Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR026C1071054398e-58
KLLA0F18634g84601879e-20
Kwal_27.1094984601704e-17
Scas_718.48*88681504e-14
YBR058C-A (TSC3)80541201e-09
YDR296W (MHR1)22648592.0
Scas_621.5191440574.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR026C
         (105 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH] (762745.....   173   8e-58
KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521 Sac...    77   9e-20
Kwal_27.10949                                                          70   4e-17
Scas_718.48*                                                           62   4e-14
YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein a...    51   1e-09
YDR296W (MHR1) [1124] chr4 (1055204..1055884) Protein involved i...    27   2.0  
Scas_621.5                                                             27   4.7  

>AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH]
           (762745..763068) [324 bp, 107 aa]
          Length = 107

 Score =  173 bits (439), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 86/105 (81%)

Query: 1   MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYY 60
           MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYY
Sbjct: 1   MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYY 60

Query: 61  LMTSFDSXXXXXXXXXXXXXXXXXXXKWVLSLYWATVGYMAYAAT 105
           LMTSFDS                   KWVLSLYWATVGYMAYAAT
Sbjct: 61  LMTSFDSFCLHVFFLVVFTLSLFGLLKWVLSLYWATVGYMAYAAT 105

>KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521
          Saccharomyces cerevisiae YBR058ca required for optimal
          serine palmitoyltransferase activity, start by
          similarity
          Length = 84

 Score = 76.6 bits (187), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (76%)

Query: 