ E++E+LAEGGFA+IYKV 
Sbjct: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60

Query: 61  FVGYTNELDR--QDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYD 118
           F+  TNE+D     ++L+ GD  CLKRV V DENGLNELRNEVE MK+LR   NIVQYYD
Sbjct: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120

Query: 119 SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHY 178
           SNASR  DG PG+E+LLLMELCP  SLLDYMN +LATKL+EAE+LKIMYD++  ++ MHY
Sbjct: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180

Query: 179 QRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYR 238
             TPLIHRDIKIENVLVD D+NFKLCDFGSTS C P V++HQ+IA+L NNIYVHTTPQYR
Sbjct: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240

Query: 239 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKL 298
           SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP+N +SSKL
Sbjct: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300

Query: 299 INLVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQ 358
           INL+IIMLAENP LRPN+YQVM+H+CS+++C+V   D Y  GPY+F  Y +Y  KLQ++Q
Sbjct: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360

Query: 359 YDMLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMP 418
           Y M   ++  +    + DK+NDLFI  FE APKQP+  G  +V QQ+   AP    T + 
Sbjct: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQE---APEDLETDI- 416

Query: 419 VDMQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVAETHMHMYADAQKNYIQVPRK 478
             M +  P        NA           K  D  +  V  T +   + ++       + 
Sbjct: 417 AKMDECYPTVEKLESANA-----------KERDDHHLQVLSTSLKQ-SSSRSISDLSNKS 464

Query: 479 EVMMQHTDRSVLSDHSGNGTSTPS-LPGSCPVQHEQLANTPKSKQYKKNNPF 529
           +V +   +R     HS +G   PS LP S   Q +  AN   ++Q+K++NPF
Sbjct: 465 QVSLDSNER-----HSSHGIRAPSPLPSS--QQPQNTANMSAARQHKQHNPF 509

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 23/108 (21%)

Query: 776 QLDLTYNQINLSKPNSVGGGDPSENASVELNGSGSSVLTNESIAMELPNAEERPVPPSTS 835
           +LDLT++Q++LSK NS+     +  +  EL     S++++ESI+++L        P    
Sbjct: 673 RLDLTFDQLDLSK-NSL-----TRQSDTELE---ESIISDESISLDLKQ------PKLKE 717

Query: 836 GATQPAENIHSRQESDSYHDREDSRHVTGHVP-RRSLELDFQEIDLSS 882
             TQP +      ES  +            VP RRSL+L +QEI+LS+
Sbjct: 718 PVTQPRQTTSPGSESKEFLK-------PAKVPKRRSLDLKYQEINLSN 758

>Kwal_27.10945
          Length = 935

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/549 (53%), Positives = 362/549 (65%), Gaps = 34/549 (6%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRI-LQPGDTVCLK 84
           LE L+ GS V+VG H+VE+++YLAEGGFAHIY V F+ Y NEL++   I L+ GD  CLK
Sbjct: 68  LEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLK 127

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           RV V+DENGLNE+RNEV VMK+L  C NIVQYYDS+ASR  DG  G+EV LLMELCPN S
Sbjct: 128 RVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNS 187

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204
           LLDYMNQRLATKLSE E+LKIM+D+T  L+ MHY   PLIHRD+KIENVLVDA++NFKLC
Sbjct: 188 LLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLC 247

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
           DFGSTS C P   +HQEIA+L NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL
Sbjct: 248 DFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307

Query: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           YKLLFYTTPFELTGQFAILHSKYE P N++SSKLINL+IIMLAENP LRPN+YQVM ++C
Sbjct: 308 YKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLC 367

Query: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFIS 384
           S+++ +  ++D Y  G Y+F+ Y +YQ KLQ++QY M ++++  Q+     D +ND+FI+
Sbjct: 368 SILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENKQQ----IDTLNDMFIN 423

Query: 385 TFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLDSLQ 444
            FE APKQP+ +     A       P S  T     + +  P  +   G    G +   Q
Sbjct: 424 CFEVAPKQPVDISDKKWAS-----GPSSYKTRENKTVPEVNPD-VTLAGEEDIGLVQ--Q 475

Query: 445 KLPKSADVGNYPVAETHMHMYADAQKNYIQVPRKEVMMQHTDRSVLSDHSGNGTSTP--S 502
           + P   D+ +Y   E        +                TD S +     +  S P   
Sbjct: 476 QFPSVEDLDHYLDGENKRDTNKSSSNGAFSTEHSSGSSSKTDLSAIQ----HAPSVPLEE 531

Query: 503 LPGSCPVQHEQLANTPKS-------------KQYKKNNPFPKMAKQDFVHDTYDESDE-- 547
           LP S P Q+ Q   T K+             KQ+K  NPFP +  +  ++   ++S+   
Sbjct: 532 LPSSKPTQNVQAVATSKNMVRDTTARSTNSVKQHKPTNPFPYIQPEKEIYGVDNDSNSIF 591

Query: 548 HSPGDDPAP 556
           H  G    P
Sbjct: 592 HGEGSKSDP 600

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 86/182 (47%), Gaps = 42/182 (23%)

Query: 762 LIEFSSPDKSANDAQLDLTYNQINLSKPNSVGGGDPSENASVELNGSGSSVLTNESIAME 821
           L++FS P K     +LDLTY+ ++LS   ++  G+  +   +    S  S+ ++ES++++
Sbjct: 773 LVDFSPPLKR-EPQKLDLTYDSVDLS---TLSKGEYKDETDI----SEQSMASSESVSVD 824

Query: 822 LPNAEERPVPPSTSGATQPAENIHSRQESDSYHDREDSRHVTGHVPR--RSLELDFQEID 879
           L   E          A    +N+            +DS       PR  RSL+L FQE+D
Sbjct: 825 LRQNERL-------SAKTRGQNV------------DDSVSAVKPSPRGRRSLDLKFQEMD 865

Query: 880 LSSSPTP-VSASKTSSKAHLQPNRSGTANCGTXXXXXXXXXXXXXFHRGRKSVDLDVSKK 938
            S+SP+P +   KT + +H Q  +S  A                 F R RKS+DL+ +K+
Sbjct: 866 FSNSPSPDIKLQKTKTVSH-QQRKSNVA-----------AEPKKSFSRARKSLDLERTKR 913

Query: 939 ES 940
           ++
Sbjct: 914 DT 915

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  539 bits (1389), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 287/557 (51%), Positives = 358/557 (64%), Gaps = 57/557 (10%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRI-LQPGDTVCLK 84
           +E    G  V VG H+VEV+ YLAEGGFA IY V F+ Y NE D    + L+ GD  CLK
Sbjct: 19  VERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLK 78

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           RV V DENGLNE+RNEVEVMKKL+   NIVQY+DSNASR  DG  G+EVLLLMELCPN S
Sbjct: 79  RVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKS 138

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204
           LLDYMNQRL+TKL+EAE++KIMYD+ + +S MHY    LIHRDIKIENVLVDA NNFKL 
Sbjct: 139 LLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLA 198

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
           DFGSTS C P V +HQ+IA+L  NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG+FL
Sbjct: 199 DFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258

Query: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           YKLLF+TTPFE+TGQFAILHSKYE P N +SSKLINL+IIMLAENP LRPN+YQV+YH+C
Sbjct: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLC 318

Query: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDK------- 377
            ++  EV I+D Y +G YNF  Y ++Q KLQ +Q  M   +QL Q+ I+  +K       
Sbjct: 319 EILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQM---YQLQQKKIMQNNKLSDSEEN 375

Query: 378 -VNDLFISTFECAPKQPMVMGQNAVAQQQIFVAPPSTNTSMPV--------DMQQSL--- 425
            +ND+F+S+FE + K PM       A  +I    PS N    +        D ++S    
Sbjct: 376 LLNDMFLSSFEISSKLPMNASDGHAAVSRI----PSQNVGQELEEEKESQSDQRKSTLSE 431

Query: 426 -PKPLDHNGPNAHGGLDSLQKLP--KSADVGNYPVAE--THMHMYADAQKNYIQVPRKEV 480
                  +  N+ G  ++ Q++   +S  + +  + E  T   +Y  +         KE+
Sbjct: 432 DKSSRTTSNANSSGTANNPQEINTIQSPGIEDKSIFENKTPGELYYPSVSELDTYLDKEL 491

Query: 481 MMQHTDRSV------------------LSDHSGNGTSTPSLP-GSCPV------QHEQLA 515
           + Q +D ++                   S +S  G S  S   G+  +       +E+ A
Sbjct: 492 VKQSSDPTISEQSPRLNTQSLPQRQKSTSSYSSGGRSMKSTSYGAATIGSDEALANEKTA 551

Query: 516 NTPKSKQYKKNNPFPKM 532
              K KQ+K NNPFPKM
Sbjct: 552 GINKMKQHKSNNPFPKM 568

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 809 GSSVLTNESIAMELPNA------EERPVPPSTSGATQPAENIHSRQESDSYHDREDSRHV 862
           G S++++ESI ++L +A      E RP+        Q   +  S+  S+ +  + D   V
Sbjct: 896 GDSMVSSESIDIDLDDARRGKTAERRPLHNERGHKDQARSSDASK--SNQFKSK-DFSSV 952

Query: 863 TGHVPRRSLELDFQEIDLSS 882
           +   PR+SL+L+FQE++LSS
Sbjct: 953 STRQPRQSLDLNFQEVNLSS 972

>Scas_661.27
          Length = 1095

 Score =  528 bits (1361), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/377 (65%), Positives = 298/377 (79%), Gaps = 7/377 (1%)

Query: 27  EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELD--RQDRILQPGDTVCLK 84
           E    G+ V VG H+VE+I+Y+AEGGFA IY V F+ + NE +  R    LQ GD  CLK
Sbjct: 20  ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK 79

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           RV V DENGLNE+RNEVEVMK+L+   NIVQYYDSNASR  +G PG+EVLLLMELCPN S
Sbjct: 80  RVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKS 139

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204
           LLDYMNQRLATKL+E E+LKIMYD+T  +S MHY  TPL+HRDIKIENVLVDA NNFKLC
Sbjct: 140 LLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
           DFGSTS   P V +HQ+IA+L  NIYVHTTPQYRSPEMIDLYRCLPI+EKSDIWALGIFL
Sbjct: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259

Query: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           YKLLF+TTPFELTGQFAILHSKYE P+N++SSKLINL+IIMLAENP LRPN+YQV+++IC
Sbjct: 260 YKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHNIC 319

Query: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYD--MLMSHQLAQRGII---NTDKVN 379
           S+   +V I+D Y +GPY+F+ Y  +Q K+Q +QY   +L   +    G +   + + +N
Sbjct: 320 SISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQEKKFKTNGKLPQADINLLN 379

Query: 380 DLFISTFECAPKQPMVM 396
           DLF+++F+ A K P  +
Sbjct: 380 DLFVTSFDIASKVPFEL 396

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  521 bits (1342), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/369 (65%), Positives = 295/369 (79%), Gaps = 7/369 (1%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDR--QDRILQPGDTVCLKRVRVS 89
           G  + VG H+VE++ YLAEGGFA IY V FV Y NE +       +  GD  CLKRV V+
Sbjct: 23  GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           DE GLNE+RNEVEVMKKL++  NIVQY+DSNASR  DGKPG+EVLLLMELCPN SLLDYM
Sbjct: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209
           NQRL TKLSE+E+LKIMYD+++G+S+MHY   PLIHRDIKIENVLVDA+NNFKLCD GST
Sbjct: 143 NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202

Query: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269
           S C P + S+Q+IAM+  NIYVHTTPQYR+PEMIDLYR LPINEKSDIWALGIFLYKLLF
Sbjct: 203 SQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLF 262

Query: 270 YTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMEC 329
           YTTPFE+TGQ AILHSKY+ P N +SSK+INL+IIMLAENP LRPN++QV+YHICS+M  
Sbjct: 263 YTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNL 322

Query: 330 EVKIDDLYGQGPYNFDMYGRYQEKLQRL--QYDMLMSHQLAQRGIINTDK---VNDLFIS 384
            V I+D YG GPYNFD+Y ++Q K+Q +  Q + L +  ++ +  ++ +    +++L+I 
Sbjct: 323 PVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSKSKLSKEDGLVLDELYIK 382

Query: 385 TFECAPKQP 393
           TFE  PK P
Sbjct: 383 TFEMIPKIP 391

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  488 bits (1256), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 229/347 (65%), Positives = 276/347 (79%), Gaps = 12/347 (3%)

Query: 27  EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQD-----RILQPGDTV 81
           E   AG  V VG H+VEV+ YLAEGGFA IY V FV YTNE +R++     + L+PG   
Sbjct: 94  EKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPA 153

Query: 82  CLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRL----GDGKPGYEVLLLM 137
           CLKRV V DE GLN++R+EVEVMKKL+   NIVQY+DSNASRL    G+   G+EVLLLM
Sbjct: 154 CLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLM 213

Query: 138 ELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA 197
           ELCPN SLLDYMNQRLATKL+E E+ KIMYDIT+ ++ MHY   PLIHRDIKIENVLVDA
Sbjct: 214 ELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDA 273

Query: 198 DNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 257
           +NNFKLCDFGSTS C PA  S Q+IAML  ++Y+HTTPQYRSPEMIDL++ +PINEKSDI
Sbjct: 274 NNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDI 333

Query: 258 WALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVY 317
           WALG+FLYKLLF+TTPFE TGQFA+LHSK+E P NS+SSKLINL+I+MLAENP LRPN+Y
Sbjct: 334 WALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIY 393

Query: 318 QVMYHICSMMECEVK---IDDLYGQGPYNFDMYGRYQEKLQRLQYDM 361
           QV+Y++  +   EV    + D YGQGPYNF+ Y R+Q++ Q++Q  +
Sbjct: 394 QVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQL 440

>Kwal_27.11542
          Length = 791

 Score =  308 bits (789), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 199/310 (64%), Gaps = 15/310 (4%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP---GDTVCLKRVRV 88
           G+ + VG HQ  +I+YL  GGFAHIY       + E+   D    P   G+  CLKRV V
Sbjct: 12  GTALTVGSHQARIIKYLTSGGFAHIY-------SAEISPAD----PNSIGNVACLKRVLV 60

Query: 89  SDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDY 148
            D+  LN LR EV+ MK LR   ++V Y DS+A++ G     YEV LLME C  G L+D+
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 149 MNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGS 208
           MN RL  +L+E EVLKIM DIT G++ MH    PLIHRDIKIENVL+  D  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268
               +    + QE + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG+FLYKL 
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 269 FYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMM 327
           +YTTPFE  G  AILHS+++ P    +S +L NL+ +ML+ENP  RPN+ QV+  +  + 
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 328 ECEVKIDDLY 337
                + + Y
Sbjct: 301 NVPCPLRNFY 310

>Scas_601.6
          Length = 661

 Score =  295 bits (756), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 202/313 (64%), Gaps = 9/313 (2%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85
           + + Q G+ + VG H+V+V++YL  GGFA IY V       ++   D+     +  CLKR
Sbjct: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTV-------QISPPDKFTN-TNVACLKR 57

Query: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145
           V V D+  LN LR EV+ MK LRN +++V Y DS+A++    +  YEV LLME C  G L
Sbjct: 58  VIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL 117

Query: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
           +D+MN RL  +L E E+L IM  +T G++ MH    PL+HRDIKIENVL+ +   +K+CD
Sbjct: 118 IDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCD 177

Query: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265
           FGS    +   ++ QE++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIWALG+FLY
Sbjct: 178 FGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLY 237

Query: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           KL +YTTPFE  G+ AILH+ ++ P    +S +L  L+  ML E P  RPN YQV+  + 
Sbjct: 238 KLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVS 297

Query: 325 SMMECEVKIDDLY 337
           SM   +  I + Y
Sbjct: 298 SMQNVQCPIPNFY 310

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  295 bits (754), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 25  PLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLK 84
           PLE   +G+ + VG H+  +I+YL  GGFAHIY       + E+   D         CLK
Sbjct: 5   PLETYPSGTVLTVGSHKARIIKYLTSGGFAHIY-------SAEISPPDP--NSSSIACLK 55

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           RV V D+  LN LR EV+ MK L+    +V Y DS+A++       YEV LLME C  G 
Sbjct: 56  RVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGG 115

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204
           L+D+MN RL  +L E EVLKIM  ++ G++ MH  + PLIHRDIKIENVL+  D NFK+C
Sbjct: 116 LIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVC 175

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
           DFGS    +    + QE+  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+FL
Sbjct: 176 DFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFL 235

Query: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323
           YKL +YTTPFE  G+ AILHSK++ P    +S +L NL+  +L ENP  RPN+ Q++  +
Sbjct: 236 YKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295

Query: 324 CSMMECEVKIDDLY 337
             +      + + Y
Sbjct: 296 SRIQGVPCPVKNFY 309

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  290 bits (741), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 145/318 (45%), Positives = 198/318 (62%), Gaps = 18/318 (5%)

Query: 25  PLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPG----DT 80
           P + LQ G  + VG H+V++I+YL  GGFA IY                +L PG      
Sbjct: 5   PQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSC-------------EVLSPGPIQGSL 51

Query: 81  VCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELC 140
            CLKRV V D+  LN LR EV+ MK L+   ++V Y DS+A++       YEV LLME C
Sbjct: 52  ACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYC 111

Query: 141 PNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNN 200
             G L+D+MN RL T+LSE EVLKIM  +  G+  MH    PLIHRDIKIENVL+  D +
Sbjct: 112 LRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGD 171

Query: 201 FKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWAL 260
           FK+CDFGS S  +    +  E   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWAL
Sbjct: 172 FKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWAL 231

Query: 261 GIFLYKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQV 319
           G+FLYK+ ++TTPFE  G+ AIL +K++ P    ++ +L NL+ +ML+E+P  RPN+ QV
Sbjct: 232 GVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291

Query: 320 MYHICSMMECEVKIDDLY 337
           +  +  +      + + Y
Sbjct: 292 LEEVSRIQGVPCPLPNFY 309

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  290 bits (742), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 199/313 (63%), Gaps = 9/313 (2%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85
           +E   +G+ + VG HQV+V++YLA GGFAH+Y V       E+   D +  P +  CLKR
Sbjct: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV-------EISPPDPVC-PDNVACLKR 57

Query: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145
           V V D+  LN LR EV+ MK LR    IV Y DS+A++       YEV LLME C  G L
Sbjct: 58  VVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGL 117

Query: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
           +D+MN RL  +L E E+L IM  ++ G++ MH  + PLIHRDIKIENVL+  ++ FKLCD
Sbjct: 118 IDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCD 177

Query: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265
           FGS S  + A  + +E   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+FLY
Sbjct: 178 FGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLY 237

Query: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           K  +YTTPFE  G+ AIL SK+E P    +S ++ NL+ +ML  +P  RPN+ QV+  + 
Sbjct: 238 KTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVS 297

Query: 325 SMMECEVKIDDLY 337
            +      I + Y
Sbjct: 298 RIQGIPCPIKNFY 310

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  282 bits (722), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 195/313 (62%), Gaps = 21/313 (6%)

Query: 31  AGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD------TVCLK 84
            G+ + VG HQVE+I+YL  GGFA +Y                ++ P D        CLK
Sbjct: 11  VGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------------LINPPDPHSNSSVACLK 56

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           RV V D+  LN LR EV+ M+ L+N   +V Y DS+A++       YEV +LME C  G 
Sbjct: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGG 116

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204
           L+D+MN RL  +L E E+L+IM  +T G++ MH  + PLIHRDIKIENVL+ A+N +KLC
Sbjct: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
           DFGS    +    + QE++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGIFL
Sbjct: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236

Query: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323
           YKL +YTTPFE  G  AIL  K+E P   ++S +L  L+  +L ++P  RPNVYQ++  I
Sbjct: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296

Query: 324 CSMMECEVKIDDL 336
             M      I+D+
Sbjct: 297 SIMQNVPCPINDI 309

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  286 bits (732), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 199/313 (63%), Gaps = 10/313 (3%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85
           + + + G+ + VG H  ++I+YL  GGFA +Y       T E+   D      +  CLKR
Sbjct: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVY-------TAEISPPDP-YSNANIACLKR 57

Query: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145
           V V  + GLN LR EV+ MK LRN  ++V Y DS+A+R  +G   YEV +LME C  G L
Sbjct: 58  VIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEFCERGGL 116

Query: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
           +D+MN RL  +L E+E+L+IM     G++ MH  + PLIHRDIKIENVL+  D  +K+CD
Sbjct: 117 IDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCD 176

Query: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265
           FGS S  +    + QE   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALG+FLY
Sbjct: 177 FGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLY 236

Query: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           K+ +YTTPFE +G+  ILH++Y+ P    +S +L NL+ +ML E P  RPN+ QV+  + 
Sbjct: 237 KICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVS 296

Query: 325 SMMECEVKIDDLY 337
            +      I + Y
Sbjct: 297 RLQNKPCPIRNFY 309

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  282 bits (722), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 196/313 (62%), Gaps = 9/313 (2%)

Query: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85
           L+ +  G+ + VG H V++++YL  GGFA IY V  +           +    +  CLKR
Sbjct: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMG--------LFNGSNVACLKR 57

Query: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145
           V+V D+  LN LR EV+ MK L N  ++V Y DS+A+R       YEV LLME C  G L
Sbjct: 58  VKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGL 117

Query: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
           +D+MN RL  +L+E E+L IM   T G++ MH    PL+HRDIKIENVL+     +K+CD
Sbjct: 118 IDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCD 177

Query: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265
           FGS S  +    + QE+  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+FLY
Sbjct: 178 FGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLY 237

Query: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           KL +YTTPFE  G+ AILH++++ P   ++S +L NL+  ML E+P  RPNV QV+  + 
Sbjct: 238 KLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVS 297

Query: 325 SMMECEVKIDDLY 337
            M      I + Y
Sbjct: 298 RMQNVPCPIRNFY 310

>Scas_671.16
          Length = 723

 Score =  282 bits (721), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 195/309 (63%), Gaps = 13/309 (4%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIY--KVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89
           G+ + VG H  ++I+YL  GGFA IY  ++S +   N             T CLKRV V 
Sbjct: 12  GTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNN----------SQTACLKRVIVP 61

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           D+ GLN LR EV+ MK L+N  ++V Y DS+A+R       YEV LLME C  G L+D+M
Sbjct: 62  DKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFM 121

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209
           N RL  +L+E E+L I+     G+S MH  +  LIHRDIKIENVL+ A   FK+CDFGS 
Sbjct: 122 NTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSV 181

Query: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269
              +    + QE+A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG+FLYKL +
Sbjct: 182 CSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCY 241

Query: 270 YTTPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMME 328
           YTTPFE  G+ AILHS+Y+ P    ++ KL NL+   L E+P  RPN+ Q++  I  +  
Sbjct: 242 YTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQG 301

Query: 329 CEVKIDDLY 337
               I++ Y
Sbjct: 302 IPCPINNFY 310

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  263 bits (672), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 195/307 (63%), Gaps = 9/307 (2%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91
           G+TV VG H V +++YL  GG+A IY    +         D+ L   +   LKRV V D+
Sbjct: 12  GTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-------ADQFLGT-NMAVLKRVIVPDK 63

Query: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151
           + LN LR EV+ MK+L++   IV Y DS+A++       YEV L+ME C  G L+D+MN 
Sbjct: 64  SHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNT 123

Query: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211
           RL  +L+E E+L I   I+ G++ MH  + PLIHRDIKIENVL+  D+ +KLCDFGS S 
Sbjct: 124 RLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSG 183

Query: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271
            +    + +E+A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+FLYKL +YT
Sbjct: 184 YIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYT 243

Query: 272 TPFELTGQFAILHSKYEI-PRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330
           TPFE TG+  IL+   E  P   +S  +  L++ MLA+NP  RPN++Q++  +  ++   
Sbjct: 244 TPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVN 303

Query: 331 VKIDDLY 337
             I +++
Sbjct: 304 CPIPNIH 310

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  101 bits (252), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 140/284 (49%), Gaps = 38/284 (13%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMK 105
           ++L EGGFA  +++         D   +I     TV   ++ +  E    +L +E+++ K
Sbjct: 85  QFLGEGGFARCFQIK--------DDSGKIF-AAKTVA--KISIKSEKTRKKLLSEIQIHK 133

Query: 106 KLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKI 165
            + + +NIVQ+ D     +        V +L+E+CPNGSL++ + +R    ++E EV   
Sbjct: 134 SMSH-TNIVQFIDCFEDNVN-------VYILLEICPNGSLMELIKKR--KTITEPEVRFF 183

Query: 166 MYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAML 225
           M  I  G+ +MH  R  +IHRD+K+ N+  D   N K+ DFG     L AV ++      
Sbjct: 184 MTQICGGIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-----LAAVLANDR---- 232

Query: 226 MNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL----TGQFA 281
                +  TP Y +PE++ + +    + + DIW++G+ LY LL    PF+     T    
Sbjct: 233 ERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYER 291

Query: 282 ILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
           I    +  P++   S     L+  +L+ NP  RP++ ++M ++ 
Sbjct: 292 IKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVW 335

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  101 bits (251), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 141/279 (50%), Gaps = 40/279 (14%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D + ++     TV   ++ +  E    +L +E+++ K 
Sbjct: 95  FLGEGGFARCFQMK--------DDKGKVF-AAKTVA--KLSIKSEKTRRKLLSEIQIHKS 143

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           +++  NIVQ+ D         +    V +L+E+CPNGS+++ + QR    L+E EV   M
Sbjct: 144 MKH-PNIVQFTDC-------FEDDTNVYILLEICPNGSVMELLRQR--KHLTEPEVRFCM 193

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D + N K+ DFG     L AV ++ +     
Sbjct: 194 IQIIGAIRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-----LAAVLANDK----E 242

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 286
               +  TP Y +PE++   +    + + DIW++G+ LY LLF   PF+   +   ++ +
Sbjct: 243 RKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYER 300

Query: 287 YEIPRNSF------SSKLINLVIIMLAENPYLRPNVYQV 319
            +     F      SS   NL+  +L  NP  RP++Y++
Sbjct: 301 IKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 143/284 (50%), Gaps = 40/284 (14%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D   +I     TV   ++ +  E    +L +E+++ K 
Sbjct: 82  FLGEGGFARCFQMK--------DDSGKIF-AAKTVA--KISIKSEKTRKKLLSEIQIHKS 130

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           +++  NIVQ+ D         +    V +L+E+CPNGSL+D + +R    L+E EV    
Sbjct: 131 MKH-PNIVQFIDC-------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFT 180

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D++ N K+ DFG     L AV ++       
Sbjct: 181 TQIVGAIKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-----LAAVLANDR----E 229

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 286
               V  TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  I++ +
Sbjct: 230 RKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYER 287

Query: 287 -----YEIPRNSFSSKLINLVII-MLAENPYLRPNVYQVMYHIC 324
                Y  PR   +SK + ++I  +L+ +P  RP++ ++M ++ 
Sbjct: 288 IKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW 331

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 98.6 bits (244), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 142/283 (50%), Gaps = 40/283 (14%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D   ++     TV   ++ +  E    +L +E+++ K 
Sbjct: 78  FLGEGGFARCFQMK--------DDSGKVF-AAKTVA--KISIKSEKTRKKLLSEIQIHKS 126

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           +++  NIVQ+ D         +    V +L+E+CPNGSL+D + QR   +L+E EV    
Sbjct: 127 MKH-PNIVQFTDC-------FEDDTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFT 176

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D   N K+ DFG     L AV ++       
Sbjct: 177 TQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-----LAAVLANDR----E 225

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 286
               +  TP Y +PE++   +    + + DIW++G+ +Y LL    PF+   +   ++ +
Sbjct: 226 RKYTICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQ-AKEVNTIYER 283

Query: 287 YEIPRNSF------SSKLINLVIIMLAENPYLRPNVYQVMYHI 323
            ++   SF      SS+   L+  +L+ +P  RP++ ++M ++
Sbjct: 284 IKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Kwal_56.22476
          Length = 697

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 143/283 (50%), Gaps = 40/283 (14%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D   +I     TV   ++ +  E    +L +E+++ K 
Sbjct: 84  FLGEGGFARCFQIK--------DDGGKIF-AAKTVA--KISIKSEKTRKKLLSEIQIHKS 132

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           +R+ +NIVQ+ D         +    V +L+E+CPNGSL+D + +R    L+E EV    
Sbjct: 133 MRH-TNIVQFVDC-------FEDDTNVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFT 182

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D   N K+ DFG     L AV ++       
Sbjct: 183 TQIVGAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-----LAAVLANDR----E 231

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK 286
               V  TP Y +PE++   +    + + DIW+ G+ +Y LL    PF+   +  I++ +
Sbjct: 232 RKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYER 289

Query: 287 -----YEIPRNSFSS-KLINLVIIMLAENPYLRPNVYQVMYHI 323
                +  P++ F S + + L+  +L+ +P  RP++ +++ ++
Sbjct: 290 IKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Scas_644.15
          Length = 726

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 146/301 (48%), Gaps = 51/301 (16%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D   +I     TV   ++ +  E    +L +E+++ K 
Sbjct: 97  FLGEGGFARCFQIK--------DESGKIF-AAKTVA--KISIKTEKTKKKLLSEIQIHKS 145

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           +++  NIV + D         +    V +L+E+C NGSL+D M +R    L+E EV    
Sbjct: 146 MKH-PNIVHFVDC-------FEDDTNVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFT 195

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D D N K+ DFG  +     +A+++E     
Sbjct: 196 TQICGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAA----VLANNRE----- 244

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILH-- 284
               V  TP Y +PE++ + +    + + DIW++G+ +Y LL    PF+      I    
Sbjct: 245 RKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRI 303

Query: 285 --SKYEIPRNSF-SSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGP 341
              +Y  P++ + SS+   L+  +L  +P  RP++ ++             IDD++ +G 
Sbjct: 304 KACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREI-------------IDDVWFRGI 350

Query: 342 Y 342
           +
Sbjct: 351 F 351

>Kwal_55.21545
          Length = 865

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 130/282 (46%), Gaps = 44/282 (15%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSD--ENGLNELRNEVEV 103
           E +  G F  +YK    GY  +  +          VC  +V   D  ++ + +++ E++ 
Sbjct: 23  EVIGRGKFGVVYK----GYYTKTKQ----------VCAIKVLNLDSADDEVEDVQKEIQF 68

Query: 104 MKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVL 163
           +  L+   NI  YY    S L D K    + ++ME C  GSL   +      K+ E  + 
Sbjct: 69  LSSLKQVPNITHYY---GSYLNDTK----LWVIMEYCAGGSLRTLLR---PGKIGEQYIG 118

Query: 164 KIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIA 223
            IM ++   L H+H  +  +IHRDIK  NVL+  D + KLCDFG  +         Q +A
Sbjct: 119 VIMRELLTALMHIH--KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA 176

Query: 224 MLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAI 282
                     TP + +PE+I     +  + K DIW+LGI  Y++     P+ E+    A+
Sbjct: 177 ---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAM 225

Query: 283 -LHSKYEIPR---NSFSSKLINLVIIMLAENPYLRPNVYQVM 320
            L +K + PR      SS L  ++ + L E+P  RP+   ++
Sbjct: 226 QLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLL 267

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 138/283 (48%), Gaps = 38/283 (13%)

Query: 47  YLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKK 106
           +L EGGFA  +++         D    I     TV   +  +  E    +L +E+++ K 
Sbjct: 87  FLGEGGFARCFQIK--------DDSGEIF-AAKTVA--KASIKSEKTRKKLLSEIQIHKS 135

Query: 107 LRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           + +  NIVQ+ D         +    V +L+E+CPNGSL++ + +R    L+E EV    
Sbjct: 136 MSH-PNIVQFIDC-------FEDDSNVYILLEICPNGSLMELLKRRKV--LTEPEVRFFT 185

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             I   + +MH +R  +IHRD+K+ N+  D++ N K+ DFG     L AV +++      
Sbjct: 186 TQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-----LAAVLANES----E 234

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILH-- 284
               +  TP Y +PE++ + +    + + DIW+LG+ LY LL    PF+      I    
Sbjct: 235 RKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERI 293

Query: 285 --SKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
               +  PR+   S +   L+  +L+ +P  RP++ ++M ++ 
Sbjct: 294 KCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW 336

>Kwal_33.13112
          Length = 505

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 135/288 (46%), Gaps = 46/288 (15%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSD-ENGLNELRNEV 101
           ++ E + +G F  +Y+         +D++      G+ V +K + + + ++ ++ L  E+
Sbjct: 37  DIKECVGKGSFGDVYRA--------IDKE-----TGEMVAVKIINLEETQDDIDVLAQEI 83

Query: 102 EVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAE 161
             + +LR    +  YY +    +        + ++ME C  GS  D +      +L E +
Sbjct: 84  YFLSELR-APFVTTYYKTYVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLPENK 135

Query: 162 VLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQE 221
           V  I+ ++  GL ++H QR   IHRD+K  N+L+  +   KL DFG          S Q 
Sbjct: 136 VAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG---------VSGQI 184

Query: 222 IAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 281
           +A L  N +V  TP + +PE+I   R    +EK+DIW+LGI   +LL    P+       
Sbjct: 185 MATLKRNTFV-GTPYWMAPEIIA--RDNGYDEKADIWSLGITAMELLTGQPPYAKYDPMK 241

Query: 282 ILHSKYEIP-------RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           +L +   IP       +  F+S   + + + L ++P LRP    ++ H
Sbjct: 242 VLMN---IPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLLSH 286

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 125/274 (45%), Gaps = 42/274 (15%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-SDENGLNELRNEVEVM 104
           E +  G F  +YK    GY          ++ G    +K + + SD + + +++ E++ +
Sbjct: 27  EVIGRGKFGVVYK----GYN---------VKTGRVYAIKVLNLDSDSDEVEDVQREIQFL 73

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLK 164
             L+  SNI +YY    S L D      + ++ME C  GSL   +      K+ E  +  
Sbjct: 74  ASLKQISNITRYY---GSYLKD----TSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGV 123

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAM 224
           IM ++ V L  +H  +  +IHRDIK  NVL+  + N KLCDFG  +         Q +A 
Sbjct: 124 IMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA- 180

Query: 225 LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----ELTGQF 280
                    TP + +PE+I     +  + K DIW+LGI  Y++     P+     L    
Sbjct: 181 --------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQ 230

Query: 281 AILHSK-YEIPRNSFSSKLINLVIIMLAENPYLR 313
            I+ SK   +   S+S+ L   + + L E+P  R
Sbjct: 231 LIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 89.7 bits (221), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 151/370 (40%), Gaps = 81/370 (21%)

Query: 19  TGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPG 78
           +  L G        S+VL+      +   L EGGF+ +Y V           Q R  +  
Sbjct: 5   SSVLCGCFPCCGRNSSVLINGQHYAIQRLLGEGGFSFVYLV-----------QSR--ENN 51

Query: 79  DTVCLKRVRVSDEN--GLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLL 136
           D   LK++     N   ++E   EV   KK R+   I     S   +  DG     V +L
Sbjct: 52  DLFALKKIHCPFGNIESVSEAMREVNSYKKFRS-PYITHCVSSQVLQEQDGSK--TVFIL 108

Query: 137 MELCPNGSLLDYMNQRL--ATKLSEAEVLKIMYDI------------------------- 169
           +   P GSLLD +N  L   T +SE E+++I+  +                         
Sbjct: 109 LPYFPTGSLLDKINTHLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNT 168

Query: 170 ------TVGLSHMHYQR----------------------TPLIHRDIKIENVLVDADNNF 201
                 TV +++    R                      T   H+DIK  N++  +D   
Sbjct: 169 DLQYRDTVSMTYNEDLRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLP 228

Query: 202 KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
            +CD GS S     ++S  ++         H T  +RSPE++++     I+EK DIW+LG
Sbjct: 229 VICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLG 288

Query: 262 IFLYKLLFYTTPFE----LTGQ---FAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLR 313
             LY + F  +PFE    L+G    +AI   K+ IP N+ +S +LI ++   +  +   R
Sbjct: 289 CTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKR 348

Query: 314 PNVYQVMYHI 323
           P++ +++  +
Sbjct: 349 PSIDELLARL 358

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 142/286 (49%), Gaps = 43/286 (15%)

Query: 80  TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
            V +K V   ++  LN++  E+ ++K L N +NIV+Y+       G  +  YE+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKYH-------GFIRKSYELYILLEY 101

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
           C NGSL   ++ R +T LSE E    +    +GL ++H +   +IHRDIK  N+L+ ADN
Sbjct: 102 CANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLHGE--GVIHRDIKAANILLSADN 158

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNN--IYVHTTPQYRSPEMIDLYRCLPINEKSDI 257
             KL DFG              ++ ++N+  + +  T  + +PE++       +   SDI
Sbjct: 159 TVKLADFG--------------VSTIVNSSALTLAGTLNWMAPEILGNRGASTL---SDI 201

Query: 258 WALGIFLYKLLFYTTPF-ELTGQ---FAILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
           W+LG  + ++L    P+  LT     +A+ +  Y  P +SFS  L + +     +N Y R
Sbjct: 202 WSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYY-PPSSFSEPLKDFLSKCFVKNMYKR 260

Query: 314 PNVYQVMYHICSMMECEVKIDDL------YGQGPYNFDMYGRYQEK 353
           P   Q++ H+       VK+D L      +    Y++D    +QE+
Sbjct: 261 PTADQLLKHVWINSTENVKVDKLNKFKEDFTDADYHWD--ADFQEE 304

>Scas_580.6
          Length = 1015

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 129/274 (47%), Gaps = 42/274 (15%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-SDENGLNELRNEVEVM 104
           E +  G F  +YK    GY          ++      +K + + SDE+ + +++ EV+ +
Sbjct: 41  EVIGRGKFGIVYK----GYH---------VRTKQIYAIKVLNLDSDEDEVEDVQREVQFL 87

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLK 164
             L+   NI +YY    S L D      + ++ME C  GSL   +      K+ E  +  
Sbjct: 88  SSLKQIPNITRYY---GSYLKD----TSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGV 137

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAM 224
           IM ++ V L ++H  +  +IHRDIK  NVL+  + + KLCDFG  +    +    Q +A 
Sbjct: 138 IMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMA- 194

Query: 225 LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAI- 282
                    TP + +PE+I     +  + K DIW+LGI  Y++     P+ E+    A+ 
Sbjct: 195 --------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQ 244

Query: 283 LHSKYEIPR---NSFSSKLINLVIIMLAENPYLR 313
           L +K + PR    S++  L   + + L E+P  R
Sbjct: 245 LITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Scas_700.28
          Length = 896

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 97/197 (49%), Gaps = 24/197 (12%)

Query: 132 EVLLLMELCPNGSLLDYM--NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIK 189
           +V + +E CP   L D +    R+ T     E +++   I  G+ + H      +HRD+K
Sbjct: 103 KVWMALEYCPGKELYDRVLSMHRVPTD----ECVQLFAQIVGGVHYAH--SLNCVHRDLK 156

Query: 190 IENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCL 249
           +EN+L+D   + KL DFG T  C+                 +  T  Y +PE+I+  R  
Sbjct: 157 LENILLDKSGDAKLTDFGFTRECMTKTTLET----------ICGTTVYMAPELIE--RKS 204

Query: 250 PINEKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIM 305
               K DIW+LG+ LY ++  + PF    E   ++ I+H   ++  N  ++   +L++ +
Sbjct: 205 YDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRL 264

Query: 306 LAENPYLRPNVYQVMYH 322
           LA+NP  RP V Q++ H
Sbjct: 265 LAKNPNDRPTVEQILKH 281

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 124/276 (44%), Gaps = 44/276 (15%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSD-ENGLNELRNEVEVM 104
           E +  G F  +YK   V             +      +K + + + E+ + ++R E++ +
Sbjct: 20  EIIGRGKFGVVYKAFHV-------------KTQQVYAIKVLNLDNTEDEVEDIRKEIQFL 66

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLK 164
             L+   NI  YY    S L D K    + ++ME C  GSL   +   +   + E  +  
Sbjct: 67  SSLKQTPNITHYY---GSYLIDTK----LWVIMEYCAGGSLRTLLRPGI---IEEKYIGV 116

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAM 224
           IM +I V L  +H  R  +IHRDIK  N+L+  + + KLCDFG  +    ++   Q +A 
Sbjct: 117 IMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMA- 173

Query: 225 LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF---ELTGQFA 281
                    TP + +PE+I     +  + K DIW+LGI  Y++     P+   E      
Sbjct: 174 --------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQ 223

Query: 282 ILHSKYEIPR---NSFSSKLINLVIIMLAENPYLRP 314
           ++ +K + PR     +S  L   + + L E+P  RP
Sbjct: 224 MI-TKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 116/235 (49%), Gaps = 28/235 (11%)

Query: 91  ENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMN 150
           E+ + +++ E++ +  L+   NI +YY    S L D K    + ++ME C  GSL   + 
Sbjct: 62  EDEVEDVQKEIQFLASLKQVPNITRYY---GSYLYDTK----LWVIMEYCAGGSLRTLLR 114

Query: 151 QRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTS 210
                K+ E  +  I+  + + L ++H  +  +IHRDIK  NVL+  + + KLCDFG  +
Sbjct: 115 ---PGKIDEKYLGVIVRKLLIALVYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAA 169

Query: 211 PCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 270
               A    Q +A          TP + +PE+I     +  N K+DIW+LGI  Y++   
Sbjct: 170 QLTAANHKRQTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATG 218

Query: 271 TTPF-ELTGQFAI-LHSKYEIPR---NSFSSKLINLVIIMLAENPYLRPNVYQVM 320
             P+ ++    A+ L +K + PR    ++S  L   + + L E+P  RP    ++
Sbjct: 219 NPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLL 273

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 144/337 (42%), Gaps = 62/337 (18%)

Query: 33  STVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDEN 92
           +T+ V   +  +   L EGG + +Y V      N L   + I  P +   LK++      
Sbjct: 21  ATIRVNDKRYRIQRLLGEGGMSFVYLVQL--SKNSLIIDNGIATP-ELYALKKIICPSVE 77

Query: 93  GLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDG-KPGYEVLLLMELCPNGSLLDYMNQ 151
            ++    E+E  K+ ++   +++  DS   +  DG K  Y VL    L   GSL D +N+
Sbjct: 78  SISNGMREIENYKRFQS-PYVIKSIDSQVMQEKDGSKTIYIVLPYYSL---GSLQDSINR 133

Query: 152 RL--ATKLSEAEVLKIMYDITVGLSHMH-----------------------------YQR 180
           RL   T +SEAE ++IM  +T GL  +H                              + 
Sbjct: 134 RLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLED 193

Query: 181 TPL---------------IHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAML 225
           TPL                HRDI   N+L  +D    + D GS S     + +  +++ L
Sbjct: 194 TPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSEL 253

Query: 226 MNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ------ 279
              +  + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFE   Q      
Sbjct: 254 QEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASL 313

Query: 280 -FAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRP 314
            +AI   KY  PRNS FS  L++++   +  +P  RP
Sbjct: 314 TYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 136/282 (48%), Gaps = 47/282 (16%)

Query: 48  LAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV--SDENGLNELRNEVEVMK 105
           +  G F  +YK             DR+ Q  + V +K V +  SDE+ +  L  E+  + 
Sbjct: 24  IGRGNFGDVYKAV-----------DRVTQ--EIVAIKVVNLEHSDED-IELLAQEIFFLA 69

Query: 106 KLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKI 165
           +L+  S ++  Y   A+ L D      + ++ME C  GS  D + +     L E +V  I
Sbjct: 70  ELK--SPLITNYI--ATMLED----VSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFI 121

Query: 166 MYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAML 225
           ++++T+GL ++H QR   IHRDIK  N+L++ +   KL DFG        V+ H   + L
Sbjct: 122 IHEVTLGLKYLHEQRK--IHRDIKAANILLNEEGMVKLGDFG--------VSGHIR-STL 170

Query: 226 MNNIYVHTTPQYRSPEMIDLYRCLPI---NEKSDIWALGIFLYKLLFYTTPFELTGQFAI 282
             + +V  TP + +PE++    C  +   NEK+DIW+LGI  Y+LL    P        +
Sbjct: 171 KRDTFVG-TPYWMAPEVV----CCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKV 225

Query: 283 LHS--KYEIPR--NSFSSKLINLVIIMLAENPYLRPNVYQVM 320
           + +  K + P+    FS    + V   L + P  RP+ Y ++
Sbjct: 226 MTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLL 267

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 86.3 bits (212), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 113/219 (51%), Gaps = 28/219 (12%)

Query: 112 NIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITV 171
           NIVQ+ D         +    V +L+E+CPNGSL+D + +R    L+E EV      I  
Sbjct: 5   NIVQFIDC-------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFTTQIVG 55

Query: 172 GLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYV 231
            + +MH +R  +IHRD+K+ N+  D++ N K+ DFG     L AV ++           V
Sbjct: 56  AIKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-----LAAVLANDR----ERKYTV 104

Query: 232 HTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSK----- 286
             TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  I++ +     
Sbjct: 105 CGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGD 162

Query: 287 YEIPRNSFSSKLINLVII-MLAENPYLRPNVYQVMYHIC 324
           Y  PR   +SK + ++I  +L+ +P  RP++ ++M ++ 
Sbjct: 163 YIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW 201

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 106/236 (44%), Gaps = 41/236 (17%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSD---ENGLNELRN 99
           E+ + L +G F  +Y V             R ++ G    LK +   D    N   + R 
Sbjct: 110 EIGKVLGKGKFGRVYCV-------------RHIESGFVCALKAMEKKDIIQYNIEKQFRR 156

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           EVE+   LR+  N+ Q Y        D K    V LLME   NG L  ++  R  +  ++
Sbjct: 157 EVEIQSSLRH-PNLTQLY----GYFHDEK---RVYLLMEYLVNGELYKHLKGR--SHFND 206

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
                 +Y +   L +MH +   ++HRDIK EN+++  +N  KL DFG  S   P  +  
Sbjct: 207 VVASYYVYQMADALDYMHERN--ILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGSKR 263

Query: 220 QEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
           + +           T  Y SPE+I   R    NEK D+WALG+  Y+LL  + PFE
Sbjct: 264 KTLC---------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Kwal_56.24274
          Length = 346

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 140/338 (41%), Gaps = 70/338 (20%)

Query: 33  STVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDEN 92
           S V +   +  + + L EGG + +Y V                + G+   LK+ R     
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVES--------------KEGELFALKKTRCP--- 59

Query: 93  GLNELRNEVEVMKKLRNCSN-----IVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLD 147
               + +    MK++ N        I Q  DS   +  DG     V +L+     GSL D
Sbjct: 60  -FGSIGSISPAMKEVANYQRFSSPYIAQIVDSQVVQEKDGSK--TVYVLLPYFAKGSLQD 116

Query: 148 YMNQRL--ATKLSEAEVLKIMYDITVGLSHMH-------------------YQRTPLI-- 184
            +N+ L   T++SE ++L++   I  GL  +H                    + + L+  
Sbjct: 117 LINRHLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLND 176

Query: 185 --------------HRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIY 230
                         HRD+K  N+++  ++   + D GS S     + S Q +        
Sbjct: 177 LELDTFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSS 236

Query: 231 VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ-------FAIL 283
            + T  Y +PE++D+     I EK DIW+ G  +Y + F  +PFE   Q       +AI 
Sbjct: 237 DNCTLSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAIT 296

Query: 284 HSKYEIPR-NSFSSKLINLVIIMLAENPYLRPNVYQVM 320
             KY +PR  S+SS LI L+   L+ NP  RP+V +++
Sbjct: 297 TGKYTVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELI 334

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 143/325 (44%), Gaps = 51/325 (15%)

Query: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89
           Q  S  LV +   ++++ + EG F  +Y  +     + L  Q  +L+ G+          
Sbjct: 25  QFSSNELVDIGNYKIVKLIGEGSFGKVYLAN-----HRLTHQKVVLKTGN---------- 69

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
            +N  N +R EV   ++  +  +I + Y+   +         +V + +E CP   L +Y+
Sbjct: 70  -KNDPNVVR-EVFYHRQF-DFPHITKLYEVIVTE-------SKVWMALEYCPGKELYEYL 119

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209
              +  ++S  E  K+   I   + + H  +   +HRD+K+EN+L+D     K+ DFG T
Sbjct: 120 --LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFT 175

Query: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269
             C           ML     V  T  Y +PE+I+  R      K DIW+LG+ LY ++ 
Sbjct: 176 RECATKT-------MLET---VCGTTVYMAPELIE--RKSYDGFKIDIWSLGVILYTMIH 223

Query: 270 YTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH--- 322
            T PF    E   ++ I++ +     +  S    +L+  +L ++P  RP + QV+ H   
Sbjct: 224 GTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFL 283

Query: 323 ---ICSMMECEVKIDDLYGQGPYNF 344
                S++E   KI     Q   NF
Sbjct: 284 QPYGSSLLEASEKIIKGQRQSTTNF 308

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 134/290 (46%), Gaps = 45/290 (15%)

Query: 41  QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENG-LNELRN 99
           Q E+++ +  G F  +YK              R L   + V +K V + D +  ++ L  
Sbjct: 19  QYEILQCIGRGNFGDVYKA-------------RDLTSNEIVAIKVVNLEDTDEPIDLLAQ 65

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E+  + +LR+   I  Y     + L D      + ++ME C  GS  + +      K++E
Sbjct: 66  EIFFLSELRS-PYITNY---KTAFLVD----VSMWIVMEYCGGGSCAELLKYTPEHKVTE 117

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
            +   I+ ++ +GL ++H QR   IHRDIK  N+L+  + + KL DFG          S 
Sbjct: 118 EQCAFIVSEVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG---------VSG 166

Query: 220 QEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 279
           Q +     + +V  TP + +PE+ID  +    NE +DIW+LGI + +LL    P +   +
Sbjct: 167 QMMVTRKRDTFV-GTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLD---K 221

Query: 280 FAILHSKYEIPR-------NSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           +  + +   IP+         FSS   + V   L ++P  RP   +++ H
Sbjct: 222 YDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKH 271

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 121/274 (44%), Gaps = 42/274 (15%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-SDENGLNELRNEVEVM 104
           E +  G F  +YK    GY          ++      +K + + S E+ + +++ E++ +
Sbjct: 20  EVIGRGKFGIVYK----GYH---------VKTKQVYAIKVLNLDSSEDEVEDVQREIQFL 66

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLK 164
             L+   NI +YY       G    G  + ++ME C  GSL   +      K+ E  +  
Sbjct: 67  ASLKQIPNITRYY-------GSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGV 116

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAM 224
           IM ++ V L  +H  +  +IHRDIK  NVL+  +   KLCDFG  +         Q +A 
Sbjct: 117 IMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA- 173

Query: 225 LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----ELTGQF 280
                    TP + +PE+I     +  + K DIW+LGI  Y++     P+     L    
Sbjct: 174 --------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQ 223

Query: 281 AILHSK-YEIPRNSFSSKLINLVIIMLAENPYLR 313
            I+ SK   +   +++ +L   + + L E+P  R
Sbjct: 224 LIIKSKPPRLEERNYTPQLKEFIALCLDEDPQER 257

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 135/303 (44%), Gaps = 57/303 (18%)

Query: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89
           Q  S  L  V   ++++ + EG F  +Y    +       R+         VCLK    S
Sbjct: 29  QFTSDELTEVGNYKILKQIGEGSFGKVY----LALHRPTHRK---------VCLK---TS 72

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           D+N  N +R EV   ++  +   I + Y+   +         +V + +E CP   L D++
Sbjct: 73  DKNDPNIVR-EVFYHRQF-DFPYITKLYEVIVTE-------SKVWMALEYCPGKELYDHL 123

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSH-MHYQRTPLIHRDIKIENVLVDADNNFKLCDFGS 208
                  L E   L       V  +H MH      +HRD+K+EN+L+D + N KL DFG 
Sbjct: 124 LSLRRISLLECGELFAQISGAVYYAHSMH-----CVHRDLKLENILLDKNGNAKLTDFGF 178

Query: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268
           T  C+                 V  T  Y +PE+I+  R      K DIW+LG+ LY L+
Sbjct: 179 TRECMTKTTLET----------VCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLI 226

Query: 269 FYTTPF----ELTGQFAILHSKYEIPRNSFSSKLI-----NLVIIMLAENPYLRPNVYQV 319
               PF    E   ++ I++   E P+  + +K+I     +L+  +LA+NP  RP++ QV
Sbjct: 227 TGYLPFDDDDEAKTKWKIVN---EEPK--YDAKVIPDDARDLISRLLAKNPGERPSLSQV 281

Query: 320 MYH 322
           + H
Sbjct: 282 LRH 284

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 95/351 (27%), Positives = 152/351 (43%), Gaps = 69/351 (19%)

Query: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89
           Q  S+ L  V   ++ + + EG F  +Y       T+   +Q  +L+ GD         S
Sbjct: 30  QFSSSELTEVGNYKIQKQIGEGSFGKVYLA-----THRPTKQKVVLKTGDK--------S 76

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           D N + E+        +  +   I + Y+   +         +V + +E CP   L D++
Sbjct: 77  DPNVVREV-----FYHRQFDYPYITKLYEVIVTET-------KVWMALEYCPGKELYDHL 124

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRT-PLIHRDIKIENVLVDADNNFKLCDFGS 208
             +  ++L   E  ++   IT     +HY  T   +HRD+K+ENVL+D + N KL DFG 
Sbjct: 125 LSK--SRLPTLECAELFAQIT---GAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGF 179

Query: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKL 267
           T   +         A+L     V  T  Y +PEMI   +  P +  K DIW+LG+ LY L
Sbjct: 180 TRESMTK-------AVLET---VCGTTVYMAPEMI---QHKPYDGFKVDIWSLGVILYTL 226

Query: 268 LFYTTPFE-----LTGQFAI-----LHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVY 317
           L    PF+     LT Q  I     +  +  IP         NL+  +L+++P  RPN  
Sbjct: 227 LCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQ------NLIEQLLSKDPTERPNTS 280

Query: 318 QVMYH------ICSMMECEVKIDDLYGQGPYNFD--MYGRYQEKLQRLQYD 360
            ++ H         ++E   KI     QG   F   +  R  +K++R+ YD
Sbjct: 281 AILLHPFLQPYGTLILEQTNKIILKQKQGGSQFSSRLERRLIKKMKRIGYD 331

>Scas_598.6
          Length = 790

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 134/300 (44%), Gaps = 36/300 (12%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYT-NELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEV 101
           ++IE   +G    +Y    +     E D    +   GD V +K++ +S +     + NE+
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFDETPEV---GDKVAIKQMILSKQPRKELIVNEI 559

Query: 102 EVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK----- 156
            VMK  R+  NIV + ++      D      + ++ME    GSL D +    AT      
Sbjct: 560 LVMKDSRH-KNIVNFLEAYLKTEDD------LWVVMEFMEGGSLTDIIENSPATGSSSSP 612

Query: 157 LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAV 216
           L+E ++  I+ +   GL  +H +   +IHRDIK +NVL+D +   K+ DFG    C    
Sbjct: 613 LTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDNNARVKITDFGF---CAKLT 667

Query: 217 ASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-- 274
               + A ++       TP + +PE++        +EK D+W+LGI   ++L    P+  
Sbjct: 668 DQRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPYLN 718

Query: 275 --ELTGQFAILHSKYEIPRN--SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330
              L   + I  +     +N  S S ++   + + L  +   R +  ++++H    M CE
Sbjct: 719 EDPLKALYLIATNGTPKLKNPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFDMACE 778

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 101/197 (51%), Gaps = 34/197 (17%)

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL--LDYMNQR 152
           N+L  E+ +MK ++   NIV +Y +  + + +    +E+++LME    GSL  +    +R
Sbjct: 236 NQLMRELTIMKNVKEQKNIVGFYGAYYTAIKN----HEIIILMEYMDCGSLDKISSTYRR 291

Query: 153 LATK-----------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNF 201
             ++            +E  + KI Y +  GLS++ YQ   +IHRDIK  N+L+++    
Sbjct: 292 YCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNILINSKGFV 350

Query: 202 KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           K+CDFG +   + ++A          + +V T+  Y SPE I    C   N K D+W+LG
Sbjct: 351 KICDFGVSKKMIDSIA----------DTFVGTS-TYMSPERIQ-GSCY--NTKGDVWSLG 396

Query: 262 IFLYKLLFYTTPFELTG 278
           + + +L+  T  F L G
Sbjct: 397 LMIIELV--TGEFPLGG 411

>Kwal_47.17263
          Length = 1127

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 128/290 (44%), Gaps = 55/290 (18%)

Query: 92  NGLNELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           NG ++++ E+ +MKK    +   +V+  D + SR        ++ L++E C  G +    
Sbjct: 153 NGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSR--------KIYLVLEYCSKGEVKWCP 204

Query: 150 NQRLATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKL 203
             +L T+      L+     +I   + +GL ++HYQ   +IHRDIK  N+L+      K+
Sbjct: 205 GDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQ--GIIHRDIKPANLLISESGTVKI 262

Query: 204 CDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY----RCLP--------- 250
            DFG +     + A +  +  L        TP + +PE+   +    R  P         
Sbjct: 263 SDFGVSFAASKSGAGYGSLDEL-ELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGS 321

Query: 251 -INEKSDIWALGIFLYKLLFYTTPF----------ELTGQFAILHSKYEIPRNSFSSKLI 299
            I+   DIWA+G+ L+ LLF   PF          ++  Q  +L +  E+  N   SK+ 
Sbjct: 322 IISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGI-SKIS 380

Query: 300 N---------LVIIMLAENPYLRPNVYQVMYH--ICSMMECEVKIDDLYG 338
           N         L+  +L +NP+ R  + ++  H  +C   E +V  D+  G
Sbjct: 381 NQEEYEAAKDLLGRLLTKNPFKRIKIAEIKKHPFVCWDFEHDVTSDNNSG 430

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 135/297 (45%), Gaps = 34/297 (11%)

Query: 36  LVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENG-L 94
           ++ + Q +++E + +G F  +Y   ++G   E    D  +     + +K + +   N  +
Sbjct: 1   MLSLQQFQLLECVGKGNFGDVYLAHYLGSNQE--PTDPKIPKNVPLAIKCINLEHSNEPI 58

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
           + L  E+  +  L +C  I  YY    +  GD      + ++ME C NGSLL+ +  R  
Sbjct: 59  DLLLKEIYFLSTL-HCPYITHYY---GTFTGDC----NLYIVMEYCSNGSLLNLL--RYY 108

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLP 214
           ++L+E     I+  +   L ++H +R  LIHRD+K  N+L++ D   +L D G T     
Sbjct: 109 SRLTEQTTCFIILQVCHALEYLHEKR--LIHRDLKAANILLNDDGEVRLADLGVTGQLKF 166

Query: 215 AVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
               H    +   N +V  TP + +PE+I   +    + K DIW+LGI   +LL    P 
Sbjct: 167 NSTRHGGKNL---NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPM 219

Query: 275 ELTGQFAILHSKYEIPRNSFSSKLINLVI---------IMLAENPYLRPNVYQVMYH 322
                   + +   IP+ +  S L N+ I           L ++P  RP   Q++ H
Sbjct: 220 ---SHLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQH 273

>Kwal_26.7355
          Length = 1446

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 134/308 (43%), Gaps = 64/308 (20%)

Query: 46   EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-----SDENGLN---EL 97
            E + +G F  +    F+G           +  G+ + +K+V V      DE  L+    L
Sbjct: 1150 EMIGKGSFGSV----FLGLN---------VTTGEMIAVKQVEVPRYGSQDETTLSVLEAL 1196

Query: 98   RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKL 157
            R+EV  +K L + +NIVQY       LG     Y   L +E    GS+   +  RL  K 
Sbjct: 1197 RSEVATLKDL-DHTNIVQY-------LGFENKNYVYSLFLEYVAGGSVGSLI--RLYGKF 1246

Query: 158  SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
             E  +  +   +  GLS++H ++  ++HRD+K +N+L+D D   K+ DFG          
Sbjct: 1247 DENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDFG---------- 1294

Query: 218  SHQEIAMLMNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271
                I+   NNIY ++      T  + +PEM+D  +    + K DIW+LG  + ++    
Sbjct: 1295 ----ISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGK 1348

Query: 272  TPFE----LTGQFAILHSKYEIPRNSFSSKLIN-----LVIIMLAENPYLRPNVYQVMYH 322
             P+     +   F I   K   P    + K+I+      +      NP  RP   +++ H
Sbjct: 1349 RPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELLSH 1408

Query: 323  ICSMMECE 330
               +++ E
Sbjct: 1409 PFCIVDKE 1416

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 109/228 (47%), Gaps = 32/228 (14%)

Query: 103 VMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEV 162
           ++ KL N  N+++ YD         +   ++ +++E    G L + + QR    L E E 
Sbjct: 80  IIMKLLNHPNVLRLYDV-------WETAQDLYMVLEYVEKGELFNLLVQR--GPLPENEA 130

Query: 163 LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           ++    I +G+S+ H     ++HRD+K EN+L+D   N KL DFG     + A+ S  ++
Sbjct: 131 VRFFRQIIIGISYCHA--LGIVHRDLKPENLLLDHKFNIKLADFG-----MAALESKDKL 183

Query: 223 AMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF-ELTGQ- 279
                      +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF E  G  
Sbjct: 184 LETSCG-----SPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNI 235

Query: 280 ----FAILHSKYEIP-RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
                 +   KYEIP  +  S +  +L++ +L   P  R    +++ H
Sbjct: 236 RNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 97/194 (50%), Gaps = 20/194 (10%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           V +++E C    L +++ +    +LS  E  K+   I   + + H      +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLKE--QRLSLEESKKLFSQIASAVYYAH--ELKCVHRDLKLEN 158

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           VL+D + + KL DFG T          +E+A       +  T  Y +PE+I+  +C    
Sbjct: 159 VLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMAPELIE-RKCYD-G 206

Query: 253 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAE 308
            K DIW+LGI LY ++    PF    ++  +  I++ + +  +   S   I+L+  ML +
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRK 266

Query: 309 NPYLRPNVYQVMYH 322
           NP  R ++ QV+ H
Sbjct: 267 NPNERISLAQVLSH 280

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 97/214 (45%), Gaps = 31/214 (14%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           V + +E CP   L DY+   L  ++   E  ++   I   + + H      +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAH--SLQCVHRDLKLEN 158

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           +L+D +    L DFG T  C  A  +  E         V  T  Y +PE+I   R     
Sbjct: 159 ILLDKNGYAMLTDFGFTREC--ATKTQLET--------VCGTTVYMAPELIK--REAYDG 206

Query: 253 EKSDIWALGIFLYKLLFYTTPFE-----LTGQFAILHSKYEIPRNSFSSKLINLVIIMLA 307
            K D W+LGI LY +L    PF+      TG   I+H +  +     S +  +L++ +L 
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTG-LKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 308 ENPYLRPNVYQVMYH---------ICSMMECEVK 332
           +N   RPN+ +V+ H         +   +EC +K
Sbjct: 266 KNAAQRPNLNEVLQHPFLQPYGALLLETVECLIK 299

>Scas_707.36
          Length = 915

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 105/222 (47%), Gaps = 39/222 (17%)

Query: 95  NELRNEVEVMKKLRN--CSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLD----- 147
           N+++ E+ +MKK  N     +++  D  +SR        ++ L++E C  G +L      
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSR--------KIYLVLEYCEKGPILWCPRDQ 193

Query: 148 -YMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
             ++ R   +LS     +I  D+ +GL ++H Q   +IHRDIK  N+L+D +   K+ DF
Sbjct: 194 LEIDSRGPPQLSFQRAREIFRDVILGLEYLHSQ--GIIHRDIKPANLLMDKNGVVKISDF 251

Query: 207 GSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--------------DLYRCLPIN 252
           G +      + ++ +   L   +    TP + +PE+               +L+    I+
Sbjct: 252 GVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNGSCIS 308

Query: 253 EKSDIWALGIFLYKLLF----YTTPFELTGQFAILHSKYEIP 290
            K DIWALGI LY LLF    + + FEL     I++ K   P
Sbjct: 309 FKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP 350

>Kwal_26.8751
          Length = 848

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           V + +E CP   L +Y+   LA K    E    ++   VG  + +      +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL---LAKKHIPLEECSELFSQIVGAVY-YAHSMKCVHRDLKLEN 158

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           +L+D   + KL DFG T  C  A     E         +  T  Y +PE+I+  R     
Sbjct: 159 ILLDKKGHAKLTDFGFTREC--ATKGILET--------ICGTTVYMAPELIE--RKPYEG 206

Query: 253 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAE 308
            K D W+LGI LY ++  T PF    E+  ++ I+H       +   S    L+  +L +
Sbjct: 207 YKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEK 266

Query: 309 NPYLRPNVYQVMYH 322
           +P  RP++ QV+ H
Sbjct: 267 DPNQRPSLTQVLQH 280

>Scas_693.17
          Length = 1049

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 98/201 (48%), Gaps = 23/201 (11%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q  + K S A        I   L ++H     ++HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTF--TRQICSALKYLHSHN--IVHRDLKIENIM 232

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP-INE 253
           +  D N KL DFG ++          ++     ++Y      + +PE++   +  P I  
Sbjct: 233 ISKDGNIKLIDFGLSN----LYDKCNKLKTYCGSLY------FAAPELL---KATPYIGP 279

Query: 254 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSF----SSKLINLVIIMLAEN 309
           + D+W+ G+ LY L+    PF+      +LH K +  +  +    S ++I+L+  ML  +
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVD 338

Query: 310 PYLRPNVYQVMYHICSMMECE 330
           P+ R  + QVM H   + +C+
Sbjct: 339 PFKRATLDQVMNHHWMVRDCD 359

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 145/314 (46%), Gaps = 55/314 (17%)

Query: 19  TGALTGPLEMLQAGSTVLVG--VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQ 76
           TG    P  M + GS + +G  + + +VI+ L EG F    KV    + +          
Sbjct: 15  TGGRNMPHGMHRPGS-IPIGQRIGKYQVIKTLGEGSFG---KVKLAHHVS---------- 60

Query: 77  PGDTVCLKRVR---VSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEV 133
            G  V LK +    ++  +    +  E+  ++ LR+  +I++ YD   S+        E+
Sbjct: 61  TGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRH-PHIIKLYDVIKSK-------DEI 112

Query: 134 LLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENV 193
           ++++E   N  L DY+ QR   K+SE E  +    I   + + H  R  ++HRD+K EN+
Sbjct: 113 IMVIEYAGN-ELFDYIVQR--DKMSENEARRFFQQIISAVEYCH--RHKIVHRDLKPENL 167

Query: 194 LVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLP 250
           L+D   N K+ DFG ++             ++ +  ++ T   +P Y +PE+I     L 
Sbjct: 168 LLDEHLNVKIADFGLSN-------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLY 212

Query: 251 INEKSDIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEIPRNSFSSKLINLVIIML 306
              + D+W+ G+ LY +L    PF+   +   F  I +  Y IP+   S    NL+  ML
Sbjct: 213 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPK-FLSQGAANLIKRML 271

Query: 307 AENPYLRPNVYQVM 320
             NP  R  ++++M
Sbjct: 272 IVNPLNRITIHEIM 285

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 101/198 (51%), Gaps = 36/198 (18%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMN--Q 151
           +N+L  E+ ++K ++   NI+ +Y +  ++        E+++LME    GSL   ++  +
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAYYNQ----HINNEIIILMEYSDCGSLDKILSVYK 287

Query: 152 RLA---------TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFK 202
           R           T  +E  + KI Y +  GL H+ Y++  +IHRDIK  NVL+++    K
Sbjct: 288 RFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIK 346

Query: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWAL 260
           LCDFG +   + ++A          + +V T+  Y SPE I  ++Y       K D+W+L
Sbjct: 347 LCDFGVSKKLINSIA----------DTFVGTST-YMSPERIQGNVYSI-----KGDVWSL 390

Query: 261 GIFLYKLLFYTTPFELTG 278
           G+ + +L+  T  F L G
Sbjct: 391 GLMIIELV--TGEFPLGG 406

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 138/286 (48%), Gaps = 45/286 (15%)

Query: 41  QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNE 100
           Q ++ + +  G +  +YK      TN+   Q+        V +K V   D++ L ++ +E
Sbjct: 21  QYQLRQIIGRGSYGVVYKA-----TNKKTAQE--------VAIKEVNYQDDDELVDIMSE 67

Query: 101 VEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEA 160
           ++++K L N  NIV+Y+       G  +  + + +++E C  GSL + +++     +SE 
Sbjct: 68  IDLLKNL-NHINIVKYH-------GFIQKQHNLYIILEYCAKGSLKNLISRN--RPMSEH 117

Query: 161 EVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQ 220
           E    +     GL+++H Q   +IHRDIK  N+L+D++N  KL DFG ++          
Sbjct: 118 EAKPYVRQTLNGLNYLHEQ--GVIHRDIKAANILLDSENVVKLADFGVSTKV-------N 168

Query: 221 EIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----EL 276
             AM +       +  + +PE+I       +   SDIW+LG  + +LL    PF    ++
Sbjct: 169 NTAMTL-----AGSLNWMAPEIIGNRGASTL---SDIWSLGATVVELLTGNPPFHNLIDM 220

Query: 277 TGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
              +AI +  Y  P +S SS   + +    A+N Y RP   Q++ H
Sbjct: 221 NIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNMYKRPTAVQLLQH 265

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q     L E    K    I   L ++H     ++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENIM 212

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           + +    ++ DFG ++   P     +++     ++Y      + +PE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPK----KQLHTFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPRNSFSSKLINLVIIMLAEN 309
            DIW+ G+ LY L+    PF+     ++LH      K E P++  S  +I+L+  ML  +
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQH-LSIDVISLLSKMLVVD 318

Query: 310 PYLRPNVYQVMYH 322
           PY R  + QV++H
Sbjct: 319 PYKRATLKQVVHH 331

>Kwal_55.20326
          Length = 750

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 100/201 (49%), Gaps = 24/201 (11%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           ++ L++E+ ++K+L++  NIV YY       G  + G  + + +E  P GS+   +N   
Sbjct: 531 VDALQHEMGLLKELQH-ENIVTYY-------GSSQEGGNLNIFLEYVPGGSVSSMLNS-- 580

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
                E  +      I +GLS++H  R  +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 581 YGPFEEPLIRNFTRQILIGLSYLH--RKDIIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
           P      + A L  ++Y      + +PE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 274 FELTGQFAILHSKYEIPRNSF 294
           F     F+ + + ++I  N+F
Sbjct: 690 FP---DFSQMQAIFKIGTNTF 707

>Kwal_56.22693
          Length = 984

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 96/195 (49%), Gaps = 15/195 (7%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  L+E  PNG  L  + +     LS+   +     I   + ++H++   ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIKK--FGSLSQECAVYYSAQILDAIDYLHHK--GIVHRDIKPEN 287

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI-DLYRCLPI 251
           +L+D D   KL DFG T+  L    + Q   +L  +     T +Y SPE++ D Y    +
Sbjct: 288 ILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 252 NEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPRNSFSSKLINLVIIMLA 307
           + K DIWA G  L++++    PF+ T ++     ++  +Y      F   + +L+  +L 
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFT-AGFPLVIRDLIKKILV 401

Query: 308 ENPYLRPNVYQVMYH 322
           ++P  R +  Q+  H
Sbjct: 402 KSPEQRLDASQIKKH 416

>Kwal_23.6325
          Length = 1542

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 127/270 (47%), Gaps = 43/270 (15%)

Query: 75   LQPGDTVCLKRVRVSDENGLNE----LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPG 130
            L  G+ + +K +++ D   + +    ++ E+ V++ L N  N+VQYY     R       
Sbjct: 1269 LDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEML-NHPNVVQYYGVEVHR------- 1320

Query: 131  YEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITV--GLSHMHYQRTPLIHRDI 188
             +V L ME C  GSL     Q L     E E++  +Y + +  GL+++H  ++ ++HRDI
Sbjct: 1321 DKVNLFMEYCEGGSLA----QLLEHGRIEDEMVTQIYALQMLEGLAYLH--QSSVVHRDI 1374

Query: 189  KIENVLVDADNNFKLCDFGST---------SPCLPAVASHQEIAMLMNNIYVHTTPQYRS 239
            K EN+L+D +   K  DFG+          +P + A      +  +M       TP Y S
Sbjct: 1375 KPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMG------TPMYMS 1428

Query: 240  PEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP-FELTGQFAILH--SKYEIP----RN 292
            PE I   +        DIW+LG  + +++    P F L  ++AI++  +   +P    + 
Sbjct: 1429 PESITGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKE 1487

Query: 293  SFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
              S + I+ ++  L ++P  R    +++ H
Sbjct: 1488 ELSPQGIDFLLRCLKQDPNKRSTAMELLLH 1517

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 140/308 (45%), Gaps = 40/308 (12%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDR----QDRILQP--GDTVCLKRVRVSDENGLNE 96
           +VIE   +G    +Y         E +      + I +P  GD V +K++ +S +     
Sbjct: 547 KVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKEL 606

Query: 97  LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM-----NQ 151
           + NE+ VMK  R+  NIV + ++   R  D     ++ ++ME    GSL D +     N 
Sbjct: 607 IVNEILVMKDSRH-KNIVNFLEAYL-RTDD-----DLWVVMEFMEGGSLTDIIENSPTND 659

Query: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211
              + L+E ++  I+ +   GL  +H +   +IHRDIK +NVL+D     K+ DFG    
Sbjct: 660 NSHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFGF--- 714

Query: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271
           C        + A ++       TP + +PE++   +    +EK D+W+LGI   ++L   
Sbjct: 715 CARLTDKRSKRATMVG------TPYWMAPEVV---KQREYDEKIDVWSLGIMTIEMLEGE 765

Query: 272 TPF----ELTGQFAILHS---KYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324
            P+     L   + I  +   K + P  S S ++   + + L  +   R +  ++++H  
Sbjct: 766 PPYLNEDPLKALYLIATNGTPKLKHPE-SLSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824

Query: 325 SMMECEVK 332
             M C+ K
Sbjct: 825 FNMACDPK 832

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 93/201 (46%), Gaps = 32/201 (15%)

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
           E+ L++E    G L DY+  R   KL E E +     I  G+S+ H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 192 NVLVDADN-NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT---PQYRSPEMI--DL 245
           N+L+D  N   K+ DFG               A+   N  + T+   P Y SPE++    
Sbjct: 194 NLLLDKKNKTVKIADFGMA-------------ALETTNRLLETSCGSPHYASPEIVMGQK 240

Query: 246 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPRNSFSSKLINL 301
           Y   P    SD+W+ GI L+ LL    PF       +L    H +Y++P N  S +  +L
Sbjct: 241 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN-VSKEAKDL 295

Query: 302 VIIMLAENPYLRPNVYQVMYH 322
           +  +L  +P  R  V +++ H
Sbjct: 296 ISKILVVDPEKRITVDKILEH 316

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 110/228 (48%), Gaps = 32/228 (14%)

Query: 103 VMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEV 162
           ++ KL N  N+++ YD         +   ++ +++E    G L + + +R    L E E 
Sbjct: 78  IIMKLLNHPNVLRLYDV-------WETSKDLYMVLEYVEKGELFNLLVER--GPLPENEA 128

Query: 163 LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           ++    I +G+S+ H     ++HRD+K EN+L+D   N KL DFG     + A+ S  ++
Sbjct: 129 VRFFRQIIIGISYCHA--LGIVHRDLKPENLLLDHKFNVKLADFG-----MAALESKDKL 181

Query: 223 AMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF-ELTGQ- 279
                      +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF E  G  
Sbjct: 182 LETSCG-----SPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNI 233

Query: 280 ----FAILHSKYEIP-RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
                 +   K+E+P  +  SS+  +L+  +L  +P  R    +++ H
Sbjct: 234 RNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 136/307 (44%), Gaps = 49/307 (15%)

Query: 44  VIEYLAEGGFAHIY---KVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNE 100
           ++E   +G    +Y   ++    Y +EL+ +   L  G+ V +K++ +S +     + NE
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQL--GNKVAIKQMILSKQPRKELIVNE 647

Query: 101 VEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA-----T 155
           + VMK  ++ +NIV + ++      D      + ++ME    GSL D +          +
Sbjct: 648 ILVMKDSKH-NNIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSGQS 700

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
            L+E ++  I+ +   GL  +H +   +IHRDIK +NVL+D     K+ DFG    C   
Sbjct: 701 PLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRGRVKITDFGF---CAKL 755

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 274
                + A ++       TP + +PE++   +    +EK D+W+LGI   ++L    P+ 
Sbjct: 756 TDKRSKRATMVG------TPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPYL 806

Query: 275 -----------ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323
                         G   + H +Y       S ++   + + L  +   R +  ++++H 
Sbjct: 807 NEEPLKALYLIATNGTPKLKHPEY------LSLEIKRFLSVCLCVDVKYRASTEELLHHS 860

Query: 324 CSMMECE 330
              M CE
Sbjct: 861 FFNMSCE 867

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  L+E  PNG  L  M +R  T LSE         I   + H+H Q   +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSEECTKYYGAQILDAIHHLHKQ--GIIHRDVKPEN 331

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI-DLYRCLPI 251
           +L+D     KL DFG T+  +     ++   +   +     T +Y SPE++ D Y    +
Sbjct: 332 ILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY----V 386

Query: 252 NEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPRNSFSSKLINLVIIMLA 307
           + + DIWA G  L++++    PF+ T ++     ++  +Y      F   L +L+  +L 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFT-AGFPMILRDLIKQLLV 445

Query: 308 ENPYLRPNVYQVMYH 322
           + P  R  + Q+  H
Sbjct: 446 KKPEQRLTILQIEKH 460

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 123/277 (44%), Gaps = 33/277 (11%)

Query: 18  GTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP 77
           G+G+       + A +  L+ V QVE+       G         V   +E  ++ +I   
Sbjct: 443 GSGSFGSVYLGMNAQTGELMAVKQVELQPSAVTAG---------VMPASEETKKQQIQVA 493

Query: 78  GDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLM 137
             T   K      +  ++ L++E+ ++K+L +  NIV YY       G  + G  + + +
Sbjct: 494 NGTAAAKNTSQIHKKMIDALQHEMNLLKELHH-ENIVTYY-------GSSQEGGNLNIFL 545

Query: 138 ELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA 197
           E  P GS+   +N        E  +      I +GL+++H  R  +IHRDIK  NVL+D 
Sbjct: 546 EYVPGGSVSSMLNN--YGPFEEPLIKNFTRQILIGLAYLH--RKNIIHRDIKGANVLIDI 601

Query: 198 DNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 257
               K+ DFG +    P      + A L  ++Y      + +PE++   + +   EK+DI
Sbjct: 602 KGCVKITDFGISKKLSPLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADI 652

Query: 258 WALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSF 294
           W++G  + ++     PF     F+ + + ++I  N+ 
Sbjct: 653 WSVGCLVVEMFTGKHPFP---DFSQMQAIFKIGTNTI 686

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 136/292 (46%), Gaps = 52/292 (17%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR---VSDENGLN 95
           + + ++I+ L EG F  + K+++             +  G  V LK +    ++  +   
Sbjct: 32  IGKYQIIKTLGEGSFGKV-KLAYH------------ISTGQKVALKIINKKVLAKSDMQG 78

Query: 96  ELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
            +  E+  ++ LR+  +I++ YD   S+        E+++++E   N  L DY+ QR   
Sbjct: 79  RIEREISYLRLLRH-PHIIKLYDVIKSK-------DEIIMVIEYAGN-ELFDYIVQR--D 127

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
           K+ E E  +    I   + + H  R  ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 128 KMPEQEARRFFQQIISAVDYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 180

Query: 216 VASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
                   ++ +  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    
Sbjct: 181 --------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRL 230

Query: 273 PFE---LTGQFA-ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
           PF+   +   F  I +  Y IP N  S    +L+  ML  NP  R  V+++M
Sbjct: 231 PFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITVHEIM 281

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 100/199 (50%), Gaps = 31/199 (15%)

Query: 79  DTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLME 138
           D+V +K++ +  +     + NE+ VM++ ++ SNIV + DS  ++ GD      + ++ME
Sbjct: 644 DSVAIKQMNLEKQPKKELILNEILVMRESKH-SNIVNFIDSYLAK-GD------LWIVME 695

Query: 139 LCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDAD 198
               GSL D +   L   LSE ++  +  +   GL  +H +   ++HRDIK +N+L+   
Sbjct: 696 YMEGGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLK 750

Query: 199 NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKS 255
            N KL DFG         A   E     NN+   T   TP + +PE++      P   K 
Sbjct: 751 GNIKLTDFG-------FCAQINE-----NNLKRTTMVGTPYWMAPEVVSRKEYGP---KV 795

Query: 256 DIWALGIFLYKLLFYTTPF 274
           DIW+LGI + +++    P+
Sbjct: 796 DIWSLGIMIIEMIEGEPPY 814

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 33/203 (16%)

Query: 95  NELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLL----DY 148
           ++++ E+ +MKK   ++   +++  D   SR        ++ L++E C  G +     D 
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSR--------KIYLVLEYCSRGEVKWCPPDC 238

Query: 149 M--NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
           M  + +  + LS  E  +I+  + +GL ++HYQ   +IHRDIK  N+L+  D   K+ DF
Sbjct: 239 MESDAKGPSLLSFQETREILRGVVLGLEYLHYQ--GIIHRDIKPANLLISGDGTVKISDF 296

Query: 207 G-STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--------------DLYRCLPI 251
           G S +      +   E    +       TP + +PEM               +L+R   I
Sbjct: 297 GVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCI 356

Query: 252 NEKSDIWALGIFLYKLLFYTTPF 274
           +   DIWA+G+ LY LLF   PF
Sbjct: 357 SFMIDIWAVGVTLYCLLFGMLPF 379

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 119/276 (43%), Gaps = 36/276 (13%)

Query: 18  GTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP 77
           G+G+       + A +  L+ V QVE+       G   I            D   +   P
Sbjct: 446 GSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIA-----------DESKKAHSP 494

Query: 78  GD-TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLL 136
           G     +K         ++ L++E+ ++K+L +  NIV YY       G  + G  + + 
Sbjct: 495 GGGNTAVKNTSQIHRKMIDALQHEMNILKELHH-ENIVTYY-------GSSQEGGNLNIF 546

Query: 137 MELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVD 196
           +E  P GS+   +N        E  V      I +GL+++H  +  +IHRDIK  N+L+D
Sbjct: 547 LEYVPGGSVSSMLNN--YGPFDEPLVKNFTRQILIGLAYLH--KRNIIHRDIKGANILID 602

Query: 197 ADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSD 256
                K+ DFG +    P      + A L  ++Y      + +PE++   + +   EK+D
Sbjct: 603 IKGGVKITDFGISKKLSPLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKAD 653

Query: 257 IWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRN 292
           IW++G  + ++     PF     F+ + + ++I  N
Sbjct: 654 IWSVGCVIVEMFTGKHPFP---DFSQMQAIFKIGTN 686

>Kwal_47.18233
          Length = 598

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 137/292 (46%), Gaps = 52/292 (17%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR---VSDENGLN 95
           + + ++I+ L EG F  + K+++   T            G  V LK +    ++  +   
Sbjct: 28  IGKYQIIKTLGEGSFGKV-KLAYHVTT------------GQKVALKIINKKVLAKSDMQG 74

Query: 96  ELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
            +  E+  ++ LR+  +I++ YD   S+        E+++++E   N  L DY+ QR   
Sbjct: 75  RIEREISYLRLLRH-PHIIKLYDVVKSK-------DEIVMVIEYAGN-ELFDYIVQR--D 123

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
           K+SE E  +    I   + + H  R  ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 124 KMSENEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 176

Query: 216 VASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
                   ++ +  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    
Sbjct: 177 --------IMTDGNFLRTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRL 226

Query: 273 PFE---LTGQFA-ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
           PF+   +   F  I +  Y +P+   S    NL+  ML  NP  R  ++++M
Sbjct: 227 PFDDESIPVLFKNISNGIYTLPK-FLSPGAANLIKRMLIVNPLNRITIHEIM 277

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 105/230 (45%), Gaps = 23/230 (10%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E   +++L N   IV+ + +      D    Y    L+E  PNG  L  M +  +  LSE
Sbjct: 230 EKNALQRLNNSRGIVKLFFT----FQDESSLY---FLLEYAPNGDFLSVMKKYGS--LSE 280

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
                    I  G+ ++H +   +IHRDIK EN+L+D D   K+ DFG+     P     
Sbjct: 281 DCTRYYSAQIIDGIKYLHSK--GIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDE 338

Query: 220 Q--EIAMLMNNIYVHTTPQYRSPEMI-DLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 276
              E  +L  +     T +Y SPE++ D Y    ++ + DIWA G  +++++    PF+ 
Sbjct: 339 DNPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKA 394

Query: 277 TGQF----AILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           T ++     ++  +Y      F   + +LV  +L + P  R  + Q+  H
Sbjct: 395 TNEYLTFQKVMKVQYAFTA-GFPVVVRDLVKRILLKVPEQRLTIPQIEKH 443

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 80  TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           +V +K++ +  +     + NE+ VMK  R+ +NIV + DS   + GD      + ++ME 
Sbjct: 708 SVAIKQMNLEKQPKKELIINEILVMKGSRH-NNIVNFIDSYLLK-GD------LWVIMEY 759

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
              GSL D +   +   L+E ++  +  +   GL  +H +   +IHRDIK +N+L+  D 
Sbjct: 760 MEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLHSKG--VIHRDIKSDNILLSMDG 814

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
           N KL DFG    C     ++ +   ++       TP + +PE++      P   K DIW+
Sbjct: 815 NIKLTDFGF---CAQINETNLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWS 862

Query: 260 LGIFLYKLLFYTTPF 274
           LGI + +++    P+
Sbjct: 863 LGIMIIEMIEGEPPY 877

>Kwal_56.23717
          Length = 858

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 93/193 (48%), Gaps = 23/193 (11%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q     L E    K    I   L ++H     ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENIM 65

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +      K+ DFG ++   P     +++     ++Y      + +PE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPK----KQLHTFCGSLY------FAAPEL--LKACPYTGPE 113

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPRNSFSSKLINLVIIMLAEN 309
            D+W+ G+ L+ L+    PF+     ++LH      K E P++  S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH-LSIEVISLLSKMLVVD 171

Query: 310 PYLRPNVYQVMYH 322
           P  R ++ QV+ H
Sbjct: 172 PTKRASLKQVVNH 184

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 136/322 (42%), Gaps = 75/322 (23%)

Query: 95  NELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
           ++++ E+ +MKK   ++   +++  D   SR        ++ L++E C  G +       
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSR--------KIYLVLEYCSRGEVKWCPPDC 245

Query: 153 LATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
           L T+      LS     +I+  + +GL ++HYQ   +IHRDIK  N+L+      K+ DF
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHYQ--GIIHRDIKPANLLLSETGIVKISDF 303

Query: 207 G-STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--------------DLYRCLPI 251
           G S +     V    E    +       TP + +PE+               +L++   I
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 252 NEKSDIWALGIFLYKLLF----YTTPFELTGQFAILHSKYEIPRNSFSSKLIN------- 300
           + K DIWALG+ LY L+F    + + FEL     I++   + P+  +S  L N       
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPK--YSDMLKNNQVLQMT 421

Query: 301 ----------LVIIMLAENPYLRPNVYQVMYH--ICSMMECEVKIDDLYGQGPYNFDMYG 348
                     L+  +L +NP  R N+ ++  H  +C                 ++FD   
Sbjct: 422 EEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFVC-----------------WDFDHLD 464

Query: 349 RYQEKLQRLQYDMLMSHQLAQR 370
              E+   L+ +  M+ Q AQR
Sbjct: 465 GESEQELSLKLEEKMNFQCAQR 486

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 77/146 (52%), Gaps = 20/146 (13%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           + +++E    G    Y+ ++   +L E+   ++   +  G+++MH +   L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYIQRK--RRLKESTACRLFAQLISGVTYMHSKN--LVHRDLKLEN 183

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCL 249
           +L+D + N  + DFG  +  LP            +N Y+ T   +P Y +PE++   R  
Sbjct: 184 LLLDKNENLVITDFGFVNEFLP------------DNEYMKTSCGSPCYAAPELVISTRPY 231

Query: 250 PINEKSDIWALGIFLYKLLFYTTPFE 275
            +  K+D+W+ GI LY +L    P++
Sbjct: 232 -VARKADVWSCGIILYAMLAGYLPWD 256

>Kwal_23.5290
          Length = 819

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 135/307 (43%), Gaps = 44/307 (14%)

Query: 43  EVIEYLAEGGFAHIY---KVSFVGYTNELDRQDRILQP--GDTVCLKRVRVSDENGLNEL 97
           +++E   +G    +Y   +     Y  E    ++I +P  GD V +K++ +S +     +
Sbjct: 526 QMMEKAGQGASGSVYLAQRTQLPAY-GEGGLNEQIGEPEIGDKVAIKQMILSKQPRKELI 584

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA--- 154
            NE+ VMK  ++  NIV + ++      D      + ++ME    GSL D +    A   
Sbjct: 585 VNEILVMKDSQH-KNIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDLIENSPANGS 637

Query: 155 --TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
             + L+E ++  I+ +   GL  +H +   +IHRDIK +NVL+D     K+ DFG    C
Sbjct: 638 SHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDNRARVKITDFGF---C 692

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
                   + A ++       TP + +PE++   +    +EK D+W+LGI   ++L    
Sbjct: 693 AKLTDKRSKRATMVG------TPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEP 743

Query: 273 PFELTGQFAILHSKYEIPRNS---------FSSKLINLVIIMLAENPYLRPNVYQVMYHI 323
           P+        L   Y I  N           S K+   + + L  +   R +  ++++H 
Sbjct: 744 PYLNEDPLKAL---YLIATNGTPKLKQPEVLSLKIKRFLSVCLCVDVKYRASTEELLHHS 800

Query: 324 CSMMECE 330
              M CE
Sbjct: 801 FFDMSCE 807

>Scas_660.28
          Length = 623

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 134/288 (46%), Gaps = 52/288 (18%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR---VSDENGLNELRN 99
           ++++ L EG F  + K+++   T            G  V LK +    ++  +    +  
Sbjct: 47  QIVKTLGEGSFGKV-KLAYHMTT------------GQKVALKIINKKVLAKSDMQGRIER 93

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E+  ++ LR+  +I++ YD   S+        E++++ME   N  L DY+ QR   K+SE
Sbjct: 94  EISYLRLLRH-PHIIKLYDVIKSK-------DEIIMVMEYAGN-ELFDYIVQR--DKMSE 142

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
            E  +    I   + + H  R  ++HRD+K EN+L+D   N K+ DFG ++         
Sbjct: 143 DEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN--------- 191

Query: 220 QEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE- 275
               ++ +  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    PF+ 
Sbjct: 192 ----IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVILYVMLCRRLPFDD 245

Query: 276 --LTGQFA-ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
             +   F  I +  Y IP+   S     L+  ML  NP  R ++ ++M
Sbjct: 246 ESIPVLFKNINNGVYTIPK-FLSQGASTLIKKMLIVNPLNRISIQEIM 292

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 26/202 (12%)

Query: 78  GDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLM 137
           GD V +K++ +S +     + NE+ VMK  ++  NIV + ++      D      + ++M
Sbjct: 539 GDKVAIKQMILSKQPRKELIVNEILVMKDSQH-KNIVNFLEAYLKTEDD------LWVVM 591

Query: 138 ELCPNGSLLDYMNQRLATKLSEA-----EVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           E    GSL D +   + +  SE+     ++  I+ +   GL  +H +   +IHRDIK +N
Sbjct: 592 EYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDN 649

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           VL+D     K+ DFG    C        + A ++       TP + +PE++        +
Sbjct: 650 VLLDTHGRVKITDFGF---CAKLTDKRSKRATMVG------TPYWMAPEVVKQRE---YD 697

Query: 253 EKSDIWALGIFLYKLLFYTTPF 274
           EK D+W+LGI   ++L    P+
Sbjct: 698 EKVDVWSLGIMTIEMLEGEPPY 719

>Scas_685.24
          Length = 515

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 124/284 (43%), Gaps = 47/284 (16%)

Query: 40  HQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDEN-GLNELR 98
           H   V E +  G F  +Y+         +DR          V +K V + + N  L  L 
Sbjct: 20  HNYIVKECVGRGNFGDVYRA--------IDRTT-----NKVVAIKVVDLENTNERLEVLA 66

Query: 99  NEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLS 158
            E+  + +L++   I+ Y     + L D      + ++ME C  GS  D +       L 
Sbjct: 67  QEIFFLAELKS-PYIINYI---TTLLEDA----SMWIVMEYCGGGSCSDLLKYYFNNGLP 118

Query: 159 EAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVAS 218
           E +V  I  +I  GL ++H Q+   IHRDIK  N+L+  + + KL DFG          S
Sbjct: 119 EKKVAYITREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG---------VS 167

Query: 219 HQEIAMLMNNIYVHTTPQYRSPEM----IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
            Q  + L     V  TP + +PE+    I+ Y     +EK DIW+LGI +++LL    P 
Sbjct: 168 GQLKSTLRRGTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPL 221

Query: 275 ELTGQFAILH--SKYEIPR--NSFSSKLINLVIIMLAENPYLRP 314
                  +L   S+   PR   ++S    + V + L +NP  RP
Sbjct: 222 VKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERP 265

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 99/230 (43%), Gaps = 25/230 (10%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E   +++L+N   I+  Y +      D    Y    L+E  PNG LL  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFT----FQDESSLY---FLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
                    I   L  MH +   +IHRD+K EN+L+D D   KL DFG+           
Sbjct: 254 KCTQYYAAQIIDALGFMHDK--GVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDD 311

Query: 220 QEIAMLMNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
            +  +L  +     T +Y SPE+++     +RC       DIWA G  L++++    PF+
Sbjct: 312 LKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRC-------DIWAFGCILFQMIAGKPPFK 364

Query: 276 LTGQFAILHSKYEIP---RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
              ++       ++       F   + +LV  +L +NP  R  + Q+  H
Sbjct: 365 ANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQIKAH 414

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 93/194 (47%), Gaps = 25/194 (12%)

Query: 82  CLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCP 141
            +++  ++  N   + R EVE+   LR+  N+ Q Y       G       V LLME   
Sbjct: 170 AMEKKEITQYNVQKQFRREVEIQASLRH-PNLTQLY-------GYFYDDKRVYLLMEYLV 221

Query: 142 NGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNF 201
           NG L  Y + R+    ++      +  +   L++MH +   ++HRDIK EN+L+   N  
Sbjct: 222 NGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPENILIGFQNTL 277

Query: 202 KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           KL DFG +   +    + ++         +  T  Y SPE++  YR    +EK D+WALG
Sbjct: 278 KLTDFGWS--VISTTGAKRKT--------LCGTLDYLSPELVK-YR--EYDEKVDVWALG 324

Query: 262 IFLYKLLFYTTPFE 275
           +  Y+LL  T PFE
Sbjct: 325 VLAYELLVGTPPFE 338

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 138/300 (46%), Gaps = 54/300 (18%)

Query: 33  STVLVGVH--QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR--- 87
           S++  G H    ++++ L EG F    KV    +T            G  V LK +    
Sbjct: 44  SSLADGAHIGNYQIVKTLGEGSFG---KVKLAYHTT----------TGQKVALKIINKKV 90

Query: 88  VSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLD 147
           ++  +    +  E+  ++ LR+  +I++ YD   S+        E+++++E   N  L D
Sbjct: 91  LAKSDMQGRIEREISYLRLLRH-PHIIKLYDVIKSK-------DEIIMVIEYAGN-ELFD 141

Query: 148 YMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG 207
           Y+ QR   K+SE E  +    I   + + H  R  ++HRD+K EN+L+D   N K+ DFG
Sbjct: 142 YIVQR--DKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG 197

Query: 208 STSPCLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
            ++             ++ +  ++ T   +P Y +PE+I     L    + D+W+ G+ L
Sbjct: 198 LSN-------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVIL 242

Query: 265 YKLLFYTTPFE---LTGQFA-ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
           Y +L    PF+   +   F  I +  Y +P+   S     L+  ML  NP  R +++++M
Sbjct: 243 YVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAAGLIKRMLIVNPLNRISIHEIM 301

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 107/242 (44%), Gaps = 41/242 (16%)

Query: 37  VGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR---VSDENG 93
           + +   EV   L +G F  +Y V             R  + G    LK +    +   N 
Sbjct: 95  LSLKDFEVGRKLGKGKFGKVYCV-------------RHKKSGFICALKAIEKNEILQFNL 141

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           L +L+ EV++   + +  NI++ Y    +   D K    V LLME   NG L  Y + + 
Sbjct: 142 LKQLKREVDIQLGM-DHPNIIKLY----AHFHDEK---RVYLLMEHSINGEL--YKSLKN 191

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
               ++      +Y I   L +MH +R  +IHRD+K ENVL+  DN  KL DFG  S   
Sbjct: 192 NGPFNDVLASHYIYQIADALHYMHKKR--IIHRDVKPENVLIGFDNVVKLADFG-WSILN 248

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
           P  +  + +           T  Y SPEMI        +E+ D+WALG+  Y+L+    P
Sbjct: 249 PEGSKRKTLC---------GTIDYLSPEMIT---PREYDEQVDVWALGVLAYELVVGVPP 296

Query: 274 FE 275
           FE
Sbjct: 297 FE 298

>Scas_564.7
          Length = 1210

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 92/192 (47%), Gaps = 21/192 (10%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q  +  L E    K    I   L ++H     ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHANN--IVHRDLKIENIM 318

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +      K+ DFG ++         +++     ++Y      + +PE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPR----NSFSSKLINLVIIMLAENP 310
            D+W+ G+ LY L+    PF+     ++LH K +  +    N  S ++I+L+  ML  +P
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVDP 425

Query: 311 YLRPNVYQVMYH 322
             R ++ QV+ H
Sbjct: 426 LRRASLKQVVEH 437

>Kwal_26.7788
          Length = 1267

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 110/236 (46%), Gaps = 40/236 (16%)

Query: 97  LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK 156
           +  E+ +MK L +  N++  Y+   ++L       E+ L++E    G L DY+  R   +
Sbjct: 104 IEREIIIMK-LISHPNVMGLYEVWENKL-------ELFLVLEYVDGGELFDYLVSR--GR 153

Query: 157 LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNN-FKLCDFGSTSPCLPA 215
           L E E +     I  G ++ H     + HRD+K EN+L+D  N   K+ DFG        
Sbjct: 154 LPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIADFGMA------ 205

Query: 216 VASHQEIAMLMNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                  A+  +N  + T+   P Y SPE++    Y   P    SD+W+ GI L+ LL  
Sbjct: 206 -------ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGP----SDVWSCGIILFALLTG 254

Query: 271 TTPFELTGQFAIL----HSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
             PF       +L      KY++P+ S SS   +L+  +L  +P  R ++ +++ H
Sbjct: 255 HLPFNDDNIKRLLLKVQAGKYQMPQ-SVSSGAQDLISRILVVDPDKRISINEILAH 309

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 119/259 (45%), Gaps = 28/259 (10%)

Query: 75   LQPGDTVCLKRVRVSDENGLNE----LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPG 130
            L  GD + +K ++ +D   + +    +R+E+ V++ L N  N+VQYY     R       
Sbjct: 1211 LDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NHPNVVQYYGVEVHR------- 1262

Query: 131  YEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITV--GLSHMHYQRTPLIHRDI 188
              V + ME C  GSL       LA    E E++  +Y + +  GL+++H   + + HRDI
Sbjct: 1263 DRVNIFMEYCEGGSLASL----LAHGRIEDEMVTQVYSLQMLEGLAYLH--ESGVDHRDI 1316

Query: 189  KIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRC 248
            K EN+L+D +   K  DFG+        +    +   M    +  TP Y SPE I     
Sbjct: 1317 KPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGY 1376

Query: 249  LPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAILH--SKYEIP----RNSFSSKLINL 301
                   DIW+LG  + +++    P+  L  Q+AI++  +  +IP    +N  S   I  
Sbjct: 1377 GKFG-SDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 302  VIIMLAENPYLRPNVYQVM 320
            +   L ++P  R    +++
Sbjct: 1436 LSRCLIQDPNQRSTAVELL 1454

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 24/223 (10%)

Query: 72  DRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGY 131
           D+   P     +K++    ++G      ++ ++K+L +  NIV YY       G  + G 
Sbjct: 459 DKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHH-ENIVTYY-------GSSQEGG 510

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
            + + +E  P GS+   +N        E  V        VGL+++H  R  +IHRDIK  
Sbjct: 511 NLNIFLEYVPGGSVSSMLNSY--GPFEEPLVKNFTRQTLVGLTYLH--RKNIIHRDIKGA 566

Query: 192 NVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPI 251
           N+L+D   + K+ DFG +    P      + A L  ++Y      + +PE++   + +  
Sbjct: 567 NLLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVT 617

Query: 252 NEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSF 294
            EK+DIW++G  + ++     PF     F+ + + ++I  N+ 
Sbjct: 618 TEKADIWSVGCVVVEMFTGKHPFP---DFSQMQAIFKIGTNTI 657

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 100/232 (43%), Gaps = 27/232 (11%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E   ++KL N  ++V+ +    S   D    Y    L+E  PNG  L  M +  +  L E
Sbjct: 227 EKTALQKLNNSPSVVRLF----STFQDESSLY---FLLEYAPNGDFLSLMKKYGS--LDE 277

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA--VA 217
                    I   + ++H     +IHRDIK EN+L+D +   KL DFG+     P     
Sbjct: 278 TCARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKLLFYTTP 273
           S  E  +   +     T +Y SPE+++     YRC       DIWA G  L++++    P
Sbjct: 336 SKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGKPP 388

Query: 274 FELTGQFAILHSKYEIPRN---SFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           F+ T ++       ++       F   + +LV  +L +N   R  + Q+  H
Sbjct: 389 FKATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEH 440

>Kwal_56.24091
          Length = 381

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 89/196 (45%), Gaps = 29/196 (14%)

Query: 82  CLKRVRVSDENGLNELRNEVEVMKKLR--NCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
            +K+  +   N   + R EVE+   L+  N + +  Y+               V LLME 
Sbjct: 153 AMKKSEIVQYNVQKQFRREVEIQSSLKHPNLTRLYGYFHDEK----------RVYLLMEY 202

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
             NG L  Y + R     ++      ++ +   L++MH +   ++HRDIK EN+L+   N
Sbjct: 203 LVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMHSKN--ILHRDIKPENILLGFQN 258

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
             KL DFG +   +  V + +   +         T  Y SPE+I   +    + K D+WA
Sbjct: 259 TLKLTDFGWS---VSNVGNSKRKTLC-------GTMDYLSPELI---KSREYDNKVDVWA 305

Query: 260 LGIFLYKLLFYTTPFE 275
           LG+  Y+LL  + PFE
Sbjct: 306 LGVLTYELLVGSPPFE 321

>Scas_627.7
          Length = 349

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 108/232 (46%), Gaps = 32/232 (13%)

Query: 96  ELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
           + R EVE+   L N  N+ + Y       G       V LLME    G L  Y   R   
Sbjct: 135 QFRREVEIQTSL-NHPNLTKLY-------GHFHDEKRVYLLMEYLVYGEL--YKLLRSHG 184

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
             ++    + ++ I   L+++H ++  +IHRD+K EN+L+  +N  KL DFG  S   P 
Sbjct: 185 PFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPENILIGFNNVIKLTDFG-WSIINPR 241

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 274
               + +           T  Y SPEMI   R    ++K D+WALG+  Y+L+  + PF 
Sbjct: 242 GVKRKTLC---------GTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSPPFE 289

Query: 275 ----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
               ELT +  IL +  + P  + S  + +L+  +L  NP  R ++  VM H
Sbjct: 290 EDTKELTYK-RILKNDIKFP-ETVSHDVKDLISKLLKYNPSERISMRDVMKH 339

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 93/201 (46%), Gaps = 32/201 (15%)

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
           E+ L++E    G L DY+  +   KL E E +     I  G+S+ H     + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 192 NVLVDADNN-FKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT---PQYRSPEMI--DL 245
           N+L+D  N   K+ DFG  +  LP             N  + T+   P Y SPE++    
Sbjct: 244 NLLLDKKNRRIKIADFGMAALELP-------------NKLLKTSCGSPHYASPEIVMGRP 290

Query: 246 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPRNSFSSKLINL 301
           Y   P    SD+W+ GI L+ LL    PF       +L      KY++P N  SS+  +L
Sbjct: 291 YHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN-LSSEARDL 345

Query: 302 VIIMLAENPYLRPNVYQVMYH 322
           +  +L  +P  R    +++ H
Sbjct: 346 ISKILVIDPEKRITTQEILKH 366

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 127/301 (42%), Gaps = 70/301 (23%)

Query: 96  ELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           ++R E+ +MKK    +   +++  D   SR        ++ L++E C  G +      +L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSR--------KIYLVLEYCSKGEVKWCPGDQL 212

Query: 154 ATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG 207
                    L+     +I+  + +GL ++HYQ   +IHRDIK  N+L+   +  K+ DFG
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHYQG--IIHRDIKPANLLLSEHDIVKISDFG 270

Query: 208 -------STSPCLPAVASHQEIAML-------MNNIYVHTTPQYRSPEMI---DLYRCLP 250
                  S +P   + +S     +L       +       TP + +PE+    D Y  L 
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLN 330

Query: 251 INEKS------------DIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSF 294
           I+ +S            DIWALG+ LY LLF   PF    E+     I++   E PR  F
Sbjct: 331 IDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEF 390

Query: 295 ----SSKLI----------NLVIIMLAENPYLRPNVYQVMYH--ICSMMECEVKIDDLYG 338
                  +I          +L+  +L +NP  R N+  +  H  +C   +    +D L G
Sbjct: 391 MQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAHPFVCWDFD---HVDGLSG 447

Query: 339 Q 339
           Q
Sbjct: 448 Q 448

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 122/265 (46%), Gaps = 34/265 (12%)

Query: 78  GDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLM 137
           GD V +K++ +S +     + NE+ VM   R+  NIV + ++      D      + ++M
Sbjct: 607 GDKVAIKQMVLSKQPRKELIVNEIMVMNDSRH-ENIVNFLEAYLKTEDD------LWVVM 659

Query: 138 ELCPNGSLLDYM-----NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           E    GSL D +     N    + LSE ++  I+ +   GL  +H +   +IHRDIK +N
Sbjct: 660 EYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKN--IIHRDIKSDN 717

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           VL+D     K+ DFG    C        + A ++       TP + +PE++   +    +
Sbjct: 718 VLLDTKARVKITDFGF---CAKLTDQRSKRATMVG------TPYWMAPEVV---KQKEYD 765

Query: 253 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHS---KYEIPRNSFSSKLINLVIIM 305
            K D+W+LGI   ++L    P+     L   + I  +   K + P+ S S ++   + + 
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQ-SLSLEIKRFLSVC 824

Query: 306 LAENPYLRPNVYQVMYHICSMMECE 330
           L  +   R +  ++++H    + CE
Sbjct: 825 LCVDVKYRASTEELLHHSFFNIACE 849

>Scas_668.22
          Length = 893

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 79  DTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLME 138
           ++V +K++ +  +     + NE+ VMK  R+  NIV + DS    L DG    ++ ++ME
Sbjct: 635 ESVAIKQMNLEKQPKKELIINEILVMKGSRH-PNIVNFIDS---YLLDG----DLWVIME 686

Query: 139 LCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDAD 198
               GSL D +   +   L+E ++  +  +   GL  +H +   ++HRDIK +N+L+   
Sbjct: 687 YMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSIS 741

Query: 199 NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 258
            + KL DFG         A   EI +    +    TP + +PE++      P   K DIW
Sbjct: 742 GDIKLTDFG-------FCAQINEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIW 789

Query: 259 ALGIFLYKLLFYTTPF 274
           +LGI + +++    P+
Sbjct: 790 SLGIMIIEMIEGEPPY 805

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 119/245 (48%), Gaps = 33/245 (13%)

Query: 83  LKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPN 142
           +K++   DE+ LNE   E++++K LR+  NIV+Y        G  +  +E+ +++E C  
Sbjct: 38  IKQIEFEDESELNEHMLEIDLLKNLRH-QNIVEYR-------GFIQKAHELYIILEYCAR 89

Query: 143 GSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFK 202
           GSL D +       L E + +  +     GL ++H Q   +IHRDIK  N+L+  +   K
Sbjct: 90  GSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLHEQ--GVIHRDIKAANLLLTEEGIVK 144

Query: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 262
           L DFG ++           +AM         +P + +PE++       +   SDIW+LG 
Sbjct: 145 LADFGVSTRI-------NRMAMTYAG-----SPNWMAPEVMTGQGASTV---SDIWSLGA 189

Query: 263 FLYKLLFYTTPFE----LTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQ 318
            + +LL    PF      +  +AI++ +Y IP  + S++  + +     +N + R    +
Sbjct: 190 TVVELLTGNPPFHNLVNESACYAIVNEEY-IPPLTLSAECKDFLSRCFQKNMFKRATAQE 248

Query: 319 VMYHI 323
           ++ HI
Sbjct: 249 LLAHI 253

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 17/192 (8%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           + + ME C  GS+ D +     + L E +   I  +I  GLS++H QR   IHRDIK  N
Sbjct: 76  MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQRK--IHRDIKAAN 133

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           +L+  +   KL DFG +   L +      +           TP + +PE++  +     +
Sbjct: 134 ILLTDEGKVKLSDFGVSGKLLSSFRRDTFVG----------TPYWMAPEIV-AHDSEGYD 182

Query: 253 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHS--KYEIPR--NSFSSKLINLVIIMLAE 308
           E++DIW+LGI + ++L  + P        ++ +  K + P+    FS    + V + L +
Sbjct: 183 ERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLIK 242

Query: 309 NPYLRPNVYQVM 320
              +RP    ++
Sbjct: 243 ESAIRPTAADLL 254

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 20/195 (10%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E+EVMK+  +  N+V+ Y+     + +     +V L++E C  G +      ++  K   
Sbjct: 104 EIEVMKRCHH-ENVVELYE-----ILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 160 AEVL------KIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG---STS 210
             +L      K++ D+  GL ++H Q   + HRDIK  N+L+ ++   K+ DFG   ST+
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLHSQ--GITHRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 211 PCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 270
                + S  E  +    +    TP + +PE+    +    +   DIW+LG+ +Y LLF 
Sbjct: 216 TGSTNIQSSHEQLLKSRAL---GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFG 272

Query: 271 TTPFELTGQFAILHS 285
             PF       +  S
Sbjct: 273 KLPFNANSGLELFDS 287

>Scas_544.6
          Length = 489

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 106/209 (50%), Gaps = 44/209 (21%)

Query: 89  SDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL--- 145
           ++E  +N+L  E+ +MK ++   NI+ +Y +  +   +     E+++LME    GSL   
Sbjct: 193 NNEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNN----EIVILMEYMDCGSLDRI 248

Query: 146 ---------LDYMNQRLATKLSEAEVL-KIMYDITVGLSHMHYQRTPLIHRDIKIENVLV 195
                       ++ R     +++ +L +I Y +  GL+++ Y+   +IHRDIK  NVL+
Sbjct: 249 FSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNYL-YENYKIIHRDIKPSNVLI 307

Query: 196 DADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINE 253
           ++    KLCDFG +   + ++A          + +V T+  Y SPE I  ++Y     + 
Sbjct: 308 NSKGLVKLCDFGVSKKLINSIA----------DTFVGTS-TYMSPERIQGNVY-----ST 351

Query: 254 KSDIWALGIFLYKLLFYTTPFELTGQFAI 282
           K D+W+LG+ + +L        +TGQF +
Sbjct: 352 KGDVWSLGLMIIEL--------VTGQFPL 372

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 97/195 (49%), Gaps = 25/195 (12%)

Query: 80  TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           +V +K++ +  +     + NE+ VMK  ++ +NIV + DS   R GD      + ++ME 
Sbjct: 723 SVAIKQMNLEKQPKKELIVNEILVMKGSKH-NNIVNFIDSYLFR-GD------LWVVMEY 774

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
              GSL D +   +   L+E ++  +  +   GL  +H +   +IHRDIK +N+L+  + 
Sbjct: 775 MEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNILLSMNG 829

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
           + KL DFG         A   E+ +    +    TP + +PE++      P   K DIW+
Sbjct: 830 DIKLTDFG-------FCAQINEVNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWS 877

Query: 260 LGIFLYKLLFYTTPF 274
           LGI + +++    P+
Sbjct: 878 LGIMIIEMIEGEPPY 892

>Kwal_26.7861
          Length = 955

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 94/195 (48%), Gaps = 25/195 (12%)

Query: 80  TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           +V +K++ +  +     + NE+ VMK  ++  NIV + DS   R GD      + ++ME 
Sbjct: 692 SVAIKQMNLEKQPKKELIINEILVMKASKHA-NIVNFIDSYLLR-GD------LWVVMEY 743

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
              GSL D +   +   L+E ++  +  +   GL  +H +   +IHRDIK +NVL+    
Sbjct: 744 MEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNVLLSMSG 798

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
             KL DFG         A   EI +    +    TP + +PE++      P   K DIW+
Sbjct: 799 EIKLTDFG-------FCAQINEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWS 846

Query: 260 LGIFLYKLLFYTTPF 274
           LGI + +++    P+
Sbjct: 847 LGIMIIEMIEGEPPY 861

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 137/294 (46%), Gaps = 56/294 (19%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-----SDENG 93
           V   ++++ L EG F  + K+++   T            G  V LK +       SD  G
Sbjct: 36  VGNYQIVKTLGEGSFGKV-KLAYHVTT------------GQKVALKIINKKVLAKSDMQG 82

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
              +  E+  ++ LR+  +I++ YD   S+        E+++++E   N  L DY+ QR 
Sbjct: 83  --RIEREISYLRLLRH-PHIIKLYDVIKSK-------DEIIMVIEYAGN-ELFDYIVQR- 130

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             K+SE E  +    I   + + H  R  ++HRD+K EN+L+D   N K+ DFG ++   
Sbjct: 131 -NKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN--- 184

Query: 214 PAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 270
                     ++ +  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L  
Sbjct: 185 ----------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVILYVMLCR 232

Query: 271 TTPFE---LTGQFA-ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
             PF+   +   F  I +  Y +P+   S    +L+  ML  NP  R +++++M
Sbjct: 233 RLPFDDESIPVLFKNISNGVYTLPK-FLSPGASDLIKRMLIVNPLNRISIHEIM 285

>Scas_602.11
          Length = 1186

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/358 (22%), Positives = 144/358 (40%), Gaps = 106/358 (29%)

Query: 95  NELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
           + ++ E+ +MKKL  ++   +++  D   SR        ++ L++E C  G +       
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSR--------KIYLVLEYCAQGEIKWCPKDC 277

Query: 153 LATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
           L T+      LS     +I+  + +GL ++HYQ   +IHRDIK  N+LVD +   K+ DF
Sbjct: 278 LETEAKGPPLLSFQSAREIIRGVILGLEYLHYQ--GIIHRDIKPANLLVDEEGTVKISDF 335

Query: 207 GST-------------------SPCLPAVASHQEIAMLMNN----------IYVHTTPQY 237
           G +                   +P   + +S + +    NN               TP +
Sbjct: 336 GVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAF 395

Query: 238 RSPEMI--------------DLYRCLPINEKSDIWALGIFLYKLLFYTTPF--------- 274
            +PE+               ++++   I+   DIWALGI  Y LLF   PF         
Sbjct: 396 FAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELF 455

Query: 275 -ELTGQFAILHSKYEIPRNSFSS--------KLINLVIIMLAENPYLRPNVYQVMYH--I 323
            ++ G+     S  E+  N  S+           N++  +L +NP  R ++ ++ YH  I
Sbjct: 456 EKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYHPFI 515

Query: 324 CSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDL 381
           C                 ++FD +    E         L++ +L ++ I   ++V+ L
Sbjct: 516 C-----------------WDFDHFAELNED--------LITSKLKEKEIFQANQVDSL 548

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 94/194 (48%), Gaps = 25/194 (12%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q     L E    K +  I   L ++H     ++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHLNN--IVHRDLKIENIM 254

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP-INE 253
           +      K+ DFG ++       + +++     ++Y      + +PE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSN----LYDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 254 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPRNSFSSKLINLVIIMLAE 308
           + DIW+ G+ +Y L+    PF+     ++LH      K E P++  S + I+L+  ML  
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYPQH-LSIECISLLSKMLVV 359

Query: 309 NPYLRPNVYQVMYH 322
           +P  R ++ QV  H
Sbjct: 360 DPLKRASLKQVCNH 373

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 112/255 (43%), Gaps = 50/255 (19%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           EV++  K+    NI + YD            ++  ++ME C  G L + +   +  + ++
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKTK 164

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
             V  I+  I   + ++H +   + HRDIK EN+L+  + N KL D+G        +A+ 
Sbjct: 165 -NVTNIINQILDAVEYVHSR--GIYHRDIKPENILIAGNWNIKLTDWG--------LATT 213

Query: 220 QEIAMLMNNIYVHTTPQYRSPEMI----------DLYRCLPINEKSDIWALGIFLYKLLF 269
            + +M  N      + +Y +PE+           D Y C     K DIWA+GI +  ++F
Sbjct: 214 DKTSMERN----VGSERYMAPELFESNLDREERTDAYDCA----KVDIWAIGIVMLNIVF 265

Query: 270 YTTPFELTGQ----FAILHSKYEIPRNSFSSKLINLVIIM---LAENPYLRPNVYQVMYH 322
           +  PF +  Q    F    +  E   + FS+   +   ++   L  +P  R N+ +V   
Sbjct: 266 HKNPFTVANQTDKAFCYFAANREALFDVFSTMSYDFFQVLRHALTIDPTNR-NLEKVRTE 324

Query: 323 ICSMMECEVKIDDLY 337
           I  +   E  +DD Y
Sbjct: 325 IKRL--SEYTMDDEY 337

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 98/226 (43%), Gaps = 19/226 (8%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E   +++L N   +++ Y +             +  L+E  PNG  L  M +     L+E
Sbjct: 230 EKNTLQRLNNSRGVIKLYFTFQDEAS-------LYFLLEYAPNGDFLSVMKK--FGSLNE 280

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
                    +   +  +H  +  ++HRDIK EN+L+D     KL DFG+    L      
Sbjct: 281 ECCRYYGAQMLDAIDFIH--KNGVVHRDIKPENILLDEHMKVKLTDFGTAK--LLDRDEK 336

Query: 220 QEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 279
               +L  +     T +Y SPE+++   C  +N K DIWA G  LY+++    PF+ T +
Sbjct: 337 SGYNLLKKSRSFVGTAEYVSPELLN-DNC--VNYKCDIWAFGCILYQMIAGKPPFKATNE 393

Query: 280 FAILHSKYEIP---RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           +       ++       F   + +LV  +L ++P  R N  QV  H
Sbjct: 394 YLTFQKVMKVQYAFTAGFPLVIRDLVKQLLVKSPEARLNASQVKSH 439

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 107/228 (46%), Gaps = 32/228 (14%)

Query: 103 VMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEV 162
           ++ KL N  N+++ +D         +   ++ L++E    G L + + +R    L E E 
Sbjct: 81  IIMKLLNHPNVLRLFDV-------WETNSDLYLVLEYAEKGELFNMLVER--GPLPENEA 131

Query: 163 LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           ++    I +G+S+ H     ++HRD+K EN+L+D   N K+ DFG         A   E 
Sbjct: 132 VRAFRQIIIGISYCHS--LGVVHRDLKPENLLLDNKLNIKIADFG-------MAALESED 182

Query: 223 AMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF-ELTGQ- 279
            +L  +     +P Y +PE+I     LP     SD+W+ G+ L+ LL    PF E  G  
Sbjct: 183 KLLETSC---GSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNI 236

Query: 280 ----FAILHSKYEIP-RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
                 +   ++E+P  +  + +  +L+  +L  +P  R  + +++ H
Sbjct: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 105/228 (46%), Gaps = 32/228 (14%)

Query: 103 VMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEV 162
           ++ KL N  N+++ YD         +   ++ L++E    G L + + +R    L E E 
Sbjct: 83  IIMKLLNHPNVLRLYDV-------WETNTDLYLVLEYAEKGELFNLLVER--GPLPEHEA 133

Query: 163 LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           ++    I +G+S+ H     ++HRD+K EN+L+D   N K+ DFG         A   E 
Sbjct: 134 IRFFRQIIIGVSYCHA--LGIVHRDLKPENLLLDHKYNIKIADFG-------MAALETEG 184

Query: 223 AMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPFE------ 275
            +L  +     +P Y +PE++     +P     SD+W+ G+ L+ LL    PF+      
Sbjct: 185 KLLETSC---GSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238

Query: 276 LTGQFAILHSKYEIPR-NSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
            T    +   ++E+P  +  S +  +L+  +L  +P  R     ++ H
Sbjct: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 23/193 (11%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q     L E    K    I   L ++H     ++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENIM 255

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP-INE 253
           + +    K+ DFG ++         +++     ++Y      + +PE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 254 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKL----INLVIIMLAEN 309
           + DIW+ GI LY L+    PF+     +ILH K +  +  + S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 310 PYLRPNVYQVMYH 322
           P  R  +  V+ H
Sbjct: 362 PLRRATLKNVVEH 374

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 105/230 (45%), Gaps = 36/230 (15%)

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
           E+ L++E    G L DY+  +   KLSE E +     I  G+S+ H     + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 192 NVLVDADNN-FKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT---PQYRSPEMI--DL 245
           N+L+D  N   K+ DFG  +  LP             N  + T+   P Y SPE++    
Sbjct: 256 NLLLDKKNKVIKIADFGMAALELP-------------NKLLETSCGSPHYASPEIVMGKP 302

Query: 246 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPRNSFSSKLINL 301
           Y   P    SD+W+ GI L+ LL    PF       +L      ++++P    ++   +L
Sbjct: 303 YHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPP-YLTNDAKDL 357

Query: 302 VIIMLAENPYLRPNVYQVMYH--ICSMME--CEVKIDDLYGQGPYNFDMY 347
           +  +L  NP  R  + +++ H  I         ++  +L G+G  N D++
Sbjct: 358 ITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLH 407

>Scas_502.2
          Length = 1116

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 89/194 (45%), Gaps = 13/194 (6%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  L+E  PNG LL  M +     L+E         I   +  MH +   +IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLMKK--FGSLNEECCCYYGAQIIDAIKFMHSK--GIIHRDIKPEN 303

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI-DLYRCLPI 251
           +L+D D   K+ DFG T+  L          +L  +     T +Y SPE++ D Y     
Sbjct: 304 ILLDKDMKVKITDFG-TAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPELLNDNY----T 358

Query: 252 NEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP---RNSFSSKLINLVIIMLAE 308
           + +SDIWA G  +++++    PF+ T ++       ++       F + + +LV  +L +
Sbjct: 359 DARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRDLVKRILIK 418

Query: 309 NPYLRPNVYQVMYH 322
            P  R  +  +  H
Sbjct: 419 APEQRLTIEAIEKH 432

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 81/180 (45%), Gaps = 25/180 (13%)

Query: 96  ELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
           + R EVE+    ++  N+ Q Y       G       V LLME    G L  ++      
Sbjct: 144 QFRREVEIQGSFKH-KNLTQLY-------GFFYDEKRVYLLMEYVYYGELYKFLKNN--G 193

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
            L+E      +Y +   L +MH +   ++HRDIK EN+L+  +N  KL DFG +      
Sbjct: 194 PLNETLASYFVYQMANALDYMHSKN--ILHRDIKPENILIGFNNTIKLTDFGWSV----Y 247

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
               Q+   L   I       Y SPE+I   +    N K D+WALG+  Y+LL  + PFE
Sbjct: 248 NEDGQKRKTLCGTI------DYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFE 298

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 96/194 (49%), Gaps = 25/194 (12%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q  + +  E +  K    I   L ++H     ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLHANN--IVHRDLKIENIM 276

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP-INE 253
           +   +  K+ DFG ++       S +++     ++Y      + +PE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 254 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPRNSFSSKLINLVIIMLAE 308
           + D+W+ G+ L+ L+    PF+     ++LH      K E P++  S ++I+L+  ML  
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH-LSIEVISLLSKMLVV 381

Query: 309 NPYLRPNVYQVMYH 322
           +P  R  + QV+ H
Sbjct: 382 DPKRRATLKQVVEH 395

>Kwal_26.8709
          Length = 829

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 97/201 (48%), Gaps = 30/201 (14%)

Query: 81  VCLKRVRVSD--ENGLNELR--NEVEVMKKLRNCSNIVQYYD--SNASRLGDGKPGYEVL 134
           V +K +R     +N   E++   E+  +K L N  NIV+  +   N+  +G         
Sbjct: 72  VAIKLIRRDTIPKNSEKEIKIYREINALKHL-NHPNIVRLEEVLQNSKYIG--------- 121

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +++E    G    Y+ ++   +L E    ++   +  G+ +MH +   L+HRD+K+EN+L
Sbjct: 122 IVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSK--GLVHRDLKLENLL 177

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +D + N  + DFG  +  LP      E  ++  +     +P Y +PE++   R      K
Sbjct: 178 LDKNENLLITDFGFVNEFLP------ENELMKTSC---GSPCYAAPELVVTARPYEA-RK 227

Query: 255 SDIWALGIFLYKLLFYTTPFE 275
           +D+W+ G+ LY +L    P++
Sbjct: 228 ADVWSCGVILYAMLAGYLPWD 248

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 124/258 (48%), Gaps = 39/258 (15%)

Query: 27  EMLQAGSTVLVGVH---QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP------ 77
           E++    TV + V+     +++E   +G    +Y    +    E D   R L+       
Sbjct: 342 EIIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQEND--PRFLKSHCHRVV 399

Query: 78  GDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLM 137
           G+ V +K++R+S++     + NE+ VM   R   NIV + +  A  + D     E+ ++M
Sbjct: 400 GERVAIKQIRLSEQPKKQLIMNELLVMNDSRQ-ENIVNFLE--AYIIDDE----ELWVIM 452

Query: 138 ELCPNGSLLDYMNQRL-------ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKI 190
           E    G L D ++          ++ L+E ++  I+ +   GL  +H ++  +IHRDIK 
Sbjct: 453 EYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKK--IIHRDIKS 510

Query: 191 ENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP 250
           +N+L+++    K+ DFG    C+       + A ++       TP + +PE+++      
Sbjct: 511 DNILLNSQGLVKITDFGF---CVELTEKRSKRATMVG------TPYWMAPEIVNQK---G 558

Query: 251 INEKSDIWALGIFLYKLL 268
            +EK D+W+LGI L +++
Sbjct: 559 YDEKVDVWSLGIMLIEMI 576

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 115/236 (48%), Gaps = 40/236 (16%)

Query: 48  LAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV--SDENGLN--ELRNEVEV 103
           + +G FA + + S      E+D       P   + +K + +   ++ G++  ++  EV++
Sbjct: 21  IGKGSFAFVKRASL-----EVD-------PSTVIAVKFIHLPSCEKQGMSQEDVLREVKL 68

Query: 104 MKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVL 163
             +  N  N+++  D N S      P   + + MEL   G L D +   +     ++EV 
Sbjct: 69  HSRCSNFVNVLKVIDCNLS-----DPF--LWIAMELAEGGDLFDKIEPDIGV---DSEVA 118

Query: 164 KIMYD-ITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           +  Y  +   +S++H     + HRDIK EN+L+D D N KL DFG     L ++   ++ 
Sbjct: 119 QFYYKQLIKAISYLH-DTCGVAHRDIKPENILLDKDGNLKLADFG-----LASLFKRKDG 172

Query: 223 AMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 276
           +  ++     + P Y +PE+I  D Y      + +DIW++G+ L+ LL   TP+EL
Sbjct: 173 SKRISRDQRGSLP-YMAPEIIYCDGYYA----DMTDIWSIGVLLFVLLTGETPWEL 223

>Scas_493.2
          Length = 1117

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 109/234 (46%), Gaps = 33/234 (14%)

Query: 97  LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK 156
           +  E+ +MK LR+  N++  YD         +    + +++E    G L + + ++    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDV-------WETNSNLYMILEYAEKGELFNLLVEK--GP 130

Query: 157 LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAV 216
           L E E ++    I +G+S+ H     ++HRD+K EN+L+D   N K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHA--LGIVHRDLKPENLLLDHKFNIKIADFG-------MA 181

Query: 217 ASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 274
           A   E  +L  +     +P Y +PE++     +P +  +SD+W+ G+ L+ LL    PF 
Sbjct: 182 ALETEDKLLETSC---GSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPFD 235

Query: 275 ELTGQ-----FAILHSKYEIP-RNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           E  G        +   ++E+P  +  S    +L+  +L  +P  R    +++ H
Sbjct: 236 EEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 92/194 (47%), Gaps = 25/194 (12%)

Query: 81  VCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELC 140
           V +K++ +  +     + NE+ VM   ++  NIV Y DS  S       G ++ ++ME  
Sbjct: 593 VAIKQMNLEKQPKKELIVNEIMVMSSSKH-QNIVNYIDSYLS-------GLDLWVVMEYM 644

Query: 141 PNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNN 200
             G L D +   +   L+E ++  +  ++  GL  +H +   ++HRDIK +NVL+  + +
Sbjct: 645 EGGCLTDVVTYCV---LTEGQIGAVCREVLQGLEFLHSK--GVLHRDIKSDNVLLSMNGD 699

Query: 201 FKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWAL 260
            KL DFG  +     V     +           TP + +PE++      P   K DIW+L
Sbjct: 700 IKLTDFGFCAQVNDTVIKRTTMV---------GTPYWMAPEIVSRKEYGP---KVDIWSL 747

Query: 261 GIFLYKLLFYTTPF 274
           GI + +++    P+
Sbjct: 748 GIMIIEMIEGEPPY 761

>Scas_477.5
          Length = 703

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 101/200 (50%), Gaps = 25/200 (12%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           ++ L++E+ ++K+L +  NIV YY       G  + G  + + +E  P GS+   +N   
Sbjct: 485 VDALQHEMNLLKELHH-ENIVTYY-------GSSQEGPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
                E+ ++  +  + +G++++H +   +IHRDIK  N+L+D     K+ DFG  S  L
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLHNKN--IIHRDIKGANILIDTKGCVKITDFG-ISKKL 591

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
             ++   + A L  ++Y      + +PE++   +     EK+DIW+ G  + ++     P
Sbjct: 592 SPLSKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKHP 642

Query: 274 FELTGQFAILHSKYEIPRNS 293
           F     F+ + + ++I  N+
Sbjct: 643 FP---DFSQMQTIFKIGTNT 659

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 101/225 (44%), Gaps = 41/225 (18%)

Query: 77  PGDTVCLKRVRVSDENGL---NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEV 133
           P   V  K+  V ++N      ++  E+ +M+ +    NIV++Y ++           +V
Sbjct: 125 PSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSSDSINGSNDV 184

Query: 134 LLLMELCPNGSLLDYMNQRLATKLSEAEVL-------------------KIMYDITVGLS 174
           ++LME    GSL D +  R    L    +L                   +I Y +  GLS
Sbjct: 185 VILMEYMNCGSL-DTIT-RTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLS 242

Query: 175 HMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT 234
           ++ Y+   +IHRDIK  NVL+++    KLCDFG +     ++A          + +V T+
Sbjct: 243 YL-YENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRKLNNSIA----------DTFVGTS 291

Query: 235 PQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 279
             Y SPE I   +      K D+W+LG+ L +LL  T  F L G 
Sbjct: 292 T-YMSPERIQGNK---YTTKGDVWSLGLMLIELL--TGEFPLGGH 330

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 91/192 (47%), Gaps = 21/192 (10%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +  E    G LLDY+ Q  +  L E    K+   I   L ++H     ++HRD+KIEN++
Sbjct: 168 MFFEFISGGQLLDYIIQHGS--LKENHARKVSRGILSALQYLHANN--IVHRDLKIENIM 223

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +      KL DFG ++   P     + +     ++Y      + +PE++  +  L    +
Sbjct: 224 LSKTGEIKLIDFGLSNMYDP----RKSLQTFCGSLY------FAAPELLKAHPYL--GPE 271

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSF----SSKLINLVIIMLAENP 310
            D+W+ G+ LY L+    PF+     A LH K +  + ++    S  +I+L+  +L  +P
Sbjct: 272 VDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVDP 330

Query: 311 YLRPNVYQVMYH 322
             R  + QV+ H
Sbjct: 331 QKRATLQQVVNH 342

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           +L E    G LLDY+ Q  +  L E    K    +   L ++H     ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQHGS--LREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 264

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +      K+ DFG ++       + +++     ++Y      + +PE++  +       +
Sbjct: 265 ISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPRNSFSSKLINLVIIMLAEN 309
            D+W+ G+ LY L+    PF+     ++LH      K E P++  S ++++L+  ML  +
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQH-LSIEVMSLLSKMLVVD 370

Query: 310 PYLRPNVYQVMYH 322
           P  R ++ QV+ H
Sbjct: 371 PSRRASLKQVVEH 383

>Kwal_56.24584
          Length = 435

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 36/197 (18%)

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
           ++L  E+ +M+ ++   NIV ++ +  +         E+++LME     SL   M+   A
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYT----ASTSNEIVILMEYMDCSSLDKIMSTYKA 197

Query: 155 -----------TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKL 203
                      T   E  + KI Y +  GLS++ Y+   +IHRDIK  NVL+++    K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 204 CDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALG 261
           CDFG +   + ++A          + +V T+  Y SPE I   +Y     + K D+W+LG
Sbjct: 257 CDFGVSKKLINSIA----------DTFVGTST-YMSPERIQGSVY-----STKGDVWSLG 300

Query: 262 IFLYKLLFYTTPFELTG 278
           + + +L+  T  F L G
Sbjct: 301 LMIIELV--TGEFPLGG 315

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 90/196 (45%), Gaps = 19/196 (9%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  +M+L P G LL  + ++     SEA     M  +   + ++H     +IHRD+K EN
Sbjct: 86  LYFVMDLAPGGELLQLLRRQRV--FSEAWARHYMCQLVDTVEYIH--SMGVIHRDLKPEN 141

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           VL+D +    + DFG+      + A         + +    T +Y SPE++   +     
Sbjct: 142 VLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFV---GTAEYVSPELLLENKSY--- 195

Query: 253 EKSDIWALGIFLYKLLFYTTPF------ELTGQFAILHSKYEIPRNSFSSKLINLVIIML 306
             SD+WALG  LY+ L  T PF      E   Q   L   + IP N  ++ L++ ++++ 
Sbjct: 196 YSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKILVL- 254

Query: 307 AENPYLRPNVYQVMYH 322
             +P  R  + Q+  H
Sbjct: 255 --DPSQRYTLEQIKKH 268

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 94/217 (43%), Gaps = 43/217 (19%)

Query: 95  NELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
           ++++ E+ +MKK    +   +++  D   SR        ++ L++E C  G +      +
Sbjct: 168 DKIKREIAIMKKCHHEHVVKLIEVLDDFKSR--------KIYLVLEYCSKGEIKWCPGDQ 219

Query: 153 LATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
           L TK      L+     +++  + +GL ++HYQ   +IHRDIK  N+LV      K+ DF
Sbjct: 220 LETKARGPPLLTFQRAREVLRGVVLGLEYLHYQ--GIIHRDIKPANLLVSETGTVKISDF 277

Query: 207 G-----STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--------------DLYR 247
           G     ST+          E+A          TP + +PE+                  +
Sbjct: 278 GVSLAASTTEDGNGFIDELELAKTAG------TPAFFAPEICLGHDALEKFNPDKKATKK 331

Query: 248 CLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILH 284
            L I+   DIWALG+ L+ LLF   PF    +  + H
Sbjct: 332 GLCISFMIDIWALGVTLHCLLFGQLPFISEFELELFH 368

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 105/239 (43%), Gaps = 34/239 (14%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLL------- 146
           + + R E+    +LRN  +IV+  +   S   +      + ++   C  G L        
Sbjct: 162 IEKCRWEIFAASRLRNNVHIVRLIECLDSPFSES-----IWIVTNWCSLGELQWKRDDDE 216

Query: 147 DYMNQRLATKLSEAEV----LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNF- 201
           D + Q     +S   V     KI+ D+T GL ++H Q    IHRDIK  N+L+D +    
Sbjct: 217 DILPQWKKIVISNCSVSTFAKKILEDMTKGLEYLHSQ--GCIHRDIKPSNILLDEEEKVA 274

Query: 202 KLCDFGS---TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRC----LPINEK 254
           KL DFGS   T   LP   ++ E         +  TP + +PE+  L       +    K
Sbjct: 275 KLSDFGSCIFTPQSLPFSDANFEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFK 334

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSK-----LINLVIIMLAE 308
            DIW+LG+ LY LL+   PF    +F   H   E+   S SSK     L +LVI  L E
Sbjct: 335 LDIWSLGVTLYCLLYNELPFFGENEFETYHKIIEV---SLSSKINGNTLNDLVIKRLLE 390

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 107/223 (47%), Gaps = 31/223 (13%)

Query: 75   LQPGDTVCLKRVRVSDENGLNE----LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPG 130
            L  GD + +K +++ D   + +    L+ E+ VM+ L N  NIVQYY     R       
Sbjct: 1279 LDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQYYGVEVHR------- 1330

Query: 131  YEVLLLMELCPNGSLLDYMNQ-RLATKLSEAEVLKIMYDITV--GLSHMHYQRTPLIHRD 187
             +V + ME C   SL   +   R+     E E++  +Y + +  GL+ +H  ++ ++HRD
Sbjct: 1331 DKVNIFMEFCEGSSLASLLEHGRI-----EDEMVTQVYTLQLLEGLACLH--QSGVVHRD 1383

Query: 188  IKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVH-----TTPQYRSPEM 242
            IK EN+L+D +   K  DFG+    L A    + I++  NN          TP Y +PE 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAK--LIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPET 1441

Query: 243  IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAILH 284
            +            DIW+LG  + +++    P+  L  ++AI++
Sbjct: 1442 VTGQGHGKFGS-DDIWSLGCVVLEMVTGRRPWANLDNEWAIMY 1483

>Kwal_27.9763
          Length = 868

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 112/229 (48%), Gaps = 37/229 (16%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           E++++K L++  NIV+Y+       G  +  +++ +L+E C  GSL D + +     + E
Sbjct: 68  EIDLLKNLKH-ENIVKYH-------GFIQKSHQLFILLEYCSQGSLRDLIKR---GPVEE 116

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASH 219
            +    +     GL ++H Q   +IHRDIK  N+L+DA N  KL DFG            
Sbjct: 117 QQCKTYIRQTLHGLKYLHDQ--GVIHRDIKAANLLLDAQNVVKLADFG------------ 162

Query: 220 QEIAMLMNNIYV--HTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE-L 276
             ++  +NN+ +    +P + +PE++        +  SDIW+LG  + ++L    PF  L
Sbjct: 163 --VSTRVNNLAMTYAGSPNWMAPEVM---MGQGASTVSDIWSLGATVVEILTGNPPFHNL 217

Query: 277 TGQ---FAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
             +   +AI+H  Y IP ++ SS     +     +N + RP    ++ H
Sbjct: 218 VNEAACYAIVHDVY-IPPSTLSSSCRKFLRSCFQKNMFKRPKAQDLLSH 265

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 143/340 (42%), Gaps = 41/340 (12%)

Query: 13  TEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQD 72
           T+ +  T A     E+ +  + +  G+   +  + L +G ++ ++       T++ D   
Sbjct: 89  TDVMTATDADIKDAEIFRRQTIIRKGIKDFKFGDMLGDGSYSQVFLA-----TSKTDSSK 143

Query: 73  ----RILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGK 128
               ++L     +  K+V+      +N  +  ++ +K +    N+   +   A+      
Sbjct: 144 TYAVKVLNKEYLIKQKKVKY-----VNIEKTALQNLKSVTGVINLSFTFQDEAN------ 192

Query: 129 PGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDI 188
               +  L+E  PNG  L  + ++  T L+E   +     I   +  MH     +IHRDI
Sbjct: 193 ----LYFLLEYAPNGDFLSLI-KKFGT-LNEECTIYYSAQIIDAIGSMHSH--GIIHRDI 244

Query: 189 KIENVLVDADNNFKLCDFGSTSPCLPAVASHQ---EIAMLMNNIYVHTTPQYRSPEMI-D 244
           K EN+L+D +   KL DFG T+  L   +         +L  +     T +Y SPE++ D
Sbjct: 245 KPENILLDGNMKIKLTDFG-TAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSD 303

Query: 245 LYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP---RNSFSSKLINL 301
            Y     + K DIWA G  +Y+++    PF+ T ++       ++       F + + +L
Sbjct: 304 NY----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPTIIRDL 359

Query: 302 VIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGP 341
           V  +L + P  R  + Q+  H C         + ++ + P
Sbjct: 360 VKNILVKQPEKRLTIPQIKEH-CLFENINFSDNSVWNRDP 398

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 90/200 (45%), Gaps = 18/200 (9%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  L+E  P+G  L  + +     L+E         I   +  +H     +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLIKKY--GSLNETCARYYASQIIDAVDSLH--NIGIIHRDIKPEN 254

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHT-----TPQYRSPEMI-DLY 246
           +L+D +   KL DFG T+  LP   S+        ++Y  +     T +Y SPE++ D Y
Sbjct: 255 ILLDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY 313

Query: 247 RCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP---RNSFSSKLINLVI 303
                + + DIWA G  LY++L    PF+   ++       +I       F   + +LV 
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 304 IMLAENPYLRPNVYQVMYHI 323
            +L  +P  R  + Q+  H+
Sbjct: 370 KLLVRDPNDRLTIKQIKAHL 389

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 96/195 (49%), Gaps = 25/195 (12%)

Query: 80  TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           +V +K++ +  +     + NE+ VMK  ++  NIV + DS   + GD      + ++ME 
Sbjct: 645 SVAIKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFIDSYVLK-GD------LWVIMEY 696

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
              GSL D +   +   L+E ++  +  +   GL  +H +   ++HRDIK +N+L+  + 
Sbjct: 697 MEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLEFLHSKG--VLHRDIKSDNILLSMEG 751

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
           + KL DFG         A   E+ +    +    TP + +PE++      P   K DIW+
Sbjct: 752 DIKLTDFG-------FCAQINELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWS 799

Query: 260 LGIFLYKLLFYTTPF 274
           LGI + +++    P+
Sbjct: 800 LGIMIIEMIEGEPPY 814

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 72/143 (50%), Gaps = 14/143 (9%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           + +++E    G    Y+ ++   +L E+   ++   +  G+++MHY+   L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYIQRK--RRLKESSACRLFAQLISGVNYMHYK--GLVHRDLKLEN 180

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           +L+D   N  + DFG  +          E   LM       +P Y +PE++   +     
Sbjct: 181 LLLDKHENLVITDFGFVNEFF-------EDNELMKTSC--GSPCYAAPELVVSTKAYEA- 230

Query: 253 EKSDIWALGIFLYKLLFYTTPFE 275
            K+D+W+ G+ LY +L    P++
Sbjct: 231 RKADVWSCGVILYAMLAGYLPWD 253

>Scas_616.10
          Length = 1461

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 94/201 (46%), Gaps = 32/201 (15%)

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
           E+ L++E    G L DY+  +   KLSE E +     I  G+S+ H     + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 192 NVLVDADN-NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT---PQYRSPEMI--DL 245
           N+L+D  N + K+ DFG  +  LP             N  + T+   P Y SPE++    
Sbjct: 266 NLLLDKKNKSIKIADFGMAALELP-------------NKLLQTSCGSPHYASPEIVMGKS 312

Query: 246 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPRNSFSSKLINL 301
           Y   P    SD+W+ GI L+ LL    PF       +L      K+ +P ++ S +  +L
Sbjct: 313 YHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMP-STLSPEAQDL 367

Query: 302 VIIMLAENPYLRPNVYQVMYH 322
           +  +L  +P  R    +++ H
Sbjct: 368 ISRILVIDPSKRITTDRILNH 388

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 120/271 (44%), Gaps = 39/271 (14%)

Query: 75   LQPGDTVCLKRVRVSDENGLNEL--------RNEVEVMKKLRNCSNIVQYYDSNASRLGD 126
            +  G+ + +K+V V      NEL        ++EV  +K L +  NIVQY       LG 
Sbjct: 1171 ITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHL-NIVQY-------LGS 1222

Query: 127  GKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHR 186
               G    L +E    GS+   +  RL  +  E  +  +   +  GL ++H +   ++HR
Sbjct: 1223 EIRGNIYSLFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLHSK--GILHR 1278

Query: 187  DIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY 246
            D+K +N+L+D D   K+ DFG  S     + S+ ++ M         T  + +PEM+D  
Sbjct: 1279 DMKADNLLLDEDGICKISDFG-ISKKSKNIYSNSDMTM-------RGTVFWMAPEMVDTK 1330

Query: 247  RCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYE--IPRNS---FSSK 297
            +    + K DIW+LG  + ++     P+     +   F I  SK    IP ++    SSK
Sbjct: 1331 QGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSK 1388

Query: 298  LINLVIIMLAENPYLRPNVYQVMYHICSMME 328
              + +      +P  RP    ++ H  S ++
Sbjct: 1389 GKDFLSKCFEIDPEKRPTADDLLEHSFSKVD 1419

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 96/200 (48%), Gaps = 24/200 (12%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           ++ L++E+ ++K+L +  NIV YY       G  + G  + + +E  P GS+   +N   
Sbjct: 498 VDALQHEMNLLKELHH-ENIVTYY-------GASQEGGNLNIFLEYVPGGSVSSMLNN-- 547

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
                E+ +      I +G++++H  +  +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 548 YGPFEESLITNFTRQILIGVAYLH--KKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 605

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
           P      + A L  +++      + SPE++   +      K+DIW+ G  + ++     P
Sbjct: 606 PLNKKQNKRASLQGSVF------WMSPEVV---KQTATTAKADIWSTGCVVIEMFTGKHP 656

Query: 274 FELTGQFAILHSKYEIPRNS 293
           F     F+ + + ++I  N+
Sbjct: 657 FP---DFSQMQAIFKIGTNT 673

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 115/262 (43%), Gaps = 39/262 (14%)

Query: 78   GDTVCLKRVRVSDENGLNE--------LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKP 129
            G+ + +K+V V   +  NE        LR+EV  +K L +  NIVQY       LG    
Sbjct: 1198 GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHL-NIVQY-------LGFENK 1249

Query: 130  GYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIK 189
                 L +E    GS+   +  R+  +  E  +  +   +  GL+++H +   ++HRD+K
Sbjct: 1250 NNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDMK 1305

Query: 190  IENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCL 249
             +N+L+D D   K+ DFG  S     + S+ ++ M         T  + +PEM+D  +  
Sbjct: 1306 ADNLLLDQDGICKISDFG-ISRKSKDIYSNSDMTM-------RGTVFWMAPEMVDTKQGY 1357

Query: 250  PINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYEIPRNSFSSKLI-----N 300
              + K DIW+LG  + ++     P+     +   F I  SK   P    +  LI     N
Sbjct: 1358 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRN 1415

Query: 301  LVIIMLAENPYLRPNVYQVMYH 322
             +      NP  RP   +++ H
Sbjct: 1416 FLDACFEINPEKRPTANELLSH 1437

>Scas_640.14*
          Length = 728

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 103/240 (42%), Gaps = 46/240 (19%)

Query: 48  LAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKL 107
           L EG F  +     +G++       +I +    V +K +R       +E     + MK  
Sbjct: 44  LGEGEFGKVK----MGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSE-----KEMKIF 94

Query: 108 RNCSNIVQYYDSNASRLGDGKPGYEVL-LLMELCPNGSLLDYMNQRLATKLSEAEVLKIM 166
           R  +++      N  RL +     + + +++E    G    Y+ ++   +L EA   ++ 
Sbjct: 95  REINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRK--RRLKEATACRLF 152

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             +  G+S+MH +   ++HRD+K+EN+L+D   N  + DFG                  +
Sbjct: 153 AQLISGVSYMHSK--GIVHRDLKLENLLLDKHENLIITDFG-----------------FV 193

Query: 227 NNIYVHT--------TPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
           N  Y           +P Y +PE++   + Y+      K+DIW+ GI LY +L    P++
Sbjct: 194 NEFYADNELMKTSCGSPCYAAPELVITTEPYKA----RKADIWSCGIILYGMLAGYLPWD 249

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 86/187 (45%), Gaps = 28/187 (14%)

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
           N++  EV +  +    SNI++  D N S+       Y + + ME+   G L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISK------DY-LWIAMEMADGGDLFDKIEPDIG 56

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC-- 212
               +AEV +  +   +   H  ++   + HRDIK EN+L+D + N KL DFG  S    
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEVCGIAHRDIKPENILLDKNGNLKLADFGLASQFRR 113

Query: 213 ---LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269
                 +A  Q             +P Y +PE+I  Y      + +DIW+ GI ++ LL 
Sbjct: 114 KDGTKRLARDQ-----------RGSPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLT 160

Query: 270 YTTPFEL 276
             TP+EL
Sbjct: 161 GETPWEL 167

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 114/258 (44%), Gaps = 58/258 (22%)

Query: 46   EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-----SDENGLN---EL 97
            E + +G F  +Y    V               G+ + +K+V V      DE+ ++    L
Sbjct: 1042 EIIGKGSFGAVYLALNVTT-------------GEMLAVKQVTVPEFSSQDESAISMVEAL 1088

Query: 98   RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKL 157
            ++EV  +K L N  NIVQY       LG  +      L +E    GS+   +  R+  + 
Sbjct: 1089 KSEVSTLKDL-NHVNIVQY-------LGFEEKNGIYSLFLEYVAGGSVGSLI--RMYGRF 1138

Query: 158  SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
             +  +  +   +  GL+++H +   ++HRD+K +N+L+D D   K+ DFG          
Sbjct: 1139 DDQLIRHLTKQVLEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDFG---------- 1186

Query: 218  SHQEIAMLMNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271
                I+   NNIY ++      T  + +PEM+D       + K DIW+LG  + ++    
Sbjct: 1187 ----ISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGK 1240

Query: 272  TPFELTGQFAILHSKYEI 289
             P+     F ++ + ++I
Sbjct: 1241 RPW---SNFEVVAAMFQI 1255

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 105/235 (44%), Gaps = 43/235 (18%)

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           R R+S+   L E   EV++  K+    NIVQ YD            ++  ++ME C  G 
Sbjct: 112 RSRLSNNICL-EAMYEVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGD 159

Query: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA--DNNFK 202
           L + +   L  K ++ E+  I+  I   +  +H ++  + HRDIK EN+L+ +  D   K
Sbjct: 160 LYEAIKDDLVPKKTK-EITHILTQILDAIEFVHNKQ--IYHRDIKPENILITSLIDWKIK 216

Query: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE--------K 254
           L D+G        +A+  E +   N      + +Y  PE+ +    L I+E        K
Sbjct: 217 LTDWG--------LATTDEKSYDRNV----GSERYMPPELFE--SNLDIDERKEPYDCSK 262

Query: 255 SDIWALGIFLYKLLFYTTPFELTGQ----FAILHSKYEIPRNSFSSKLINLVIIM 305
            D+W++GI    ++FY  PF +  Q    F    S  E   + FS+   +   ++
Sbjct: 263 VDLWSIGIVFLNVVFYKNPFRIADQSDKSFCYFASNREALFDVFSTMTYDFFQVL 317

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 127/297 (42%), Gaps = 42/297 (14%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGL 94
           +LVG    E I  L +G    +Y V     TN L    +I    + +  K+++       
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVR-EKQTNRL-YALKIFSKPEMIKRKKIK------- 422

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
             +  E E++    N   IV  Y S  +        Y + L ME C  G     +  R  
Sbjct: 423 -RILTEQEILA-TSNHPFIVTLYHSFQTE------DY-LYLCMEYCMGGEFFRALQTRKT 473

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG------- 207
             +SE +      ++T  L ++H      I+RD+K EN+L+    +  L DF        
Sbjct: 474 KCISEDDARFYSSEVTAALEYLHLM--GFIYRDLKPENILLHQSGHIMLSDFDLSVQAKD 531

Query: 208 STSPCLPAVASHQEIAM------LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           + +P +   ASH  +           N +V T  +Y +PE+I   R        D W LG
Sbjct: 532 TKNPQVKGNASHSLVDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWWTLG 587

Query: 262 IFLYKLLFYTTPF--ELTGQ-FA-ILHSKYEIPRNSFSSKLI-NLVIIMLAENPYLR 313
           I +Y++LF  TPF  + T Q F+ IL ++  IP N+ +S+   +L+  +L +N   R
Sbjct: 588 ILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNENKR 644

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 42/124 (33%), Positives = 64/124 (51%), Gaps = 19/124 (15%)

Query: 153 LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
           L T ++E E   I   +  G+ H+H     ++HRDIK EN++VD     KL DFGS    
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGS---- 138

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
               A++ +      +++V T   Y +PE++  D Y   P     DIWA+G+ LY ++F 
Sbjct: 139 ----AAYVKSGPF--DVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFK 187

Query: 271 TTPF 274
             PF
Sbjct: 188 ENPF 191

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 111/223 (49%), Gaps = 26/223 (11%)

Query: 75   LQPGDTVCLKRVRVSDENGLNEL----RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPG 130
            L+ G+ + +K +++ D   + ++    + E+ V++ L N  NIVQYY     R       
Sbjct: 1054 LENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEML-NHPNIVQYYGVEVHR------- 1105

Query: 131  YEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKI-MYDITVGLSHMHYQRTPLIHRDIK 189
             +V + ME C  GSL   ++     ++ +  V ++  +++  GL+++H  ++ ++HRDIK
Sbjct: 1106 DKVNIFMEYCEGGSLASLLDH---GRIEDEMVTQVYTFELLEGLAYLH--QSGVVHRDIK 1160

Query: 190  IENVLVDADNNFKLCDFGSTSPCLPAV------ASHQEIAMLMNNI-YVHTTPQYRSPEM 242
             EN+L+D +   K  DFG+    + +       A+ Q+  +   ++  +  TP Y +PE 
Sbjct: 1161 PENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPET 1220

Query: 243  IDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE-LTGQFAILH 284
            I            D+WALG  + ++     P+  L  ++AI++
Sbjct: 1221 ISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMY 1263

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 87/186 (46%), Gaps = 34/186 (18%)

Query: 133 VLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRD 187
           + ++M+    G L   +  +QR      K   AEV       T+ L ++H+    +I+RD
Sbjct: 124 LFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEV-------TLALEYLHFHN--IIYRD 174

Query: 188 IKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR 247
           +K EN+L+D + + K+ DFG          +            +  TP Y +PE+I    
Sbjct: 175 LKPENILLDRNGHIKITDFGFAKEVETVTWT------------LCGTPDYIAPEVI---A 219

Query: 248 CLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPRNSFSSKLINLVI 303
             P N+  D W+LG+ +Y++L   TPF  T        ILH K   P+  F+S +I+L+ 
Sbjct: 220 TKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQ-FFNSDVIDLLS 278

Query: 304 IMLAEN 309
            +L  +
Sbjct: 279 KLLTAD 284

>Scas_675.2
          Length = 527

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 102/208 (49%), Gaps = 26/208 (12%)

Query: 75  LQPGDTVCLKRVRV--SDENGLNELRNEVEVMKKLRNCS---NIVQYYDSNASRLGDGKP 129
           + P   + +K V +    +NGL E     EV+   R CS   N+++  D N ++      
Sbjct: 36  VDPSVIIAVKYVHIPTCKKNGLTEKDISREVLLHSR-CSKNPNVLRLIDCNIAK------ 88

Query: 130 GYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITV-GLSHMHYQRTPLIHRDI 188
            Y + ++ME+   G L D +   +     ++EV +  +   V  +S++H +   + HRDI
Sbjct: 89  DY-MWMIMEMADGGDLFDKIEPDVGV---DSEVAQFYFQQLVRAISYLH-EECGVAHRDI 143

Query: 189 KIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRC 248
           K EN+L+D + N KL DFG +S         ++   L  +     +P Y +PE+  L+  
Sbjct: 144 KPENILLDKNGNLKLADFGLSS------QYRRKDGTLRISTDQRGSPPYMAPEI--LHSR 195

Query: 249 LPINEKSDIWALGIFLYKLLFYTTPFEL 276
                 +DIW++GI L+ LL   TP+EL
Sbjct: 196 GYYAHSTDIWSIGILLFVLLTGETPWEL 223

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 86/199 (43%), Gaps = 29/199 (14%)

Query: 81  VCLKRVRVSDE----NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLL 136
           +C  +V   +E    N   + R EVE+   L N  N+ + Y        D K    V LL
Sbjct: 129 ICALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSY----GYFHDEK---RVYLL 180

Query: 137 MELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVD 196
           ME   NG +  Y   RL    ++      +Y I   L +MH  +  +IHRDIK EN+L+ 
Sbjct: 181 MEYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPENILIG 236

Query: 197 ADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSD 256
            +N  KL DFG +    P                V  T  Y SPEM++       +   D
Sbjct: 237 FNNVIKLTDFGWSIINPPENRRKT----------VCGTIDYLSPEMVE---SREYDHTID 283

Query: 257 IWALGIFLYKLLFYTTPFE 275
            WALG+  ++LL    PFE
Sbjct: 284 AWALGVLAFELLTGAPPFE 302

>Scas_548.6
          Length = 1382

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 65/124 (52%), Gaps = 19/124 (15%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              T ++E E   I   I  G+ H+H Q   ++HRDIK ENV+VD+    K+ DFGS    
Sbjct: 1224 FKTNMTEFEAKLIFKQIVSGIKHLHDQ--GIVHRDIKDENVIVDSKGCVKIIDFGS---- 1277

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                A++ +      +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F 
Sbjct: 1278 ----AAYVKSGPF--DVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFK 1326

Query: 271  TTPF 274
              PF
Sbjct: 1327 ENPF 1330

>Scas_633.29
          Length = 789

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/362 (24%), Positives = 148/362 (40%), Gaps = 63/362 (17%)

Query: 29  LQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV 88
           L   +T+ V   + E IE L  GG + +YKV         + Q+++        LKRV  
Sbjct: 287 LAKRNTITVNDTEYEKIELLGRGGSSRVYKVK--------NSQNKVF------ALKRVSF 332

Query: 89  S--DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLL 146
              D++ ++  + E+E+++KL N S +V+ +D    ++  G     VL L+  C +  L 
Sbjct: 333 DEFDDSSVDGFKGEIELLEKLSNESRVVKLFDY---QMDSG-----VLFLIMECGDHDLS 384

Query: 147 DYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206
             ++QR    L    V     ++   +  +H     ++H D+K  N  V      K+ DF
Sbjct: 385 QILSQRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKIIDF 441

Query: 207 GSTSPCLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMI---------DLYRCLPINEK 254
           G  +    A+  H        NIY      TP Y +PE +         D      + + 
Sbjct: 442 GIAN----AIPDHTV------NIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKP 491

Query: 255 SDIWALGIFLYKLLFYTTPFE-LTGQ----------FAILHSKYEIPRNSFSSKLINLVI 303
           SDIW+ G  +Y++++   P+    GQ            ++ S+      S    LI+L+ 
Sbjct: 492 SDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMK 551

Query: 304 IMLAENPYLRPNVYQVMY--HICSMMECEVKIDDLYGQG-PYNFDMYGRYQEKLQRLQYD 360
             L  +P  R +V QV+       ++     I DL      Y  D      EK++ L  D
Sbjct: 552 GCLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELAND 611

Query: 361 ML 362
           +L
Sbjct: 612 VL 613

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 127/309 (41%), Gaps = 54/309 (17%)

Query: 34  TVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DE 91
           T+ V     E +E L +GG   +YKV    +                  LKRV     DE
Sbjct: 464 TITVNGTAYEKVELLGKGGSGKVYKVKSSDHK--------------VYALKRVSFDEFDE 509

Query: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151
           + ++  + E+E++KKL N   +V+  D +   +G G     VL L+  C    L   + Q
Sbjct: 510 SSIDGFKGEIELLKKLENKQRVVKLIDYH---MGQG-----VLFLLMECGEHDLSQVLTQ 561

Query: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211
           R         V     ++   +  +H     ++H D+K  N  V      K+ DFG  + 
Sbjct: 562 RSKIPFDTEFVRYHFQEMIKCVKVVH--DADIVHSDLKPAN-FVFVKGMLKIIDFGIAN- 617

Query: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI---DLYRC------LPINEKSDIWALGI 262
              AV  H       N I    TP Y +PE +   +  R         + + SD+W+ G 
Sbjct: 618 ---AVPDHTVNIYRDNQI---GTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGC 671

Query: 263 FLYKLLFYTTPF-ELTGQ---FAILHSKYEIP---RNSFSS----KLINLVIIMLAENPY 311
            LY++++   P+    G    +AI++   +IP   ++SF +     +I+ +   L  NP 
Sbjct: 672 ILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPI 731

Query: 312 LRPNVYQVM 320
            R  + Q++
Sbjct: 732 SRVTIDQLL 740

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 65/124 (52%), Gaps = 19/124 (15%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              T ++E E   I   +  G+ H+H Q   ++HRDIK ENV+VD+    K+ DFGS    
Sbjct: 1198 FKTNMTEFEAKLIFKQVVAGIKHLHDQ--GIVHRDIKDENVIVDSKGFVKIIDFGS---- 1251

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                A++ +      +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F 
Sbjct: 1252 ----AAYVKSGPF--DVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFK 1300

Query: 271  TTPF 274
              PF
Sbjct: 1301 ENPF 1304

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 91/186 (48%), Gaps = 32/186 (17%)

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM----- 149
           N+L  E+ +MK +    NIV +Y +      +     E+++LME    GSL   +     
Sbjct: 207 NQLVRELTIMKNVSAHDNIVGFYGA----FYNPSTTNEIVILMEYMDCGSLDKILSVYRS 262

Query: 150 -----NQRLATKLS---EAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNF 201
                N  ++ K S   E  + +I + +  GL ++ Y    +IHRDIK  N+L+++  + 
Sbjct: 263 DCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYL-YDCYKIIHRDIKPSNILINSKGDV 321

Query: 202 KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           K+CDFG ++  + ++A          + +V T+  Y SPE I   R      K D+W+LG
Sbjct: 322 KICDFGVSTTLINSLA----------DTFVGTS-TYMSPERIQGGR---YTTKGDVWSLG 367

Query: 262 IFLYKL 267
           + + +L
Sbjct: 368 LMIIEL 373

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 104/228 (45%), Gaps = 32/228 (14%)

Query: 103 VMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEV 162
           V+ KL +  N++  YD         +    + L++E    G L + +       L E E 
Sbjct: 79  VIMKLLSHPNVLSLYDV-------WETNNNLYLILEYAEKGELFNLLVDH--GPLPEREA 129

Query: 163 LKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI 222
           +     I +G+S+ H     ++HRD+K EN+L+D+  N K+ DFG        +A+ Q  
Sbjct: 130 INCFRQIIIGISYCHA--LGIVHRDLKPENLLLDSFYNIKIADFG--------MAALQTD 179

Query: 223 AMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF-ELTGQ- 279
           A L+       +P Y +PE++     LP     SD+W+ G+ L+ LL    PF E  G  
Sbjct: 180 ADLLET--SCGSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNV 234

Query: 280 ----FAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYH 322
                 +   ++E+P ++  S    +L+  +L  +P  R  +  ++ H
Sbjct: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 102/229 (44%), Gaps = 35/229 (15%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR--VSDENGLNELRNE 100
           EV++ L +G +  +  VS V  +N         + G  + +K++      E  L     E
Sbjct: 122 EVLQVLGKGSYGTV--VSAVDNSNP--------EYGVRIAIKKITNIFHREVLLKRAIRE 171

Query: 101 VEVMKKLRNCSNIVQYYDSN--ASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL---AT 155
           ++ M   +   NI+   D +  + +  DG   Y+            L+DY   R+   + 
Sbjct: 172 LKFMNYFKGHKNIINLLDLDIVSEKPYDGLYCYQ-----------ELIDYDLARVIHSSV 220

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
           +LSE  +   +Y I  GL ++H     +IHRD+K  N+L     N K+CDFG      P 
Sbjct: 221 QLSEFHIKSFLYQILCGLKYIH--SADVIHRDLKPGNILCTIHGNLKICDFGLARGVSPQ 278

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264
               + ++ + N +    T  YR+PE+I  ++    ++  D+WA+G  L
Sbjct: 279 FFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVGCIL 322

>Scas_458.1
          Length = 367

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 122/302 (40%), Gaps = 58/302 (19%)

Query: 75  LQPGDTVCLKRVRV--SDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYE 132
            + G    LKR+     D   ++   NE+   KK    S+I+   D    +  DG    +
Sbjct: 56  FENGPLFVLKRIYCPFGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQID 115

Query: 133 VLLLMELCPNGSLLDYMNQR-------LATKLSEAEVLKIMYDITVGLSHMH-------- 177
           VL        GS+ D +N+        L T + E + +KIM  +  GL  +H        
Sbjct: 116 VLF--PFYHYGSVQDDINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQG 173

Query: 178 ----------YQRTPLIHRDIKIE--------------------NVLVDADNNFKLCDFG 207
                      +  PL+  D+ +E                     +L+    N  + D  
Sbjct: 174 SPDDMAIMSYSENAPLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQ 233

Query: 208 STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
           S       +++  ++      I  H T Q+ +PE++ L     I  K DIW+LG  LY +
Sbjct: 234 SCFRTNITISTEIQLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSM 293

Query: 268 LFYTTPFE----LTG---QFAILHSKYEIP--RNSFSSKLINLVIIMLAENPYLRPNVYQ 318
           +F  +PFE    L G   ++ I   KY IP  + ++S ++I+++   L  +P  RP++  
Sbjct: 294 MFGISPFEREEQLNGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNG 353

Query: 319 VM 320
           ++
Sbjct: 354 IL 355

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 110/257 (42%), Gaps = 39/257 (15%)

Query: 43  EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR--VSDENGLNELRNE 100
           E+I++L +G +  +  V F G +           P   + +K++    + E  L     E
Sbjct: 39  EIIQFLGKGAYGTVCSVKFKGRS-----------PAARIAVKKISNIFNKEILLKRAIRE 87

Query: 101 VEVMKKLRNCSNIVQYYDSN--ASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL---AT 155
           ++ M   +   NIV   D     S   DG   Y+            L+DY   ++   + 
Sbjct: 88  LKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQ-----------ELIDYDLAKVIHSSV 136

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
           +LSE  +   +Y I  GL ++H     +IHRD+K  N+L   +   K+CDFG        
Sbjct: 137 QLSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAG 194

Query: 216 -VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
               H  +   + N YV  T  YR+PE+  L    P ++  DIWA+G  L +  FY    
Sbjct: 195 FFKCHSTVQPHITN-YV-ATRWYRAPEL--LLSNQPYSKSVDIWAVGCILAE--FYARKP 248

Query: 275 ELTGQFAILHSKYEIPR 291
              G+ + +H  +EI +
Sbjct: 249 VFMGRDS-MHQIFEIIK 264

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 91/199 (45%), Gaps = 32/199 (16%)

Query: 96  ELRNEVEVMKKL--RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           +++ E+ +MKK    +   +++  D   SR        ++ L++E C  G +       +
Sbjct: 173 KIKREIAIMKKCHHEHVVKLIEVLDDAKSR--------KIYLVLEYCSKGEIKWCPGDVI 224

Query: 154 ATK------LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG 207
            TK      LS     +I   + +GL ++H+Q   +IHRDIK  N+L+  D   K+ DFG
Sbjct: 225 ETKARGPPLLSFQRTREIFRGVLLGLEYLHFQ--GIIHRDIKPANLLLSEDGIVKISDFG 282

Query: 208 STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEM------IDLYRCLP------INEKS 255
             S    + +S   +  L        TP + +PE+      I  +   P      I+  +
Sbjct: 283 -VSLAFSSDSSTDSLNEL-ELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPIISFPT 340

Query: 256 DIWALGIFLYKLLFYTTPF 274
           DIWA+GI L+ LLF   PF
Sbjct: 341 DIWAMGITLHCLLFGMLPF 359

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 101/247 (40%), Gaps = 48/247 (19%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDEN----- 92
           G H+ +V   +  G F+ ++             QD   Q G  V LK VR   +N     
Sbjct: 3   GNHRYKVGRLIQSGSFSVVHHA-----------QD--CQTGQDVALKYVRKPHDNPEQLQ 49

Query: 93  -GLNELRNEVEVMKKL---RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDY 148
                + NE  ++++L   RN   ++ +Y+   +           + ++E C  G L D+
Sbjct: 50  KVAALVHNEYAILRRLGTHRNICQLLDFYEDADT----------YVFVLEYCAYGDLYDF 99

Query: 149 MNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGS 208
           +                ++ +   +S+ H +     HRDIK ENVL+D     KL DFG 
Sbjct: 100 IKAIRERPTMRINFHSFLFQLCSAISYCHSKDVS--HRDIKPENVLMDDRGQVKLTDFG- 156

Query: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268
               L  + S       ++  Y   T +Y +PE     R       +D W+LGI ++ L+
Sbjct: 157 ----LSQIGS-------VSKDYCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCLM 203

Query: 269 FYTTPFE 275
           F + PFE
Sbjct: 204 FGSCPFE 210

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 110/256 (42%), Gaps = 36/256 (14%)

Query: 81  VCLKRVRVS-DENGLNELRNEVEVMKKLRNCSN--IVQYYDSNASRLGDGKPGYEVLLLM 137
           + +K VR+  DE+   ++  E+EV   L NC +  IV +Y    +   +G     V + M
Sbjct: 444 MAMKEVRLELDESKFRQILMELEV---LHNCQSPYIVDFY---GAFFIEGA----VYMCM 493

Query: 138 ELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA 197
           E    GSL    +      + E ++ +I   +  GL  +      +IHRD+K  N+L  A
Sbjct: 494 EYMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHN-IIHRDVKPTNILCSA 552

Query: 198 D-NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR--CLPINEK 254
                KLCDFG +   + ++A          NI   +   Y +PE I          + +
Sbjct: 553 SQGTIKLCDFGVSGNLVASLAK--------TNIGCQS---YMAPERIKSLNPDKSTYSVQ 601

Query: 255 SDIWALGIFLYKLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIML 306
           SDIW+LG+ + ++     P+        F+ L +  +     +P   FS+   N V + L
Sbjct: 602 SDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMCL 661

Query: 307 AENPYLRPNVYQVMYH 322
            + P  RP    ++ H
Sbjct: 662 QKIPERRPTYAALLEH 677

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 113/228 (49%), Gaps = 37/228 (16%)

Query: 101 VEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEA 160
           ++++K L++  NIV+Y+       G  +  +E+ +L+E C  GSL D + +     LSEA
Sbjct: 65  IDLLKNLKH-ENIVKYH-------GFIQSSHELYILLEYCIRGSLRDLIKKE---ALSEA 113

Query: 161 EVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQ 220
           +    +     GL ++H Q   +IHRDIK  N+L+  +   KL DFG             
Sbjct: 114 KAKTYVRQTLRGLQYLHDQ--GVIHRDIKAANLLLTENGVVKLADFG------------- 158

Query: 221 EIAMLMNNIYV--HTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELT 277
            ++  +NN+ +    +P + +PE++        +  SDIW+LG  + +LL    PF  L 
Sbjct: 159 -VSTRVNNMAMTYAGSPNWMAPEVM---LGKGASTVSDIWSLGATVVELLTGNPPFYNLV 214

Query: 278 GQ---FAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
            +   +AI++  Y  P +  S++    + +   +N + RP  +Q++ H
Sbjct: 215 NEAACYAIVNDVYYPPEH-LSAECKAFMELCFQKNMFKRPQAHQLLQH 261

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 112/263 (42%), Gaps = 59/263 (22%)

Query: 46   EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV-----SDENGLNE---L 97
            E + +G F  +Y    +G           +  G+ + +K+V V      DE  +N    L
Sbjct: 1128 EMIGKGSFGAVY----LGLN---------VTTGEMMAVKQVEVPKFGSQDETTVNNAEAL 1174

Query: 98   RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKL 157
             +EV  +K L +  NIVQY       LG         L +E    GS+   +  RL    
Sbjct: 1175 ISEVSTLKDLDHL-NIVQY-------LGFENKNCIYSLFLEYVAGGSVGSLI--RLYGHF 1224

Query: 158  SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
             E  +  +   +  GL+++H +   ++HRD+K +N+L+D D   K+ DFG          
Sbjct: 1225 DEQLIRFLTTQVLEGLAYLHLR--GILHRDMKADNLLLDNDGVCKISDFG---------- 1272

Query: 218  SHQEIAMLMNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271
                I+   NNIY ++      T  + +PEM+D  +    + K DIW+LG  + ++    
Sbjct: 1273 ----ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFAGK 1326

Query: 272  TPFE----LTGQFAILHSKYEIP 290
             P+     +   F I  SK   P
Sbjct: 1327 RPWSNLEVVAAMFQIGKSKSAPP 1349

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 110/244 (45%), Gaps = 38/244 (15%)

Query: 41  QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNE 100
           Q+E +  L EG    + K        +L    +I        L     +D+    ++  E
Sbjct: 235 QIEELGVLGEGAGGSVTKC-------KLRHGSKIFALKTITTL----TTDQESQKQIFRE 283

Query: 101 VEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL---ATKL 157
           ++  K  ++   IV+YY      +   +    + + ME    G  LD + + L     ++
Sbjct: 284 LQFNKSCKS-DYIVRYYG-----MFTDEEHSSIYIAMEYM-GGRSLDAIYKHLLKHGGRV 336

Query: 158 SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
            E  + KI   +  GLS++H ++  +IHRDIK +N+L++     KLCDFG +   + ++A
Sbjct: 337 GEKVLGKIAESVLRGLSYLHQRK--IIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSLA 394

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 277
           +               T  Y +PE I   +  P +  SD+W+LG+ L ++     PF+ +
Sbjct: 395 T-----------TFTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQAHFPFD-S 439

Query: 278 GQFA 281
           G+FA
Sbjct: 440 GKFA 443

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 134/315 (42%), Gaps = 65/315 (20%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DEN 92
           + V   Q E IE L  GG + +YKV   G        +R+        LKRV     D++
Sbjct: 433 ITVNDSQYEKIELLGRGGSSRVYKVKGSG--------NRVY------ALKRVSFDAFDDS 478

Query: 93  GLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
            ++  + E+E+++KL++   ++Q  D     +GDG     +L L+  C +  L   +NQR
Sbjct: 479 SIDGFKGEIELLEKLKDQKRVIQLLD---YEMGDG-----LLYLIMECGDHDLSQILNQR 530

Query: 153 LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN-VLVDADNNFKLCDFGSTSP 211
               L    V     ++ + +  +H     ++H D+K  N VLV      K+ DFG  + 
Sbjct: 531 SGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVLVKGI--LKIIDFGIAN- 585

Query: 212 CLPAVASHQEIAMLMNNIYVHT---TPQYRSPEMIDLYRC------------LPINEKSD 256
              AV  H        NIY  T   TP Y +PE +                   +   SD
Sbjct: 586 ---AVPEHTV------NIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSD 636

Query: 257 IWALGIFLYKLLFYTTPF-ELTGQ---FAILHSKYEIP---RNSFSSKL----INLVIIM 305
           +W+ G  +Y++++   P+    GQ    AI++   +IP     S + K+    I L+   
Sbjct: 637 MWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKAC 696

Query: 306 LAENPYLRPNVYQVM 320
           L  NP  R  V +V+
Sbjct: 697 LYRNPDKRWTVDKVL 711

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 120/269 (44%), Gaps = 54/269 (20%)

Query: 68  LDRQDRILQPGDTVCLKRVRVSDENGL-NELRNEVEVMKKLRNCSNIVQYYDSNASRLGD 126
           L+++  +L+   ++  ++VR    N +  E   EV++  K+    NI + YD        
Sbjct: 74  LEKRQMLLRRQRSLISEKVRSRLSNHICFEALYEVDIQSKIGKHKNITELYDY------- 126

Query: 127 GKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHR 186
               ++  ++ME C  G L + +      + +  ++  I+  I   +  +H +   + HR
Sbjct: 127 ----FDSYIIMEYCSGGDLYEAIKADTIPRKTR-QLTHIISQILDAVEFVHSK--GIYHR 179

Query: 187 DIKIENVLVDADNNF--KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMID 244
           DIK EN+L+ AD+N+  KL D+G        +A+  + +M  N      + +Y +PE+ +
Sbjct: 180 DIKPENILI-ADSNWTVKLTDWG--------LATTDQTSMDRNV----GSERYMAPELFE 226

Query: 245 L----------YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ----FAILHSKYEIP 290
                      Y C     K DIWA+GI L  ++F+  PF +  Q    F    +  E  
Sbjct: 227 SNLDYDERNEPYEC----SKVDIWAIGIVLLNIVFHKNPFSVANQTDKSFCYFAANREAL 282

Query: 291 RNSFSS------KLINLVIIMLAENPYLR 313
            + FS+      +L+   + +   N YLR
Sbjct: 283 FDVFSTMSYDLYQLLRHSLTIDPTNRYLR 311

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 86/177 (48%), Gaps = 37/177 (20%)

Query: 108 RNCSN--IVQYY-----DSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ---RLATKL 157
           +NC +  IV+YY     D N+S          + + ME    G  LD + +   R   ++
Sbjct: 250 KNCKSEYIVRYYGMFNDDRNSS----------IYIAMEYM-GGKSLDAIYKNLLRRGGRI 298

Query: 158 SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
           SE  + KI   +  GLS++H +R  +IHRDIK +N+L++     KLCDFG +   + ++A
Sbjct: 299 SEKVLGKIAESVLRGLSYLHERR--IIHRDIKPQNILLNEIGQVKLCDFGVSGEAVNSLA 356

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
           +               T  Y +PE I   +  P +  SD+W+LG+ L ++     PF
Sbjct: 357 TT-----------FTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGHFPF 399

>Scas_643.20
          Length = 1082

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 66/124 (53%), Gaps = 19/124 (15%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
            L   ++E E   I   +  GL H+H Q   ++HRDIK ENV+VD+  + KL D+GS    
Sbjct: 924  LKKNMTEYEEKLIFKQVVSGLKHLHDQ--GIVHRDIKDENVIVDSKGHVKLIDYGS---- 977

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                A++ +      +++V T   Y +PE++   +Y   P     DIWA+GI LY ++F 
Sbjct: 978  ----AAYTKSGPF--DVFVGTI-DYAAPEVLGGSVYDGKP----QDIWAIGILLYTIIFK 1026

Query: 271  TTPF 274
              PF
Sbjct: 1027 ENPF 1030

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 89/182 (48%), Gaps = 22/182 (12%)

Query: 94  LNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           ++ L++E+ ++K+L++  NIV YY       G  + G  + + +E  P GS+   ++   
Sbjct: 456 IDALQHEMSLLKELQH-ENIVTYY-------GSSQEGGNLNIFLEYVPGGSVSSMLSN-- 505

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
                E  ++     I +G++++H  R  +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 506 YGPFEEPLIVNFTRQILIGVAYLH--RKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 214 PAVASHQEI-AMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
           P    +Q+    L  ++Y      + SPE++   +      K+DIW+ G  + ++     
Sbjct: 564 PLNQENQDKRTSLQGSVY------WMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKH 614

Query: 273 PF 274
           P+
Sbjct: 615 PY 616

>Kwal_27.11919
          Length = 209

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 63/224 (28%), Positives = 106/224 (47%), Gaps = 44/224 (19%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DENGLNELRNEVE 102
           +E + EG +  +YK        +L    R+      V LK++R+   DE   +    E+ 
Sbjct: 10  LEKVGEGTYGVVYKAL------DLRHGQRV------VALKKIRLESEDEGVPSTAIREIS 57

Query: 103 VMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK-LS 158
           ++K+L++  NIV+ YD   S+A +L      Y V   ++L     L  YM      + L 
Sbjct: 58  LLKELKD-DNIVRLYDIVHSDAHKL------YLVFEFLDL----DLKRYMEAIPKEQPLG 106

Query: 159 EAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STSPCLPAVA 217
           +  + K M  +  G+++ H  R  ++HRD+K +N+L++ D N KL DFG + +  +P  A
Sbjct: 107 DNIIKKFMMQLCKGIAYCHSHR--ILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRA 164

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
              EI  L           YR+PE+  L      +   DIW++G
Sbjct: 165 YTHEIVTLW----------YRAPEV--LLGGKQYSTGVDIWSIG 196

>Scas_700.34
          Length = 864

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 103/234 (44%), Gaps = 33/234 (14%)

Query: 48  LAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVR----VSDENGLNELRNEVEV 103
           L EG F    KV      N L      +     V +K +R      D +   ++  E+  
Sbjct: 54  LGEGEFG---KVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINA 110

Query: 104 MKKLRNCSNIVQYYD--SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAE 161
           +K L +  NIV+  +   N+  +G         +++E    G    Y+ ++   +L E  
Sbjct: 111 LKHLTH-PNIVKLEEVLQNSKYIG---------IVLEYASGGEFYKYIQRK--KRLKEGP 158

Query: 162 VLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQE 221
             ++   +  G+ ++H +   L+HRD+K+EN+L+D   N  + DFG  S       SH E
Sbjct: 159 ACRLFAQLINGVHYIHSKG--LVHRDLKLENLLLDKHENLIITDFGFVS----EFYSHGE 212

Query: 222 IAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
           +           +P Y +PE++   +     +K+DIW+ G+ LY +L    P++
Sbjct: 213 LMKTSCG-----SPCYAAPELVVSTKPYEA-KKADIWSCGVILYAMLAGYLPWD 260

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 62/123 (50%), Gaps = 17/123 (13%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              + ++E E   I   I  G+ H+H Q   ++HRDIK ENV+VD+    KL DFGS +  
Sbjct: 1048 FKSNMTEFEAKLIFKQIVSGIKHLHDQ--GIVHRDIKDENVIVDSKGFVKLIDFGSAAYV 1105

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKS-DIWALGIFLYKLLFYT 271
                           +++V T   Y +PE++      P   KS DIWA+GI LY L++  
Sbjct: 1106 KSGPF----------DVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIGILLYTLIYKE 1151

Query: 272  TPF 274
             PF
Sbjct: 1152 NPF 1154

>Scas_634.5
          Length = 790

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 110/226 (48%), Gaps = 30/226 (13%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVM 104
           +  +  G F+ +Y+V+F   TN+               +K V+ +  N LN +  E++++
Sbjct: 447 VHMIGSGQFSSVYQVTFAP-TNK------------KYAVKAVKANKYNSLNRILQEIKIL 493

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA---TKLSEAE 161
            ++R     ++  +     +   K      ++ E   NG+L  ++ +++    T+L +  
Sbjct: 494 DEIRTSQLDLEGKEYVIDFISSWKYQGSFYIMSEYYDNGNLDSFLQEQIISKNTRLEDWR 553

Query: 162 VLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQE 221
           + KI+ ++++ L  +H Q   ++H D+K  N+L+  + N KL DFG        +A+H  
Sbjct: 554 IWKIIVELSLALRFIH-QTCHVVHLDLKPTNILITFEGNLKLADFG--------MAAH-- 602

Query: 222 IAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
           + +   +       +Y +PE+I    C+  + K+DI++LG+ + ++
Sbjct: 603 LPLRDQDFENEGDREYIAPEIIS--ECI-YDFKADIFSLGLMIVEI 645

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 116/257 (45%), Gaps = 38/257 (14%)

Query: 81  VCLKRVRVS-DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           + +K VR+  DE+   ++  E+EV+ K ++  +IV +Y    +   +G     V + ME 
Sbjct: 358 MAMKEVRLELDESKFTQILMELEVLHKCQS-PHIVDFY---GAFFIEG----AVYMCMEY 409

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVD-AD 198
              GSL    +Q     + E ++  I   +  GL  +      +IHRD+K  N+L   A 
Sbjct: 410 MDGGSLDKCYDQDCIGGIDEPQLAYITEAVICGLKELKDVHN-IIHRDVKPTNILCSAAQ 468

Query: 199 NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE----- 253
              KLCDFG        V+ +   +M   NI   +   Y +PE I   + L  ++     
Sbjct: 469 GTIKLCDFG--------VSGNLVASMAKTNIGCQS---YMAPERI---KSLNPDKSTYTV 514

Query: 254 KSDIWALGIFLYKLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIM 305
           +SDIW+LG+ + ++     P+        F+ L +  +     +P+  FS+   + V + 
Sbjct: 515 QSDIWSLGLSILEMALGAYPYPPETYDNIFSQLSAIVDGPPPKLPQAKFSADAQDFVSMC 574

Query: 306 LAENPYLRPNVYQVMYH 322
           L + P  RPN   ++ H
Sbjct: 575 LQKVPERRPNYAALLEH 591

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 119/289 (41%), Gaps = 54/289 (18%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G    EV+  L +G F  +Y+V          ++D        V  K+V V         
Sbjct: 408 GPQDFEVLRLLGKGTFGQVYQVK---------KKDTQRIYAMKVLSKKVIVK-------- 450

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGY----EVLLLMELCPNGSLLDYMNQRL 153
           +NE+      RN   +V     ++  +   K  +    ++ L+ +    G L  ++ +  
Sbjct: 451 KNEIAHTIGERNI--LVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKE- 507

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             + SE      + ++ + L H+H     +++RD+K EN+L+DA+ N  LCDFG +   L
Sbjct: 508 -GRFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADL 564

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
                         N +  TT +Y +PE+  L       +  D W+LG+ ++++    +P
Sbjct: 565 KD----------RTNTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEMCCGWSP 611

Query: 274 FELTGQFA---------ILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
           F     FA         I   K + PR+  S +  + V  +L  NP  R
Sbjct: 612 F-----FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>Kwal_47.16761
          Length = 744

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 117/285 (41%), Gaps = 46/285 (16%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G    EV+  L +G F  +Y+V       +  R   +      V +K+  ++   G    
Sbjct: 330 GPQDFEVLRLLGKGTFGQVYQVR----KKDTKRIYAMKVLSKKVIVKKNEIAHTIG---- 381

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKL 157
              + V    ++C  IV        +     P  ++ L+ +    G L  ++ +    + 
Sbjct: 382 ERNILVRTASKSCPFIV------GLKFSFQTPA-DLYLVTDFMSGGELFWHLQKE--GRF 432

Query: 158 SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
           +E      + ++ + L ++H     +++RD+K EN+L+DA+ N  LCDFG +   L    
Sbjct: 433 AEDRARFYIAELVLALEYLH--ENDIVYRDLKPENILLDANGNIALCDFGLSKADLKD-- 488

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 277
                     N +  TT +Y +PE+  L       +  D W+LG+ ++++    +PF   
Sbjct: 489 --------RTNTFCGTT-EYLAPEL--LLDESGYTKMVDFWSLGVLIFEMCCGWSPF--- 534

Query: 278 GQFA---------ILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
             FA         I   K + PR+  S +  + V  +L  NP  R
Sbjct: 535 --FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHR 577

>Kwal_26.7154
          Length = 1213

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 128/300 (42%), Gaps = 65/300 (21%)

Query: 43   EVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSD---ENGLNELRN 99
            EV++ + EG +    KV        + ++DR +     +  +R+ V     +  L  + +
Sbjct: 954  EVLQKMGEGAYG---KVDLC-----MHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPS 1005

Query: 100  EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPN--------------GSL 145
            E+++M  L                  + KP   +L+L++   +              GS+
Sbjct: 1006 EIQIMATL------------------NAKPHENILMLLDFFEDDDYYYIETAVHGTSGSI 1047

Query: 146  LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205
              +    + T ++E E + I   I  G+ ++H     ++HRDIK ENV+VD +   K+ D
Sbjct: 1048 DLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVD 1105

Query: 206  FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIF 263
            FGS +                 +++V T   Y +PE++  + Y   P     DIWA+G+ 
Sbjct: 1106 FGSAAYVKSGPF----------DVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVL 1150

Query: 264  LYKLLFYTTPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYH 322
            LY +++   PF    +  IL +   +  +   S   I L+  +L  +   RP++ ++  H
Sbjct: 1151 LYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEICNH 1208

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 125/300 (41%), Gaps = 50/300 (16%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRV--SDENGLNE 96
           + ++E+ E + +G FA +   S         R D    P   V +K V V      G+ +
Sbjct: 12  IKELELGETIGQGTFAFVKTASL--------RAD----PQTIVAVKFVHVERCKARGMTD 59

Query: 97  --LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLL-MELCPNGSLLDYMNQRL 153
             L  EV +  +     ++V+  D N SR        E L + MEL   G L D +   +
Sbjct: 60  EDLTREVVLQTRCAGHRHVVRVLDCNVSR--------EYLWIAMELADGGDLFDKIEPDV 111

Query: 154 ATKLSEAEVLKIMYDITV-GLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
                ++EV +  Y   V  L+H+H +   + HRDIK EN+L+D   N K+ DFG     
Sbjct: 112 GV---DSEVARFYYQQLVRALTHLH-EACGVAHRDIKPENMLLDRAGNLKVADFG----- 162

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMID--LYRCLPINEKSDIWALGIFLYKLLFY 270
           L      ++    +      T P Y +PE++    Y      + +DIW+ G+ ++ LL  
Sbjct: 163 LATRFRRRDGTRRLARDRRGTLP-YLAPEVVGERAYHA----DTADIWSAGVLVFVLLTG 217

Query: 271 TTPFEL----TGQFAILHSK----YEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
            TP+       G F    +      + P        +NL+  ML + P  R  + Q+  H
Sbjct: 218 ETPWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQH 277

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 32/201 (15%)

Query: 132 EVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
           E+ L++E    G L DY+  +   KL E+E +     I   +++ H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 192 NVLVDADN-NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTT---PQYRSPEMI--DL 245
           N+L+D    + K+ DFG               A+  ++  + T+   P Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 246 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPRNSFSSKLINL 301
           Y   P    SD+W+ GI L+ LL    PF       +L      KY++P+   S +  +L
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ-WLSVEAKDL 305

Query: 302 VIIMLAENPYLRPNVYQVMYH 322
           +  +L  +P  R  + Q++ H
Sbjct: 306 ISRILVVDPNRRITIDQILQH 326

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 103/241 (42%), Gaps = 47/241 (19%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELR 98
           +H  +++  L  G F  ++ V  V   N      ++L+    V +K+V         E  
Sbjct: 67  LHDFQIMRTLGTGSFGRVHLVRSV--HNGRYYAIKVLKKQQVVKMKQV---------EHT 115

Query: 99  NEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM--NQRL--- 153
           N+   M KL     +++ +       G  +    + ++M+    G L   +  +QR    
Sbjct: 116 NDERRMLKLVEHPFLIRMW-------GTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNP 168

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             K   AEV+       + L ++H     +I+RD+K EN+L+D + + K+ DFG      
Sbjct: 169 VAKFYAAEVI-------LALEYLHAHN--IIYRDLKPENILLDRNGHIKITDFGFAKEV- 218

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
                 Q +   +       TP Y +PE+I      P N+  D W+LG+ +Y++L   TP
Sbjct: 219 ------QTVTWTLCG-----TPDYIAPEVIT---TKPYNKSVDWWSLGVLIYEMLAGYTP 264

Query: 274 F 274
           F
Sbjct: 265 F 265

>Scas_720.94
          Length = 1683

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 108/233 (46%), Gaps = 37/233 (15%)

Query: 75   LQPGDTVCLKRVRVSDENGLNEL----RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPG 130
            L  G+ + +K +++ D   + ++    + E+ V++ L N  NIVQYY     R       
Sbjct: 1381 LDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEML-NHPNIVQYYGVEVHR------- 1432

Query: 131  YEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITV--GLSHMHYQRTPLIHRDI 188
             +V + ME C  GS    M   L     E E++  +Y + +  GL+++H  +  ++HRDI
Sbjct: 1433 DKVNIFMEYCEGGS----MASLLEHGRIEDEMVTQVYTLELLEGLAYLH--QAGVVHRDI 1486

Query: 189  KIENVLVDADNNFKLCDFGSTSPC------LPAVASHQEIAMLM---------NNIY-VH 232
            K EN+L+D +   K  DFG+          +  + S  +              N+++ + 
Sbjct: 1487 KPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDML 1546

Query: 233  TTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAILH 284
             TP Y +PE I  Y+        DIW+ G  + +++    P+  L  ++AI++
Sbjct: 1547 GTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIY 1599

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 67/228 (29%), Positives = 108/228 (47%), Gaps = 52/228 (22%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DENGLNELRNEVE 102
           +E + EG +  +YK        +L   +RI      V LK++R+   DE   +    E+ 
Sbjct: 10  LEKVGEGTYGVVYKAL------DLRHGNRI------VALKKIRLESEDEGVPSTAIREIS 57

Query: 103 VMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYMN-----QRLA 154
           ++K+LR+  NIV+ YD   S+A +L      Y V   ++L     L  YM      Q L 
Sbjct: 58  LLKELRD-DNIVRLYDIVHSDAHKL------YLVFEFLDL----DLKRYMESVPKEQPLG 106

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STSPCL 213
            K+    + K M  +  G+++ H  R  ++HRD+K +N+L++ D N KL DFG + +  +
Sbjct: 107 NKI----IKKFMMQLCKGIAYCHAHR--ILHRDLKPQNLLINRDGNLKLGDFGLARAFGV 160

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           P  A   EI  L           YR+PE+  L      +   DIW++G
Sbjct: 161 PLRAYTHEIVTLW----------YRAPEV--LLGGKQYSTGVDIWSIG 196

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 119/283 (42%), Gaps = 50/283 (17%)

Query: 4   RHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEY-----LAEGGFAHIYK 58
           RHT      T P     A TGPL   +  +       QV    Y     L EG F    K
Sbjct: 7   RHTYYGGGATPP-----AATGPLSGSRGHAAGRSKKKQVTFGPYIIGPTLGEGEFG---K 58

Query: 59  VSFVGYTNELDRQDRILQPGDTVCLKRVR--VSDENGLNELR--NEVEVMKKLRNCSNIV 114
           V        LD   R       V +K +R     +N   E++   E+  +K L +  NIV
Sbjct: 59  VKLGWSKARLDGDSR------NVAIKLIRRDTVPKNSEKEIKIYRELNALKLLSH-PNIV 111

Query: 115 QYYD--SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVG 172
           +  +   N+  +G         ++++    G    Y+ ++   +L E    ++   +  G
Sbjct: 112 RLEEVLQNSKYIG---------IVLQYASGGEFYKYIQKK--RRLKEPPACRLFAQLISG 160

Query: 173 LSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVH 232
           + ++HY+   L HRD+K+EN+L+D   N  + DFG  +        H+   M  +     
Sbjct: 161 VHYIHYKG--LAHRDLKLENLLLDEHENLIITDFGFVNEF------HKNDLMRTSC---- 208

Query: 233 TTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
            +P Y +PE++   +     +K+D+W+ G+ LY +L    P++
Sbjct: 209 GSPCYAAPELVVSSKPYSA-QKADVWSCGVILYAMLAGYLPWD 250

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 64/234 (27%), Positives = 111/234 (47%), Gaps = 52/234 (22%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DENGLNELRNEVE 102
           +E + EG +  +YK        +L  Q+R+      V +K++R+   DE   +    E+ 
Sbjct: 10  LEKVGEGTYGVVYKAV------DLRHQNRV------VAMKKIRLESEDEGVPSTAIREIS 57

Query: 103 VMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYM-----NQRLA 154
           ++K+L++  NIV+ YD   S+A +L      Y V   ++L     L  YM     +Q L 
Sbjct: 58  LLKELKD-DNIVRLYDIVHSDAHKL------YLVFEFLDL----DLKRYMESIPKDQPLG 106

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STSPCL 213
             +    + K M  +  G+++ H  R  +IHRD+K +N+L++ D N KL DFG + +  +
Sbjct: 107 GNI----IKKFMMQLCKGIAYCHAHR--IIHRDLKPQNLLINRDGNLKLGDFGLARAFGV 160

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
           P  A   EI  L           YR+PE+  L      +   D+W++G    ++
Sbjct: 161 PLRAYTHEIVTLW----------YRAPEV--LLGGKQYSTGVDVWSIGCIFAEM 202

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 82/175 (46%), Gaps = 30/175 (17%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
            L T ++E E   +   +  G+ H+H     ++HRDIK ENV+VD     KL DFGS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYV 1128

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                           +++V T   Y +PE++  + Y   P     DIWA+G+ LY +++ 
Sbjct: 1129 KSGPF----------DVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1173

Query: 271  TTPFE-----LTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
              PF      L G   I  S +E+     S++ + L+  +L  +   RP +  +M
Sbjct: 1174 ENPFYNIDEILDGDLRI-QSTHEV-----SAECVALIRKILNRSVSKRPTIDDIM 1222

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 19/124 (15%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              T ++E E   +   +  G+ H+H Q   ++HRDIK EN++VD+    K+ DFGS +  
Sbjct: 1178 FKTNMTEIEAKLLFKQVVSGVKHLHDQ--GIVHRDIKDENIIVDSQGFVKIIDFGSAAYV 1235

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDL--YRCLPINEKSDIWALGIFLYKLLFY 270
                           +++V T   Y +PE++    Y   P     DIWA+GI LY ++F 
Sbjct: 1236 KSGPF----------DVFVGTI-DYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVFK 1280

Query: 271  TTPF 274
              PF
Sbjct: 1281 ENPF 1284

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 99/197 (50%), Gaps = 29/197 (14%)

Query: 84  KRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNG 143
           K++ +SD+    ++  EV +  K     N+++  D N S+         + +++E+   G
Sbjct: 53  KKMGLSDK----DITKEVVLQSKCSKHPNVLRLIDCNVSK-------EYMWIILEMADGG 101

Query: 144 SLLDYMNQRLATKLSEAEVLKIMYD-ITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFK 202
            L D +   +     +++V +  +  +   ++++H +   + HRDIK EN+L+D + N K
Sbjct: 102 DLFDKIEPDVGV---DSDVAQFYFQQLVSAINYLHVE-CGVAHRDIKPENILLDKNGNLK 157

Query: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWA 259
           L DFG  S         ++   L  ++    +P Y +PE++   + Y      +++DIW+
Sbjct: 158 LADFGLAS------QFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYYA----DRTDIWS 207

Query: 260 LGIFLYKLLFYTTPFEL 276
           +GI L+ LL   TP+EL
Sbjct: 208 IGILLFVLLTGQTPWEL 224

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 106/263 (40%), Gaps = 63/263 (23%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELR 98
           +H+ + I+ +  G F+ +Y+ ++   T        + +P D V L+ +          +R
Sbjct: 1   MHKYQPIDVIQTGSFSTVYR-AYDSKTGSYVAMKVVSKPADPVKLEAIS-------KLVR 52

Query: 99  NEVEVMKKLRN-----CSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM---- 149
           NE  V+KKL N     C+ +  Y D             + + ++E C NG L DYM    
Sbjct: 53  NEYRVLKKLGNRHPNICAMLDFYQDHE-----------KFVFVLEYCHNGDLYDYMKRIK 101

Query: 150 ----------NQR----LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLV 195
                     N R     +    +     +M+ +   L + H     + HRD K EN+LV
Sbjct: 102 ESGGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCH--TLGIAHRDFKPENILV 159

Query: 196 DADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI---DLYRCLPIN 252
                 KL DFG +      VAS   I           T +Y +PE     D Y      
Sbjct: 160 TNTGKIKLTDFGLSY--FGEVASDHGIG----------TEKYLAPETFSHNDTYN----T 203

Query: 253 EKSDIWALGIFLYKLLFYTTPFE 275
             +D+W+LGI +  ++F + PF+
Sbjct: 204 YSADLWSLGISVLYIVFGSCPFK 226

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 132/307 (42%), Gaps = 52/307 (16%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS-D 90
           GS+  + + +++ IE L  G +  + KV        L + + +L     + +K VR+  D
Sbjct: 359 GSSSRITLDELQFIEELGHGNYGTVSKV--------LHKPNNVL-----MAMKEVRLELD 405

Query: 91  ENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLD-YM 149
           E+   ++  E+EV+ K  N   IV +Y    +   +G     V + ME    GSL   Y 
Sbjct: 406 ESKFRQILMELEVLHKC-NSPFIVDFY---GAFFIEG----AVYMCMEYMDGGSLDKIYD 457

Query: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDAD-NNFKLCDFGS 208
                  + E ++  I   +  GL  +      +IHRD+K  N+L  A     KLCDFG 
Sbjct: 458 ENPEMGGIDEPQLAFITNAVIQGLRELKEVHN-VIHRDVKPTNILCSAKQGTVKLCDFG- 515

Query: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE-----KSDIWALGIF 263
                  V+ +   ++   NI   +   Y +PE I   + L  +      +SDIW+LG+ 
Sbjct: 516 -------VSGNLVASLAKTNIGCQS---YMAPERI---KSLNPDRGTYTVQSDIWSLGLS 562

Query: 264 LYKLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIMLAENPYLRPN 315
           + ++     P+        F+ L +  +     +P + FS +  + V + L + P  RPN
Sbjct: 563 ILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPN 622

Query: 316 VYQVMYH 322
              +  H
Sbjct: 623 YSNLYEH 629

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 117/285 (41%), Gaps = 46/285 (16%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G    EV+  L +G F  +Y+V       +  R   +      V +K+  ++   G    
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQVR----KKDTKRIYAMKVLSKKVIVKKNEIAHTIG---- 351

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKL 157
              + V    ++C  IV        +     P  ++ L+ +    G L  ++ +    + 
Sbjct: 352 ERNILVRTASKSCPFIV------GLKFSFQTPT-DLYLVTDFLSGGELFWHLQKE--GRF 402

Query: 158 SEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVA 217
           +E      + ++ + L ++H     +++RD+K EN+L+DA+ N  LCDFG +   L    
Sbjct: 403 TEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD-- 458

Query: 218 SHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 277
                     N +  TT +Y +PE+  L       +  D W+LG+ ++++    +PF   
Sbjct: 459 --------RTNTFCGTT-EYLAPEL--LLDETGYTKMVDFWSLGVLIFEMCCGWSPF--- 504

Query: 278 GQFA---------ILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
             FA         I   K + PR+  S +  + V  +L  NP  R
Sbjct: 505 --FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 547

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 80/167 (47%), Gaps = 22/167 (13%)

Query: 153  LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
            L T ++E E   +   +  GL H+H     ++HRDIK ENV+VD     K+ DFGS    
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGS---- 1154

Query: 213  LPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 270
                A++ +      +++V T   Y +PE++  D Y   P     D+WA+G+ LY +++ 
Sbjct: 1155 ----AAYVKRGPF--DVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIYK 1203

Query: 271  TTPFELTGQFAILHSKYEI-PRNSFSSKLINLVIIMLAENPYLRPNV 316
              PF    +  IL     I P    S + + L+  +L  +   RP V
Sbjct: 1204 ENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>Scas_711.25
          Length = 1515

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 102/225 (45%), Gaps = 34/225 (15%)

Query: 78   GDTVCLKRVRVSDENGLNE--------LRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKP 129
            G+ + +K+V V   +  +E        LR+EV  +K L +  NIVQY       LG    
Sbjct: 1237 GEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHL-NIVQY-------LGFENK 1288

Query: 130  GYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIK 189
                 L +E    GS+   +  R+  +  E  +  +   +  GL+++H +   ++HRD+K
Sbjct: 1289 DNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSRG--ILHRDMK 1344

Query: 190  IENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCL 249
             +N+L+D D   K+ DFG  S     + S+ ++ M         T  + +PEM+D  +  
Sbjct: 1345 ADNLLLDQDGVCKISDFG-ISRKSKDIYSNSDMTM-------RGTVFWMAPEMVDTKQGY 1396

Query: 250  PINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYEIP 290
              + K DIW+LG  + ++     P+     +   F I  SK   P
Sbjct: 1397 --SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPP 1439

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 109/255 (42%), Gaps = 50/255 (19%)

Query: 28  MLQAGSTVLVG---VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLK 84
           +L   STV  G   +H  +++  L  G F  ++ V  V   N      ++L+    + +K
Sbjct: 45  LLPQRSTVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSV--HNGRYYAIKVLKKHQIIRMK 102

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144
           ++         E  N+   M KL     +++ +       G  +    + ++M+    G 
Sbjct: 103 QI---------EHTNDERRMLKLVEHPFLIRMW-------GTFQDSRNLFMVMDYIEGGE 146

Query: 145 LLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADN 199
           L   +  +QR      K   AEV       T+ L ++H     +I+RD+K EN+L+D + 
Sbjct: 147 LFSLLRKSQRFPNPVAKFYAAEV-------TLALEYLHSHN--IIYRDLKPENILLDRNG 197

Query: 200 NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
           + K+ DFG     +    +            +  TP Y +PE+I      P N+  D W+
Sbjct: 198 HIKITDFGFAKEVITVTWT------------LCGTPDYIAPEVI---TTKPYNKSVDWWS 242

Query: 260 LGIFLYKLLFYTTPF 274
           LGI ++++L   TPF
Sbjct: 243 LGILIFEMLAGYTPF 257

>Kwal_33.14081
          Length = 580

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 112/255 (43%), Gaps = 34/255 (13%)

Query: 81  VCLKRVRVS-DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           + +K VR+  DE+   ++  E+EV+ K ++   IV +Y    +   +G     V + ME 
Sbjct: 300 MAMKEVRLELDESKFTQILMELEVLHKCQS-PYIVDFY---GAFFIEG----AVYMCMEY 351

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA-D 198
              GSL    +  +   + E E+  I   I  GL  +      +IHRD+K  NVL  A  
Sbjct: 352 MDGGSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVHN-IIHRDVKPTNVLCSAAQ 410

Query: 199 NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR--CLPINEKSD 256
              KLCDFG +   + ++A          NI   +   Y +PE I  +         +SD
Sbjct: 411 GTVKLCDFGVSGNLVASLAK--------TNIGCQS---YMAPERIKSFNPDKATYTVQSD 459

Query: 257 IWALGIFLYKLLFYTTPFELTGQFAILHSKY---------EIPRNSFSSKLINLVIIMLA 307
           IW+LG+ + ++   T P+ +   F  + S+          ++P+  FS    + V + L 
Sbjct: 460 IWSLGLSILEMAIGTYPYPVE-TFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQ 518

Query: 308 ENPYLRPNVYQVMYH 322
           + P  R N   ++ H
Sbjct: 519 KIPERRRNYAALLEH 533

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 112/254 (44%), Gaps = 32/254 (12%)

Query: 81  VCLKRVRVS-DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMEL 139
           + +K VR+  DE+   ++  E+EV+ K ++   IV +Y    +   +G     V + ME 
Sbjct: 403 MAMKEVRLELDESKFRQILMELEVLHKCQS-PYIVDFY---GAFFIEG----AVYMCMEF 454

Query: 140 CPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA-D 198
              GSL    +      + E ++  I   +  GL  +      +IHRD+K  N+L  A  
Sbjct: 455 MDGGSLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHN-IIHRDVKPTNILCSATQ 513

Query: 199 NNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR--CLPINEKSD 256
              KLCDFG        V+ +   ++   NI   +   Y +PE I          + +SD
Sbjct: 514 GTVKLCDFG--------VSGNLVASLARTNIGCQS---YMAPERIKSLNPDKATYSVQSD 562

Query: 257 IWALGIFLYKLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIMLAE 308
           IW+LG+ + ++     P+        F+ L +  +     +P+++FSS   + V + L +
Sbjct: 563 IWSLGLSIVEMALGAYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQK 622

Query: 309 NPYLRPNVYQVMYH 322
            P  RP    ++ H
Sbjct: 623 IPERRPTYASLLEH 636

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 121/316 (38%), Gaps = 50/316 (15%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGL 94
           ++VG    E I  L +G    ++ V          R+ +  +      L +  +   N +
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLV----------REKKTNRVYALKVLSKDEMIKRNKI 538

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
             +  E E++    N   IV  Y S  S        Y + L ME C  G     +  R  
Sbjct: 539 KRVLTEQEILA-TSNHPFIVTLYHSFQSE------DY-LYLCMEYCMGGEFFRALQTRKT 590

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG----STS 210
             + E +      ++T  L ++H      I+RD+K EN+L+    +  L DF     +  
Sbjct: 591 KCICEDDARFYASEVTAALEYLHL--LGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKD 648

Query: 211 PCLPAVASHQEIAM---------LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
             +P V    +  +            N +V  T +Y +PE+I   R        D W LG
Sbjct: 649 SKVPVVKGSAQSTLVDTKICSDGFRTNSFV-GTEEYIAPEVI---RGNGHTAAVDWWTLG 704

Query: 262 IFLYKLLFYTTPFE---LTGQFA-ILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNV 316
           I +Y++LF  TPF+       F  IL ++   P N+  S    +L+  +L +N   R   
Sbjct: 705 ILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESKRLG- 763

Query: 317 YQVMYHICSMMECEVK 332
                  C M   +VK
Sbjct: 764 -------CKMGAADVK 772

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 79/165 (47%), Gaps = 23/165 (13%)

Query: 113 IVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL-LDYMNQ-RLATKLSEAEVLKIMYDIT 170
           IVQYY      +   +    + + ME     SL   Y N  +   ++SE  + KI   + 
Sbjct: 273 IVQYYG-----MFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVL 327

Query: 171 VGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIY 230
            GLS++H ++  +IHRDIK +N+L++     KLCDFG +   + ++A           + 
Sbjct: 328 RGLSYLHERK--VIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLA-----------MT 374

Query: 231 VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 275
              T  Y +PE I   +  P +   D+W+LG+ L ++     PFE
Sbjct: 375 FTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 121/289 (41%), Gaps = 54/289 (18%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G    EV+  L +G F  +Y+V          ++D +      V  K+V V         
Sbjct: 321 GPQDFEVLRLLGKGTFGQVYQVR---------KKDTMRIYAMKVLSKKVIVK-------- 363

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYE----VLLLMELCPNGSLLDYMNQRL 153
           +NE+      RN   +V+    ++  +   K  ++    + L+ +    G L  ++ +  
Sbjct: 364 KNEIAHTIGERNI--LVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKE- 420

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             + +E      + ++ + L ++H     +++RD+K EN+L+DA+ N  LCDFG +   L
Sbjct: 421 -GRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADL 477

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
                         N +  TT +Y +PE+  L       +  D W+LG+ ++++    +P
Sbjct: 478 KD----------RTNTFCGTT-EYLAPEL--LMDETGYTKMVDFWSLGVLIFEMCCGWSP 524

Query: 274 FELTGQFA---------ILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
           F     FA         I   K + PR+  S +  + V  +L  NP  R
Sbjct: 525 F-----FASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 568

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 52/234 (22%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS--DENGLNELRNEVE 102
           +E + EG +  +YK        +L    RI      V LK++R+   DE   +    E+ 
Sbjct: 10  LEKVGEGTYGVVYKAV------DLRHGQRI------VALKKIRLESEDEGVPSTAIREIS 57

Query: 103 VMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYM-----NQRLA 154
           ++K+L++  NIV+ YD   S+A +L      Y V   +EL     L  YM     +Q L 
Sbjct: 58  LLKELKD-DNIVRLYDIVHSDAHKL------YLVFEFLEL----DLKRYMESVPKDQPLG 106

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STSPCL 213
            K+    + K M  +  G+++ H  R  +IHRD+K +N+L++ + N KL DFG + +  +
Sbjct: 107 DKI----IKKFMMQLCKGIAYCHAHR--IIHRDLKPQNLLINRNGNLKLGDFGLARAFGV 160

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
           P  A   EI  L           YR+PE+  L      +   D+W++G    ++
Sbjct: 161 PLRAYTHEIVTLW----------YRAPEV--LLGGKQYSTGVDVWSIGCIFAEM 202

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 29/156 (18%)

Query: 124 LGDGKPGYEVLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHY 178
            G  +  ++V ++M+    G L   +  +QR      K   AEV        + L ++H 
Sbjct: 140 WGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLHS 192

Query: 179 QRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYR 238
           +   +I+RD+K EN+L+D + + KL DFG  +  +P V              +  TP Y 
Sbjct: 193 K--DIIYRDLKPENILLDKNGHIKLTDFG-FAKYVPDVTYT-----------LCGTPDYI 238

Query: 239 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
           +PE++      P N+  D W+ GI +Y++L   TPF
Sbjct: 239 APEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPF 271

>Kwal_23.5668
          Length = 1689

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 93/202 (46%), Gaps = 23/202 (11%)

Query: 133  VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
            + + ME C N +L D ++        E E  ++  +I   LS++H Q   +IHRD+K  N
Sbjct: 812  LFIQMEYCENRTLFDLIHTENLCAQKE-EYWRLFREILDALSYIHSQ--GIIHRDLKPMN 868

Query: 193  VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHT--TPQYRSPEMIDLYRCLP 250
            + +D   N K+ DFG       A   H+ + +L  + ++ T  T    S     LY    
Sbjct: 869  IFIDESRNIKIGDFG------LAKNVHKSVDLLRMDSHISTASTEDLTSAIGTALYVATE 922

Query: 251  I-------NEKSDIWALGIFLYKLLF-YTTPFELTGQF-AILHSKYEIPRNSFSSKLI-- 299
            +       NEK D+++LGI  +++++ + T  E       I  S  + P +  SSKL   
Sbjct: 923  VLTGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAVE 982

Query: 300  -NLVIIMLAENPYLRPNVYQVM 320
              ++  +L  +P  RPN   ++
Sbjct: 983  KKIITQLLDHDPNRRPNAKTLL 1004

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 87/213 (40%), Gaps = 25/213 (11%)

Query: 69  DRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCS--NIVQYYDSNASRLGD 126
           D  D        V L     +  NG  ++ N  + ++ L   S  N+   Y  +  R G 
Sbjct: 274 DMMDNFFYLLSVVTLDNPYFNTSNGKRDISNLEKELESLLRVSHENVNVLYAFSVERTGR 333

Query: 127 GKPGY--EVLLLMELCPNGSLLDYMNQRLATKLSEAE--VLKIMYDITVGLSHMHYQRTP 182
               Y  ++ LL E  P   + D ++      L+ A   +L+++     GL  +H  +  
Sbjct: 334 NNTNYAWKISLLSEYSPLSLVGDIVDSVGFVNLATARGWILRLIE----GLESLH--KHG 387

Query: 183 LIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQ------ 236
           ++H++I +++V +  D      DFG T P L        I  L+ N    + P+      
Sbjct: 388 IVHKNITLQSVTLSKD-----ADFGVTVPKLLHSGYGFTILNLLLNHPNKSGPKVDPLDQ 442

Query: 237 -YRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268
            + +PE+       P   K+DIW LG+   +++
Sbjct: 443 PWPAPELAKFNNSKP-QRKTDIWQLGVLFMQIV 474

>Kwal_27.12559
          Length = 414

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 60/123 (48%), Gaps = 9/123 (7%)

Query: 145 LLDYMNQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNF 201
           L+DY   R+     + SE  +   +Y I  GL ++H     +IHRD+K  N+L     N 
Sbjct: 152 LVDYDLARVIHSTVQFSEFHIKHFLYQILCGLKYIH--SADVIHRDLKPGNILCSIGGNL 209

Query: 202 KLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           K+CDFG      P     +   + + + YV  T  YR+PE+I  +R     +  DIWA+G
Sbjct: 210 KICDFGLARGIAPQYFEQKSDEIHITS-YV-ATRWYRAPELILSHR--RYTKAIDIWAVG 265

Query: 262 IFL 264
             L
Sbjct: 266 CIL 268

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 83/189 (43%), Gaps = 37/189 (19%)

Query: 100 EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSE 159
           EV++  K+    NI    D            ++  ++ME C  G L + +      K ++
Sbjct: 134 EVDIQTKIGRHQNIAALLDF-----------FDSYIIMEYCSGGDLYEAIKADAVPKKTK 182

Query: 160 AEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA-DNNFKLCDFGSTSPCLPAVAS 218
           + +  I+  I   + ++H     + HRDIK EN+L+   D   KL D+G        +A+
Sbjct: 183 S-ITHIITQIMDAIEYVH--NKGIYHRDIKPENILISGIDWTIKLTDWG--------LAT 231

Query: 219 HQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINE--------KSDIWALGIFLYKLLFY 270
             + +M  N      + +Y SPE+ D    L I E        K D+WA+GI    ++F+
Sbjct: 232 TDKTSMDRN----VGSERYMSPELFD--SNLDIKERKEPYDCAKVDLWAMGIVFLNIVFH 285

Query: 271 TTPFELTGQ 279
             PF +  Q
Sbjct: 286 KNPFSIANQ 294

>Kwal_23.3590
          Length = 499

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 114/279 (40%), Gaps = 58/279 (20%)

Query: 78  GDTVCLKRVRV---SDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVL 134
           GD V +K        D+    + R E +++  +++  NIV+  D     +   K   +  
Sbjct: 209 GDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQH-KNIVKLIDRFVEPVS--KAQIQTF 265

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           L++E   +G L D + ++  T+L E E   I   I  GL ++H +   +IHRDIK EN+L
Sbjct: 266 LVLEKVSDGELFDRIVRK--TRLREDETNAIFKQILNGLRYLHAKN--IIHRDIKPENIL 321

Query: 195 V-------------------DADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTP 235
           +                   + D   K+ DFG            + I  +     +  TP
Sbjct: 322 LSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLA----------KFIGEMQFTNTLCGTP 371

Query: 236 QYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE------------LTGQFAIL 283
            Y +PE++          + D+W+ G+ LY  L    PF             L G+FA  
Sbjct: 372 SYVAPEVLTK---TGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILNGKFA-F 427

Query: 284 HSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
           +S Y    +      ++L+  +L  NP  R +V + + H
Sbjct: 428 YSPYW---DDIDDSCLHLISNLLVVNPAYRFDVQKTINH 463

>YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinase
           kinase (MEK) activated by high osmolarity through the
           Sln1p-Ypd1p-Ssk1p two-component osmosensor and the Sho1p
           osmosensor [2007 bp, 668 aa]
          Length = 668

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 128/305 (41%), Gaps = 48/305 (15%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTV-CLKRVRVS- 89
           GS+  + + ++E ++ L  G + ++ KV              + +P + +   K VR+  
Sbjct: 350 GSSSRITLDELEFLDELGHGNYGNVSKV--------------LHKPTNVIMATKEVRLEL 395

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLD-Y 148
           DE    ++  E+EV+ K  N   IV +Y    +   +G     V + ME    GSL   Y
Sbjct: 396 DEAKFRQILMELEVLHKC-NSPYIVDFY---GAFFIEG----AVYMCMEYMDGGSLDKIY 447

Query: 149 MNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDAD-NNFKLCDFG 207
                   + E ++  I   +  GL  +  Q   +IHRD+K  N+L  A+    KLCDFG
Sbjct: 448 DESSEIGGIDEPQLAFIANAVIHGLKELKEQHN-IIHRDVKPTNILCSANQGTVKLCDFG 506

Query: 208 STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR--CLPINEKSDIWALGIFLY 265
            +   + ++A          NI   +   Y +PE I            +SDIW+LG+ + 
Sbjct: 507 VSGNLVASLAK--------TNIGCQS---YMAPERIKSLNPDRATYTVQSDIWSLGLSIL 555

Query: 266 KLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIMLAENPYLRPNVY 317
           ++     P+        F+ L +  +     +P + FSS   + V + L + P  RP   
Sbjct: 556 EMALGRYPYPPETYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYA 615

Query: 318 QVMYH 322
            +  H
Sbjct: 616 ALTEH 620

>Scas_584.11
          Length = 1074

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 47/194 (24%)

Query: 100 EVEVMKKL---RNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK 156
           EV+++ K+   +N  ++V Y+DS               ++ME C  G L + +   L  K
Sbjct: 108 EVDILTKVGKHKNIVSLVDYFDS--------------YIIMEYCSGGDLYEAIKDDLVPK 153

Query: 157 LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA-DNNFKLCDFGSTSPCLPA 215
            ++  +  I   I   +  +H +   + HRDIK EN+L+   D   KL D+G        
Sbjct: 154 KTKT-ITHIFSQIMDAIEFVHGKS--IYHRDIKPENILITGIDWTIKLTDWG-------- 202

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMID----------LYRCLPINEKSDIWALGIFLY 265
           +A+  E +   +      + +Y +PE+ +           Y+C    +K D+WA+GI   
Sbjct: 203 LATTHETSFDRS----VGSERYMAPELFESNLDIEERKEAYKC----DKVDLWAMGIVFL 254

Query: 266 KLLFYTTPFELTGQ 279
            ++F   PF +  Q
Sbjct: 255 NIVFQKNPFSVANQ 268

>Scas_703.5
          Length = 749

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 120/290 (41%), Gaps = 56/290 (19%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G +  EV+  L +G F  +Y+V          ++D        V  K+V V         
Sbjct: 340 GPNDFEVLRLLGKGTFGQVYQVK---------KKDTKRIYAMKVLSKKVIVK-------- 382

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDG-----KPGYEVLLLMELCPNGSLLDYMNQR 152
           +NEV      RN   I+    + AS    G     +   ++ L+ +    G L  ++ + 
Sbjct: 383 KNEVAHTIGERN---ILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKE 439

Query: 153 LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              + +E      + ++ + L ++H     +++RD+K EN+L+DA+ N  LCDFG +   
Sbjct: 440 --GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKAD 495

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
           L              N +  TT +Y +PE+  L       +  D W+LG+ ++++    +
Sbjct: 496 LKD----------RTNTFCGTT-EYLAPEL--LLDEAGYTKMVDFWSLGVLIFEMCCGWS 542

Query: 273 PFELTGQFA---------ILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
           PF     FA         I   K + PR+  S +  + V  +L  NP  R
Sbjct: 543 PF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 587

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 130 GYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIK 189
           G   L++ME CP     D+ N  ++ ++++ EV      I  G+ ++H Q   L HRD+K
Sbjct: 335 GELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLHSQG--LAHRDLK 388

Query: 190 IENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCL 249
           ++N +V AD   KL DFGS         S  E A  +    V + P Y +PE++      
Sbjct: 389 LDNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGI----VGSDP-YLAPELLTQLYYD 443

Query: 250 PINEKSDIWALGIFLYKLLFYTTPFE 275
           P    +D+W++ +  Y +     P++
Sbjct: 444 P--SAADVWSIAVMFYCMSLRRFPWK 467

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 110/243 (45%), Gaps = 48/243 (19%)

Query: 41  QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNE 100
           Q++ +  L EG    + K        +L    +I        LK +   + +G     +E
Sbjct: 178 QIDTLGILGEGTGGSVTKC-------KLRNGSKIF------ALKTIATIENDG-----SE 219

Query: 101 VEVMKKL---RNCSN--IVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
            ++ ++L   ++C +  IV+YY   A      +    + + ME    G  LD + + L +
Sbjct: 220 KQIFRELQFNKSCKSDFIVRYYGMFAC-----EETSTIFIAMEYM-GGRSLDSVYKHLLS 273

Query: 156 K---LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
           K   + E  + KI   +  GL ++H ++  +IHRDIK +N+L +     KLCDFG +   
Sbjct: 274 KGGRIGEKVLGKIAESVLRGLFYLHERK--IIHRDIKPQNILFNEIGQIKLCDFGVSGEA 331

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
           + ++A+               T  Y +PE I   +  P +  SD+W+LG+ L ++    +
Sbjct: 332 VNSLAT-----------TFTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGHS 377

Query: 273 PFE 275
           PF+
Sbjct: 378 PFD 380

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 114/226 (50%), Gaps = 29/226 (12%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVM 104
           +  + +G F+ +Y+V+F   TN+     + ++P     LKR+ + +   LNE+ N++ + 
Sbjct: 447 VHSIGKGQFSTVYQVTF-AQTNK-KYAIKAIKPNKYNSLKRILL-EIKILNEVTNQITMD 503

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK---LSEAE 161
           ++ +    I+ Y  S        K      ++ ELC NG+L  ++ +++  K   L +  
Sbjct: 504 QEGKEY--IIDYISS-------WKFQNSYYIMTELCENGNLDGFLQEQVIAKKKRLEDWR 554

Query: 162 VLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQE 221
           + KI+ ++++ L  +H     ++H D+K  NV++  + N KL DFG        +A+H  
Sbjct: 555 IWKIIVELSLALRFIH-DSCHIVHLDLKPANVMITFEGNLKLGDFG--------MATH-- 603

Query: 222 IAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
           + +   +       +Y +PE+I    C   + K+DI++LG+ + ++
Sbjct: 604 LPLEDKSFENEGDREYIAPEIIS--DC-TYDYKADIFSLGLMIVEI 646

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 103/213 (48%), Gaps = 54/213 (25%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD---TVCLKRVRVS--DENGLNELRN 99
           +E + EG +  +YK         LD     L+PG     V LK++R+   DE   +    
Sbjct: 11  LEKVGEGTYGVVYKA--------LD-----LRPGKGQRVVALKKIRLESEDEGVPSTAIR 57

Query: 100 EVEVMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYM-----NQ 151
           E+ ++K+L++  NIV+ YD   S+A +L      Y VL  ++L     L  YM     +Q
Sbjct: 58  EISLLKELKD-DNIVRLYDIVHSDAHKL------YLVLEFLDL----DLKRYMESIPKDQ 106

Query: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STS 210
            L   +    + K M  +  G+++ H  R  ++HRD+K +N+L+D + N KL DFG + +
Sbjct: 107 PLGVNI----IKKFMVQLCKGIAYCHAHR--ILHRDLKPQNLLIDKEGNLKLGDFGLARA 160

Query: 211 PCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI 243
             +P  A   EI  L           YR+PE++
Sbjct: 161 FGVPLRAYTHEIVTLW----------YRAPEVL 183

>YPR161C (SGV1) [5576] chr16 complement(864443..866416)
           Serine/threonine protein kinase involved in pheromone
           adaptation pathway, cell cycle regulation, and
           regulation of transcription [1974 bp, 657 aa]
          Length = 657

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 102/239 (42%), Gaps = 41/239 (17%)

Query: 46  EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL--RNEVEV 103
           E L +G F  +YK    G   E  RQ         V +K++ VS E  L  +  + E+ +
Sbjct: 64  EKLGQGTFGEVYK----GIHLETQRQ---------VAMKKIIVSVEKDLFPITAQREITI 110

Query: 104 MKKLRNCSNIVQY----YD-----SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
           +K+L N  NI++     YD     +NA+     K  Y +L  M    +G L    N R+ 
Sbjct: 111 LKRL-NHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVL---HNPRI- 165

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTS---P 211
             L   ++  +M  I  GL+++H  +   +HRDIK  N+L+D +   KL DFG       
Sbjct: 166 -NLEMCDIKNMMLQILEGLNYIHCAK--FMHRDIKTANILIDHNGVLKLADFGLARLYYG 222

Query: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLL 268
           C P +              V  T  YR+PE++  D      +    DIW +G    +  
Sbjct: 223 CPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAV----DIWGVGCVFAEFF 277

>Kwal_26.8703
          Length = 444

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 88/181 (48%), Gaps = 30/181 (16%)

Query: 102 EVMKKL---RNCSN--IVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL--- 153
           +V+++L   R+CS+  IV+YY   A           + + ME    G  LD + + L   
Sbjct: 200 QVLRELQFNRSCSSEYIVRYYGMFAEESTS-----SIYIAMEYM-GGKSLDAIYKHLLER 253

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             ++ E  + KI   +  GLS++  ++  +IHRDIK +N+L++     KLCDFG +   +
Sbjct: 254 GGRIGEKVLGKIAESVLKGLSYLQERK--IIHRDIKPQNILLNEAGQVKLCDFGVSGVAV 311

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
            ++A+               T  Y +PE I   +  P +  SD+W+LG+ L ++     P
Sbjct: 312 NSLATT-----------FTGTSFYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGQFP 357

Query: 274 F 274
           F
Sbjct: 358 F 358

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 117/285 (41%), Gaps = 46/285 (16%)

Query: 38  GVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNEL 97
           G    EV+  L +G F  +Y+V          ++D        V  K+V V         
Sbjct: 336 GPQDFEVLRLLGKGTFGQVYQVK---------KKDTKRIYAMKVLSKKVIVK-------- 378

Query: 98  RNEVEVMKKLRNCSNIVQYYDSNASRLGDG-----KPGYEVLLLMELCPNGSLLDYMNQR 152
           +NE+      RN   I+    S AS    G     +   ++ L+ +    G L  ++ + 
Sbjct: 379 KNEIAHTIGERN---ILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQRE 435

Query: 153 LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
              + +E      + ++ + L H+H     +++RD+K EN+L+DA+ N  LCDFG +   
Sbjct: 436 --GRFTEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKAD 491

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
           L              N +  TT +Y +PE+  L       +  D W+LG+ ++++    +
Sbjct: 492 LKD----------RTNTFCGTT-EYLAPEL--LLDESGYTKMVDFWSLGVLIFEMCCGWS 538

Query: 273 PFELTGQ----FAILHSKYEIPRNSFSSKLINLVIIMLAENPYLR 313
           PF           I   K + PR+  S +  + V  +L  NP  R
Sbjct: 539 PFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRNPKHR 583

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 100/254 (39%), Gaps = 37/254 (14%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGL 94
            +VG    E I  L +G    +Y V       + DR   +   G    +KR ++      
Sbjct: 454 AVVGPQSFEKIRLLGQGDVGKVYLVR----EKKSDRLYALKIFGKAEMIKRKKI------ 503

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
             +  E E++    N   IV  Y S  +        Y + L ME C  G     +  R  
Sbjct: 504 KRILAEQEILA-TSNHPFIVTLYHSFQTE------DY-LYLCMEYCMGGEFFRALQTRKT 555

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF-------G 207
             +SE +      ++T  L ++H      I+RD+K EN+L+    +  L DF       G
Sbjct: 556 KCISEDDARFYASEVTAALEYLHLM--GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKG 613

Query: 208 STSPCLPAVASHQEIAM------LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
           + +P +   A    +           N +V T  +Y +PE+I   R        D W LG
Sbjct: 614 TRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTE-EYIAPEVI---RGNGHTASVDWWTLG 669

Query: 262 IFLYKLLFYTTPFE 275
           I  Y++LF  TPF+
Sbjct: 670 ILTYEMLFGFTPFK 683

>Scas_649.30
          Length = 648

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 109/255 (42%), Gaps = 42/255 (16%)

Query: 93  GLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
            + + R E+ V  +L+NC  +V+  +       D      + ++ E C  G L    N +
Sbjct: 149 NVEKCRWEIFVWNQLQNCDYVVKLVEC-----LDSPSSKNIWIINEYCSLGELRWRRNSK 203

Query: 153 LATKLSEAEVL-----------KIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDA-DNN 200
               LS+ E +            +  D+   L  +  +    IHRDIK  N+L +A D +
Sbjct: 204 DEV-LSQWEKMIPGCDVQDFTEWVFVDMIKALRFL--EANGCIHRDIKPANILCNARDGH 260

Query: 201 FKLCDFGSTSPCLPAVASHQE------IAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN-- 252
           F++ DFG  S  LP     ++        M +N I    TP + +PE+         N  
Sbjct: 261 FQISDFG-CSILLPRYVPFKDPKLEHCFQMELNKII--GTPAFIAPELCHFNESKRNNIR 317

Query: 253 --EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLI-----NLVI-I 304
              K DIW+LGI LY LL    PF    +F   H   ++   S  S L      NLVI  
Sbjct: 318 DGFKLDIWSLGITLYCLLHNKLPFSGENEFDTYH---KVVSESLDSDLDDVPLNNLVIEK 374

Query: 305 MLAENPYLRPNVYQV 319
           +L +NP  R +++++
Sbjct: 375 LLKKNPRERVSIHEL 389

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 45/228 (19%)

Query: 48  LAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENG---LNELRNEVEVM 104
           + EG +  +YK   V               G  + LKR+R+  E     +  +R E++++
Sbjct: 135 VGEGTYGKVYKAENV-------------HTGKLIALKRLRLEQERDGFPITSIR-EIKLL 180

Query: 105 KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLK 164
           ++L N  NI   ++   S       G++    ME   +G L+D      + + S++ +  
Sbjct: 181 QQL-NHPNISLIHEIIVSDKNTISMGFQY---MENDLSGMLMDK-----SIQFSDSNIKH 231

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG----STSPCLPAVASHQ 220
           +M  + VGL ++H Q+  ++HRDIK  N+L+D   N K+ DFG     T    PA  +++
Sbjct: 232 LMKQLFVGLQYLHQQQ--IVHRDIKGSNLLIDNRGNLKITDFGLAKKLTDVSSPASNTNR 289

Query: 221 EIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268
            I +            YR PE+  L        + D W  G  L +L 
Sbjct: 290 VITLW-----------YRPPEL--LLGATDYKYEVDCWGCGCLLVELF 324

>Kwal_27.10004
          Length = 735

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
            +ME C  G L   +++    K    E  +    +  G+  +H Q   ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQG--VVHRDIKPENVL 418

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY-------- 246
           +  +   K+ DFG  S             + + + YV  +P Y +PE++           
Sbjct: 419 ISKEGIAKMTDFG-ISDWGNEDPDDLTSPVRLFDTYV-GSPPYSAPEVVAFKDEDSTYQD 476

Query: 247 RCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSF 294
           R      K D WALG+ L+ L++  TPF    +    +  Y +  N+F
Sbjct: 477 RKPYDAYKMDCWALGVLLFTLVYQCTPFLDASKSDSKYRSYVLSYNNF 524

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 103/254 (40%), Gaps = 37/254 (14%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGL 94
           + VG    E I  L +G    +Y V     TN L    +I    + +  K+++       
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRL-YALKIFSKSEMIKRKKIK------- 540

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
             +  E E++    N   +V  Y S  S        Y + L ME C  G     +  R +
Sbjct: 541 -RILAEQEILA-TSNHPFVVTLYHSFQSE------DY-LYLCMEYCMGGEFFRALQTRKS 591

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG----STS 210
             +SE +      ++T  L ++H      I+RD+K EN+L+    +  L DF     +  
Sbjct: 592 KCISEEDAKFYASEVTAALEYLHL--LGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKD 649

Query: 211 PCLPAVASHQEIAM---------LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
             +P V  + +  +            N +V T  +Y +PE+I   R        D W LG
Sbjct: 650 AKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWWTLG 705

Query: 262 IFLYKLLFYTTPFE 275
           I +Y++LF  TPF+
Sbjct: 706 ILIYEMLFGFTPFK 719

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 80  TVCLKRVRVSDENGLNELRN--EVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLM 137
           TV +K+V       L   R+  E+++++  R   NI   YD +   L DG   +  L L 
Sbjct: 50  TVAIKKVTNVFSKALLCKRSLRELKLLRHFRGHKNITCLYDMDIVLLPDG--SFNGLDLY 107

Query: 138 ELCPNGSLLDY-MNQRLATK--LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
           E      L+++ M+Q + +   L++A     +Y I  GL ++H     ++HRD+K  N+L
Sbjct: 108 E-----ELMEWDMHQIIKSGQPLTDAHYQSFVYQILCGLKYIH--SADVLHRDLKPGNLL 160

Query: 195 VDADNNFKLCDFG-----STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCL 249
           V+AD   K+CDFG     S +P    + + Q +       YV  T  YR+PE++  Y+  
Sbjct: 161 VNADCQLKICDFGLARGYSENP----IENDQFLTE-----YV-ATRWYRAPEIMLSYQ-- 208

Query: 250 PINEKSDIWALGIFLYKLL 268
                 D+W+ G  L +LL
Sbjct: 209 GYTRAIDVWSCGCVLAELL 227

>Scas_713.7
          Length = 983

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 130/286 (45%), Gaps = 44/286 (15%)

Query: 41  QVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNE 100
           Q ++ + + +G +  +YK              + LQ    V +K V   +++ L E+  E
Sbjct: 25  QYQLKQVIGKGSYGVVYKAV----------NKKTLQ---IVAIKEVNYDNDDELIEIMTE 71

Query: 101 VEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEA 160
           ++++K L N  NIV+Y+       G  +    + +++E C  GSL + +       + E 
Sbjct: 72  IDLLKNL-NHVNIVKYH-------GFIQKSSNLYIILEFCSKGSLKNLLTGY-KDGIPEL 122

Query: 161 EVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQ 220
           +    +     GL ++H Q   +IHRDIK  N+L+D+++  KL DFG ++          
Sbjct: 123 DAKVYIRQTLNGLVYLHEQ--GVIHRDIKAANLLLDSNDVVKLADFGVSTKV-------S 173

Query: 221 EIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----EL 276
             AM +       +  + SPE+I       +   SDIW+LG  + +L+    PF    ++
Sbjct: 174 NTAMTL-----AGSLHWMSPEIIGNRGASTL---SDIWSLGATVVELVTGNPPFYKLVDV 225

Query: 277 TGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322
              +AI +  + IP    S++  + +     +N Y RP   +++ H
Sbjct: 226 NIYYAIENDPF-IPPEFLSNEAKDFLKKCFQKNMYKRPTAKKLLKH 270

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 92/191 (48%), Gaps = 36/191 (18%)

Query: 95  NELRNEVEVMKK---LRNCS--NIVQYYD--SNASRLGDGKPGYEVLLLMELCPNGSLLD 147
           N+ R EV++ ++   L++ S  NIV+  +   N+  +G         +++E    G    
Sbjct: 89  NDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIG---------IVLEYACGGEFYK 139

Query: 148 YMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG 207
           Y+ ++   +L E    ++   +  G+ ++H +   L+HRD+K+EN+L+D + N  + DFG
Sbjct: 140 YIQKK--RRLKEMNACRLFSQLISGVHYIHSK--GLVHRDLKLENLLLDKNENLVITDFG 195

Query: 208 STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWALGIFL 264
                +    S  E+           +P Y +PE++   + Y       K+DIW+ G+ L
Sbjct: 196 ----FVNEFCSRNELMKTSCG-----SPCYAAPELVISAEPYEA----RKADIWSCGVIL 242

Query: 265 YKLLFYTTPFE 275
           Y +L    P++
Sbjct: 243 YAILAGYLPWD 253

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 102/209 (48%), Gaps = 46/209 (22%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD---TVCLKRVRVS--DENGLNELRN 99
           +E + EG +  +YK         LD     L+PG     V LK++R+   DE   +    
Sbjct: 11  LEKVGEGTYGVVYKA--------LD-----LRPGQGQRVVALKKIRLESEDEGVPSTAIR 57

Query: 100 EVEVMKKLRNCSNIVQYYD---SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK 156
           E+ ++K+L++  NIV+ YD   S+A +L      Y V   ++L     L  YM      +
Sbjct: 58  EISLLKELKD-DNIVRLYDIVHSDAHKL------YLVFEFLDL----DLKRYMEGIPKDQ 106

Query: 157 LSEAEVLK-IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG-STSPCLP 214
              A+++K  M  +  G+++ H  R  ++HRD+K +N+L++ D N KL DFG + +  +P
Sbjct: 107 PLGADIVKKFMMQLCKGIAYCHSHR--ILHRDLKPQNLLINKDGNLKLGDFGLARAFGVP 164

Query: 215 AVASHQEIAMLMNNIYVHTTPQYRSPEMI 243
             A   EI  L           YR+PE++
Sbjct: 165 LRAYTHEIVTLW----------YRAPEVL 183

>Kwal_55.20189
          Length = 812

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 103/227 (45%), Gaps = 35/227 (15%)

Query: 62  VGYTNE-LDRQDRILQPGDTVCLKRVRVS-DENGLNELRNEVEVMKKLRNCSNIVQYYDS 119
           +G  N  + +++ +L+   ++  ++VR    +N   E   EV++  K+    NI + YD 
Sbjct: 67  IGSNNSSVQKKNELLKHQKSLISEKVRSRLSKNICFEALYEVDIHTKVGKHKNITELYDF 126

Query: 120 NASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQ 179
                      ++  ++ME C  G L + +   L  K ++  +  I   I   +  +H  
Sbjct: 127 -----------FDSFIVMEYCSGGDLYEAIKADLIPKRTKV-ITHIASQIMEAIEFVH-- 172

Query: 180 RTPLIHRDIKIENVLVD-ADNNFKLCDFG--STSPCL--PAVASHQEIA--MLMNNIYVH 232
           +  + HRD+K EN+L++ +D   KL D+G  +T P     +V S + +A  +   N+   
Sbjct: 173 QKGIYHRDLKPENILIEGSDWTIKLTDWGLATTEPTSLDRSVGSERYMAPELFEENL--- 229

Query: 233 TTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 279
                   E  + Y C     K D+WA+GI L  ++F   PF +  Q
Sbjct: 230 -----DRDERSEPYDC----SKVDLWAIGIVLLNIVFQKNPFSVANQ 267

>Scas_640.16
          Length = 505

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 111/247 (44%), Gaps = 48/247 (19%)

Query: 113 IVQYY----DSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT--KLSEAEVLKIM 166
           IV+YY    D N+S          + + ME     SL       L+   ++SE  + KI 
Sbjct: 269 IVRYYGMFNDVNSS---------SIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKIS 319

Query: 167 YDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLM 226
             +  GLS++H Q+  +IHRDIK +N+L +     KLCDFG +   + ++A+        
Sbjct: 320 ESVLRGLSYLHEQK--VIHRDIKPQNILFNEKGQVKLCDFGVSGEAVNSLATT------- 370

Query: 227 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF---ELTGQFA-- 281
                  T  Y +PE I   +  P +   DIW+LG+ + ++     PF   ++T   A  
Sbjct: 371 ----FTGTSFYMAPERI---QGQPYSVTCDIWSLGLTILEVAQGRFPFGSDKITATIAPI 423

Query: 282 -----ILHSKYEIPRN-----SFSSKLINLVIIMLAENPYLRPNVYQVMYH--ICSMMEC 329
                IL    E+        ++S    + +   L ++P+ RP+  Q++ H  I   M+ 
Sbjct: 424 ELLVLILTFNPELKDEPELNITWSKAFKSFIHFCLKKDPHERPSPRQMIDHPWIQGQMKK 483

Query: 330 EVKIDDL 336
           +V +++ 
Sbjct: 484 KVNMENF 490

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 70/147 (47%), Gaps = 29/147 (19%)

Query: 133 VLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRD 187
           V ++M+    G L   +  +QR      K   AEV        + L ++H +   +I+RD
Sbjct: 225 VFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLHSKE--IIYRD 275

Query: 188 IKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR 247
           +K EN+L+D + + K+ DFG  +  +P V              +  TP Y +PE++    
Sbjct: 276 LKPENILLDKNGHIKITDFG-FAKYVPDVT-----------YTLCGTPDYIAPEVVS--- 320

Query: 248 CLPINEKSDIWALGIFLYKLLFYTTPF 274
             P N+  D W+ GI +Y++L   TPF
Sbjct: 321 TKPYNKSVDWWSFGILIYEMLAGYTPF 347

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 29/148 (19%)

Query: 132 EVLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHR 186
           ++ ++M+    G L   +  +QR      K   AEV        + L ++H +   +I+R
Sbjct: 159 QIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLHSK--DIIYR 209

Query: 187 DIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY 246
           D+K EN+L+D + + K+ DFG  +  +P V              +  TP Y +PE++   
Sbjct: 210 DLKPENILLDKNGHIKITDFG-FAKYVPDVTYT-----------LCGTPDYIAPEVVS-- 255

Query: 247 RCLPINEKSDIWALGIFLYKLLFYTTPF 274
              P N+  D W+ GI +Y++L   TPF
Sbjct: 256 -TKPYNKSIDWWSFGILIYEMLAGYTPF 282

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 19/143 (13%)

Query: 133  VLLLMELCPNGSLLDYM-NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
            +   ME    G L+ ++ NQRL+ + ++       Y   V L+  ++    +I+RD+K+E
Sbjct: 898  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGIIYRDLKLE 951

Query: 192  NVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPI 251
            N+L+  + + K+ D+G             E+           TP++ +PE++   R    
Sbjct: 952  NILLTLEGHIKIADYG---------LCKDEMWFGNRTSTFCGTPEFMAPEIL---REQAY 999

Query: 252  NEKSDIWALGIFLYKLLFYTTPF 274
             +  D WA G+ LY++L   +PF
Sbjct: 1000 TKAVDWWAFGVLLYQMLLCQSPF 1022

>Scas_629.16
          Length = 918

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 118/293 (40%), Gaps = 42/293 (14%)

Query: 35  VLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGL 94
           + VG    E I+ L +G    +Y V     TN L    +I    + +  K+++       
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR-EKKTNRL-YALKIFSKSEMIKRKKIK------- 562

Query: 95  NELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
             +  E E++    N   +V  Y S  S        Y +   ME C  G     +  R  
Sbjct: 563 -RILAEQEILA-TSNHPFVVTLYHSFQSE------DY-LYFCMEYCMGGEFFRALQTRRT 613

Query: 155 TKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG----STS 210
             +SE +      ++T  L ++H      I+RD+K EN+L+    +  L DF     +  
Sbjct: 614 KCISEDDARFYASEVTAALEYLHL--LGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKD 671

Query: 211 PCLPAVASHQEIAM---------LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 261
             +P +    E  +            N +V T  +Y +PE+I   R        D W LG
Sbjct: 672 AKVPVMKGSAESTVVDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTAAVDWWTLG 727

Query: 262 IFLYKLLFYTTPFELTGQ---FA-ILHSKYEIPRNS-FSSKLINLVIIMLAEN 309
           I +Y++LF  TPF+ +     F+ IL +    P N+  S    +L+  +L +N
Sbjct: 728 ILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>Scas_651.18
          Length = 371

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 34/187 (18%)

Query: 132 EVLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHR 186
           +V ++M+    G L   +  +QR      K   AEV        + L ++H     +I+R
Sbjct: 131 QVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLH--SMDIIYR 181

Query: 187 DIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY 246
           D+K EN+L+D + + K+ DFG  +  +P +              +  TP Y +PE++   
Sbjct: 182 DLKPENILLDKNGHIKITDFG-FAKYVPDITYT-----------LCGTPDYIAPEVVS-- 227

Query: 247 RCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA----ILHSKYEIPRNSFSSKLINLV 302
              P N+  D W+ GI +Y++L   TPF  +        IL+ K + P N F   + +L+
Sbjct: 228 -TKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFP-NFFHDDVKDLL 285

Query: 303 IIMLAEN 309
             ++ +N
Sbjct: 286 SKLITKN 292

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 112/270 (41%), Gaps = 48/270 (17%)

Query: 70  RQDRILQPGDTVCLKRV--RVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDG 127
           RQ R  +    V +K +  R    N L  L +E+ +++KL +  NIV++ D   SR    
Sbjct: 71  RQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKL-DHPNIVKFKDWFESR---- 125

Query: 128 KPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRD 187
               +  ++ +L   G L D + ++   K +E + +KI+  +   + +MH Q   ++HRD
Sbjct: 126 ---EKFYIVTQLATGGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMHSQN--VVHRD 178

Query: 188 IKIENVLV---DADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIY--VHTTPQYRSPEM 242
           +K ENVL      ++   + DFG               A  M  +   V TT  +  P  
Sbjct: 179 LKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGHGKP-- 236

Query: 243 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF--ELTGQF----------AILHSKYEIP 290
                C       DIW+LG+  Y LL   +PF  E T  F             HS Y   
Sbjct: 237 -----C-------DIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY--- 281

Query: 291 RNSFSSKLINLVIIMLAENPYLRPNVYQVM 320
            N+ S +    ++  L   P  RP   +++
Sbjct: 282 WNNISKEAKQFILRALTLTPARRPTAAELL 311

>Kwal_33.13846
          Length = 375

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 29/147 (19%)

Query: 133 VLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRD 187
           V ++M+    G L   +  +QR      K   AEV        + L ++H Q   +I+RD
Sbjct: 138 VFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLHAQ--DIIYRD 188

Query: 188 IKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR 247
           +K ENVL+D + + K+ DFG  +  +P V              +  TP Y +PE++    
Sbjct: 189 LKPENVLLDKNGHVKITDFG-FAKFVPDVT-----------YTLCGTPDYIAPEVVS--- 233

Query: 248 CLPINEKSDIWALGIFLYKLLFYTTPF 274
             P N+  D W+ GI ++++L   TPF
Sbjct: 234 TKPYNKSVDWWSFGILIFEMLAGYTPF 260

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 134/328 (40%), Gaps = 71/328 (21%)

Query: 40  HQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRN 99
           ++ +V+E +  G F  + KV  V  +  + R++  ++ G     +R          +L  
Sbjct: 25  NEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKE--IKYGHMNSKER---------QQLIA 73

Query: 100 EVEVMKKLRNCSNIVQYY--DSNASRLG---DGKPGYEVLLLMELCPNGSLLDYMNQRLA 154
           E  ++  LR+  NIV++Y  D  +SR G   D   G  + L ME C  G L   +     
Sbjct: 74  ECTILAGLRH-ENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKG 132

Query: 155 TK--LSEAEVLKIMYDITVGLSHMH-----------YQR-------------TPLIHRDI 188
            +  + E ++ +I   + + L   H           Y +             T +IHRD+
Sbjct: 133 MRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDL 192

Query: 189 KIENVLVDADN------------NFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQ 236
           K  N+ +  D               KL DFG        +A   + A+     YV  TP 
Sbjct: 193 KPGNIFLTGDGVGGRGSVDYSKVEVKLGDFG--------LAKSLQSAIEFATTYV-GTPY 243

Query: 237 YRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQFAILHSKYEIPRN 292
           Y SPE++      P +  SDIW+LG  +Y+L     PF     +  Q  I  +  +   +
Sbjct: 244 YMSPEVL---MDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPD 300

Query: 293 SFSSKLINLVIIMLAENPYLRPNVYQVM 320
            +S +L  LVI  +  N  LRP+ + ++
Sbjct: 301 YYSKELQQLVISCINPNEKLRPSAFDLL 328

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 16/119 (13%)

Query: 156 KLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPA 215
           ++SE  + KI   +  GLS++H ++  +IHRDIK +N+L++ D   KLCDFG +   + +
Sbjct: 279 RISEKVLGKISEAVLRGLSYLHEKK--VIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNS 336

Query: 216 VASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
           +A+               T  Y +PE I   +  P +   D+W+LG+ + ++     PF
Sbjct: 337 LATT-----------FTGTSYYMAPERI---QGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 19/143 (13%)

Query: 133  VLLLMELCPNGSLLDYM-NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIE 191
            +   ME    G L+ ++ NQRL+ + ++       Y   V L+   +    +I+RD+K+E
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKFFHDNGVIYRDLKLE 946

Query: 192  NVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPI 251
            N+L+  + + K+ D+G    C   +    + +          TP++ +PE++   R    
Sbjct: 947  NILLTPEGHIKIADYG---LCKDGMWYGNKTSTFCG------TPEFMAPELL---REQDY 994

Query: 252  NEKSDIWALGIFLYKLLFYTTPF 274
             +  D WA G+ LY++L   +PF
Sbjct: 995  TKAVDWWAFGVLLYQMLLCQSPF 1017

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 86/356 (24%), Positives = 140/356 (39%), Gaps = 97/356 (27%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91
           G T   G ++ E  E L +G F  +YK                LQ    V +KR+ V+ E
Sbjct: 52  GCTTFQGNYKEE--EKLGQGTFGEVYKGLH-------------LQTQRKVAMKRIIVNQE 96

Query: 92  NGLNEL--RNEVEVMKKLRNCSNIVQY------------------YDSNASRLGDGKPG- 130
           N L  +  + E+ ++K+L N  NI++                   ++ N S      P  
Sbjct: 97  NDLFPITAQREITILKRL-NHKNIIKLLEMVYDFPPESNNKDYAQFNQNNSANPPAVPKK 155

Query: 131 --YEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDI 188
             Y +L  M    +G L    N R+  K+  A++  +M  I  G++ +H  +   +HRDI
Sbjct: 156 FFYMILPYMVADLSGIL---HNPRIELKM--ADIKNMMKQILEGVNFIHCSK--FMHRDI 208

Query: 189 KIENVLVDADNNFKLCDFG------STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEM 242
           K  N+L+D +   KL DFG       + P +    S    A   +   V  T  YR+PE+
Sbjct: 209 KTANLLIDHNGVLKLADFGLARQYYGSPPNIKFPGSAGSGAKYTS---VVVTRWYRAPEL 265

Query: 243 I--DLYRCLPINEKSDIWALG-IF---------------------LYKLLFYTTPFELTG 278
           +  D Y    +    DIW +G +F                     ++KL+   TP E T 
Sbjct: 266 VLGDKYYTTAV----DIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLM--GTPDERTW 319

Query: 279 QFAILHSKYEIPRNSFSSKL------------INLVIIMLAENPYLRPNVYQVMYH 322
           + A      E+ +  + S +            ++ +  +LA +PY R      M H
Sbjct: 320 ELAKYLPGAELTKTEYKSTIDERFGKHLTPTGLSFLKGLLALDPYKRLTAMSAMKH 375

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 81/163 (49%), Gaps = 35/163 (21%)

Query: 113 IVQYY-----DSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL---ATKLSEAEVLK 164
           IV+YY     D N+S          + + ME    G  LD + + L     ++SE  + K
Sbjct: 280 IVRYYGMFTDDENSS----------IYIAMEYM-GGRSLDAIYKNLLERGGRISEKVLGK 328

Query: 165 IMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAM 224
           I   +  GLS++H ++  +IHRDIK +N+L++ +   KLCDFG +   + ++A+      
Sbjct: 329 IAEAVLRGLSYLHEKK--VIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATT----- 381

Query: 225 LMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
                    T  Y +PE I   +  P +  SD+W+LG+ + ++
Sbjct: 382 ------FTGTSFYMAPERI---QGQPYSVTSDVWSLGLTILEV 415

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 100/227 (44%), Gaps = 31/227 (13%)

Query: 45  IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVM 104
           +  + +G F+ +Y+V+F              + G    +K VR +  N  N +  E+ ++
Sbjct: 399 VSIMGKGQFSTVYQVTFP-------------ETGLKYAIKSVRPTKHNFTNRILQEINML 445

Query: 105 KKLRN-CSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATK---LSEA 160
             +++  +N  +  +     +          ++ E C NG+L  ++ + +  K   L + 
Sbjct: 446 STIQDSVTNDTEGKEYIVEFISSWSHKGSFYIMTEFCENGNLDAFIQEHVIAKQQRLEDW 505

Query: 161 EVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQ 220
            + KI+ +I + L  +H     ++H D+K  NVL+  + N KL DFG  +       S +
Sbjct: 506 RIWKIIVEICLALRFIH-DSCSIVHLDLKPANVLITFEGNLKLADFGMATKLPIEDKSFE 564

Query: 221 EIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267
                          +Y +PE+I   R    + ++DI++LG+ + ++
Sbjct: 565 N----------EGDREYIAPEII---RDGIYDFRADIFSLGLMMIEI 598

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 157/350 (44%), Gaps = 71/350 (20%)

Query: 49  AEGGFAHIYKVSFV------------GYTNELDRQDRILQPGDTVC----LKRVRVSDEN 92
           +EG  AH+   S+V              T  + RQ +  + G+ V     +K+    ++ 
Sbjct: 19  SEGKMAHVQPASYVNKKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKV 78

Query: 93  GLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQR 152
            L  L +E++++++L +  NIV + D   S+        +  ++ +L   G L D + ++
Sbjct: 79  QLEALYDELDILQRLHH-PNIVAFKDWFESK-------DKFYIITQLAKGGELFDRILKK 130

Query: 153 LATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL-VDADNN--FKLCDFGST 209
              K +E + ++I+ +I   + +MH Q   ++HRD+K EN+L +D  +     + DFG  
Sbjct: 131 --GKFTEEDAVRILVEILSAVKYMHSQN--IVHRDLKPENLLYIDKSDESPLVVADFG-- 184

Query: 210 SPCLPAVASHQEIAMLMNNIYV-HTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYK 266
                 + S +E+      +Y    +  Y +PE++  D +      +  DIW++G+  Y 
Sbjct: 185 --IAKRLKSDEEL------LYKPAGSLGYVAPEVLTQDGH-----GKPCDIWSIGVITYT 231

Query: 267 LLFYTTPFE-----------LTGQFAI-LHSKYEIPRNSFSSKLINLVIIMLAENPYLRP 314
           LL   + F             TG++ +  H  Y    +S S+K    ++  L  +P  RP
Sbjct: 232 LLCGYSAFRAERVQDFLDECTTGEYPVKFHRPY---WDSVSNKAKQFILKALNLDPSKRP 288

Query: 315 NVYQVM---YHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDM 361
              +++   + IC+    E+K  +L        D   +++  ++R++ +M
Sbjct: 289 TAAELLEDPWIICT----ELKTHNLLPGLKEGLDARQKFRNSVERVRLNM 334

>Scas_700.35
          Length = 439

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 89/183 (48%), Gaps = 26/183 (14%)

Query: 96  ELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLAT 155
           +L  E+E  K  ++ + IV YY        D   G  + + ME    G  LD + + L +
Sbjct: 193 QLFRELEFNKSFKS-NYIVTYY----GMFNDTLNG-SIYIAMEYM-GGQSLDTIYKSLLS 245

Query: 156 K---LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPC 212
           +   + E  + KI   +  GLS++H ++  +IHRDIK +N+L++ +   KLCDFG +   
Sbjct: 246 RGGRIGEKILGKIAESVLRGLSYLHERK--IIHRDIKPQNILLNEEGEVKLCDFGVSGEA 303

Query: 213 LPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 272
           + ++A+               T  Y +PE I  +   P +   D+W+LG+ + ++     
Sbjct: 304 VNSLATT-----------FTGTSFYMAPERIQGH---PYSVTCDVWSLGLTILEVAQGRF 349

Query: 273 PFE 275
           PF+
Sbjct: 350 PFD 352

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 90/194 (46%), Gaps = 13/194 (6%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           +  +++  P G LL ++ QR  T   E      M  +   + ++H +   +IHRD+K EN
Sbjct: 92  LYFVLDYAPGGELL-HLLQRYGT-FDEVWSKHFMCQLVDVVEYIHSKG--VIHRDLKPEN 147

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           VL+  D    + DFG+ S       S           +V T  +Y SPE++   +C    
Sbjct: 148 VLLSKDGRLMVTDFGAASVVTTDGTSSDNSVSERAASFVGTA-EYVSPELLLNNQCF--- 203

Query: 253 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAE 308
             SDIWALG  LY+ +  + PF    EL     I+   Y   + + +  +++LV  +L  
Sbjct: 204 FSSDIWALGCILYQFMQGSPPFRGENELQTFEKIVSLDYHW-KLAVNPSVMDLVRHILVI 262

Query: 309 NPYLRPNVYQVMYH 322
           +P+ R ++  +  H
Sbjct: 263 DPHERLSISAIKQH 276

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 102/217 (47%), Gaps = 41/217 (18%)

Query: 70  RQDRILQPGDTVC----LKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLG 125
           RQ R +  GD V     LK+    ++  L  L +E+ +++KL N  NIV++ D   S+  
Sbjct: 61  RQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKL-NHPNIVKFKDWFESK-- 117

Query: 126 DGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIH 185
                 +  ++ +L   G L D + Q+   K +E + +KI+  I   + ++H +   ++H
Sbjct: 118 -----EKFYIVTQLATGGELFDRILQK--GKFTEVDAVKIVVQILKAVEYLHSRN--IVH 168

Query: 186 RDIKIENVL-VDADNNFKLC--DFGSTSPCLPAVASHQEIAMLMNN--IYVHTTP---QY 237
           RD+K EN+L +D  +N +L   DFG              IA  + N    +H       Y
Sbjct: 169 RDLKPENLLYLDKSDNSQLVLGDFG--------------IAKELKNDGDLIHKAAGSMGY 214

Query: 238 RSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 274
            +PE++         +  DIW++G+  Y LL   +PF
Sbjct: 215 VAPEVL---TSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>Scas_582.1
          Length = 638

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 131/308 (42%), Gaps = 54/308 (17%)

Query: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTV-CLKRVRVS- 89
           GS+  + + ++E IE L  G + ++ KV              + +P + +  +K V++  
Sbjct: 320 GSSSRITLAELEFIEELGHGNYGNVSKV--------------LHKPTNVIMAMKEVKLEL 365

Query: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149
           DE    ++  E+EV+ K ++   IV +Y    +   +G     V + ME    GSL    
Sbjct: 366 DEAKFRQILMELEVLHKCKS-PYIVDFY---GAFFIEG----AVYMCMEYMDGGSLDKIY 417

Query: 150 NQRLATK-LSEAEVLKIMYDITVGLS---HMHYQRTPLIHRDIKIENVLVDAD-NNFKLC 204
           +Q      + E ++  I   +  GL     +H+    +IHRD+K  N+L  A     KLC
Sbjct: 418 DQDPEIGGIDEPQLAVIATAVIRGLKVLKDVHH----IIHRDVKPTNILCSAKQGTIKLC 473

Query: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYR--CLPINEKSDIWALGI 262
           DFG        V+ +   +M   NI   +   Y +PE I            +SDIW+LG+
Sbjct: 474 DFG--------VSGNLVASMAKTNIGCQS---YMAPERIKSLNPDIATYTVQSDIWSLGL 522

Query: 263 FLYKLLFYTTPF---ELTGQFAILHSKYE-----IPRNSFSSKLINLVIIMLAENPYLRP 314
            + ++     P+        F+ L +  +     +P   FS +  + V + L + P  R 
Sbjct: 523 SILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRL 582

Query: 315 NVYQVMYH 322
           N   ++ H
Sbjct: 583 NYTALLEH 590

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 129/298 (43%), Gaps = 43/298 (14%)

Query: 2   SKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSF 61
           SKR+T         VP   ++  P  + +  +  + G  + E+I+ L +G +  +     
Sbjct: 35  SKRNT----DAAGIVPDFTSIKAPRTIYKNANFSISG--KYEIIQVLGKGSYGVV----- 83

Query: 62  VGYTNELDRQDRILQPGDTVCLKRVR--VSDENGLNELRNEVEVMKKLRNCSNIVQYYDS 119
               ++LD +D   Q   TV +K++      +  L     E++ M   +   +IV   D 
Sbjct: 84  CSAKHKLDNED---QEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKGHKHIVNLIDI 140

Query: 120 NASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL---ATKLSEAEVLKIMYDITVGLSHM 176
               +   KP Y+ L   +      L+DY   R+   + +LSE  +   +Y I  G+ ++
Sbjct: 141 ---EIVQDKP-YDGLYCYQ-----ELIDYDLARVIHSSVQLSEFHIQHFIYQILCGVKYI 191

Query: 177 HYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQ 236
           H     +IHRD+K  N+L   +   K+CDFG          +       + N YV  T  
Sbjct: 192 H--SADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNEITN-YV-ATRW 247

Query: 237 YRSPEMIDLYRCLPINEKS---DIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPR 291
           YR+PE+I     L  NE +   D+W++G  L +  FY       G+ +I H  YEI +
Sbjct: 248 YRAPELI-----LSNNEYTKSVDMWSVGCILAE--FYGRRPIFMGKDSI-HQVYEIKK 297

>Scas_690.13
          Length = 354

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 105/241 (43%), Gaps = 47/241 (19%)

Query: 39  VHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELR 98
           +H  +V+  L  G F  ++ V  V   N      ++L+    V +K++         E  
Sbjct: 41  LHDFQVMRTLGTGSFGRVHLVRSV--HNGRYYAIKVLKKQQVVRMKQI---------EHT 89

Query: 99  NEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM--NQRL--- 153
           N+   M KL     +++ +       G  +    + ++M+    G L   +  +QR    
Sbjct: 90  NDERRMLKLVEHPFLIRMW-------GTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP 142

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             K   AEV       T+GL ++H     +I+RD+K EN+L+D + + K+ DFG      
Sbjct: 143 VAKFYAAEV-------TLGLEYLHSHN--IIYRDLKPENILLDRNGHIKITDFGFA---- 189

Query: 214 PAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 273
                 +E+  +   +     P Y +PE+I      P N+  D W+LG+ ++++L   TP
Sbjct: 190 ------KEVDTVTWTL--CGPPDYIAPEVI---ATKPYNKSVDWWSLGVLIFEMLAGYTP 238

Query: 274 F 274
           F
Sbjct: 239 F 239

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 104/256 (40%), Gaps = 53/256 (20%)

Query: 40  HQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR--VRVSDENGLNEL 97
           H     E L  G ++ ++K         LD++         VC K+  ++ +    +   
Sbjct: 9   HDFIFKEELGHGSYSTVFKA--------LDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIE 60

Query: 98  RNEVEVMKKLRNCSNIVQYY----DSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRL 153
           +N + ++ +  +   I  YY    + N   + D  PG E+L L+     G+  D   +  
Sbjct: 61  KNTMNLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKM--GTFNDIWTRHF 118

Query: 154 ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCL 213
             +L +A          +   H H     +IHRD+K ENVL+D D    + DFG+ +   
Sbjct: 119 TAQLIDA----------LEFIHSH----GIIHRDLKPENVLLDRDGRLMITDFGAAATID 164

Query: 214 PAVAS--------------HQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 259
           P+++               +Q  A  +       T +Y SPE++   +C      SDIWA
Sbjct: 165 PSLSGDSAKFNSDSNGSKDNQNCASFVG------TAEYVSPELLLYNQC---GYGSDIWA 215

Query: 260 LGIFLYKLLFYTTPFE 275
           LG  +Y+ +    PF 
Sbjct: 216 LGCMIYQFVQGQPPFR 231

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 66/136 (48%), Gaps = 14/136 (10%)

Query: 133 VLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIEN 192
           + +++     G    Y+ ++   +L E    ++   +  G+ +MH++   L HRD+K+EN
Sbjct: 133 IGIVLHYASGGEFYKYIQKK--RRLKEPAACRLFAQLISGVHYMHHK--GLAHRDLKLEN 188

Query: 193 VLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPIN 252
           +L+D   N  + DFG     +   +S  ++           +P Y +PE++   +     
Sbjct: 189 LLLDEHENLIITDFG----FVNEFSSRNDLMKTSCG-----SPCYAAPELVVTTKAYEA- 238

Query: 253 EKSDIWALGIFLYKLL 268
            K+D+W+ G+ LY +L
Sbjct: 239 RKADVWSCGVILYAML 254

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 110/267 (41%), Gaps = 42/267 (15%)

Query: 29  LQAGSTVLVGVHQVEV----IEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLK 84
           L+  +T++   H VE     I  + EG +  +YK   + YTN+L            V LK
Sbjct: 105 LRVPATIITHTHSVESSYQRITQVGEGTYGKVYKCRNI-YTNKL------------VALK 151

Query: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGD--GKPGYEVLLLMELCPN 142
           ++R+  E     +   +  +K L++C +       N S + +   +    V ++ E   N
Sbjct: 152 KLRLETERDGFPI-TSIREIKLLQHCQH------ENVSTIAEIMCEAQKTVYMIFEYADN 204

Query: 143 GSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFK 202
                 MN+ +    S+A    +   +  G+ ++H  R  ++HRDIK  N+L+D   N K
Sbjct: 205 DLSGLLMNKEI--HFSDANCKHLFRQLLKGMEYLHECR--ILHRDIKGSNILIDNRGNLK 260

Query: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 262
           + DFG       A    QE       I    T  YR PE+  L        + D+W  G 
Sbjct: 261 ITDFGL------ARKMKQEPDYTNRVI----TLWYRPPEL--LLGTTRYGTEVDMWGCGC 308

Query: 263 FLYKLLFYTTPFELTGQFAILHSKYEI 289
            L +L      F+ T +   L   +++
Sbjct: 309 LLVELFLKAAFFQGTNELEQLRCIFQV 335

>Kwal_47.18307
          Length = 621

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 89/189 (47%), Gaps = 17/189 (8%)

Query: 135 LLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194
            ++E    G LL  + QRL  +L+E     I   +   + +MH +   +IHRD+K ENVL
Sbjct: 89  FVLEYVSGGELLALI-QRLG-RLTEDLSRHITAQLVDTVDYMHSK--GVIHRDLKPENVL 144

Query: 195 VDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEK 254
           +  +    + DFG+        A+ ++            T +Y SPE++   +C      
Sbjct: 145 LSQEGRVVITDFGAA-----CTAADRKFENTKRTASFVGTAEYVSPELLLHSQC---GFS 196

Query: 255 SDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENP 310
           SDIWALG  +Y+L     PF    EL     I+   Y+    S S +++++V  +L  +P
Sbjct: 197 SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKW-LFSNSPQVVSIVQSILVTDP 255

Query: 311 YLRPNVYQV 319
             RP+  Q+
Sbjct: 256 LKRPSAAQL 264

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 29/148 (19%)

Query: 132 EVLLLMELCPNGSLLDYM--NQRL---ATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHR 186
           ++ ++M+    G L   +  +QR      K   AEV        + L ++H +   +I+R
Sbjct: 217 QLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV-------CLALEYLHSK--GIIYR 267

Query: 187 DIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLY 246
           D+K EN+L+D + + KL DFG  +  +P V              +  TP Y +PE++   
Sbjct: 268 DLKPENILLDKNGHIKLTDFG-FAKYVPDVT-----------YTLCGTPDYIAPEVVS-- 313

Query: 247 RCLPINEKSDIWALGIFLYKLLFYTTPF 274
              P N+  D W+ G+ +Y++L   TPF
Sbjct: 314 -TKPYNKSVDWWSFGVLIYEMLAGYTPF 340

>Kwal_14.1416
          Length = 365

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 91/193 (47%), Gaps = 13/193 (6%)

Query: 78  GDTVCLKRVR-VSDENGLNELRNEVEVMKKLRNCSNIVQYYDS-NASRLGDGKPGYEVLL 135
           G  V +K+++  S E  +     E++++K   +  NI+   D    + +   +  Y V  
Sbjct: 36  GTKVAIKKIQPFSKEMFVTRTLRELKLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQE 95

Query: 136 LMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLV 195
           LME     + L  +       LS+  +    Y I   L  +H  +  +IHRDIK  N+L+
Sbjct: 96  LME-----TDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQ--VIHRDIKPSNLLL 148

Query: 196 DADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKS 255
           +++ + K+CDFG     + +  S Q +   M   YV  T  YR+PE++  ++   +    
Sbjct: 149 NSNCDLKVCDFGLARCLISSTHSRQNLVGFMTE-YV-ATRWYRAPEIMLTFQQYTV--AM 204

Query: 256 DIWALGIFLYKLL 268
           DIW+ G  L +++
Sbjct: 205 DIWSCGCILAEMI 217

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,372,576
Number of extensions: 1356981
Number of successful extensions: 4915
Number of sequences better than 10.0: 633
Number of HSP's gapped: 4579
Number of HSP's successfully gapped: 664
Length of query: 944
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 833
Effective length of database: 12,753,511
Effective search space: 10623674663
Effective search space used: 10623674663
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)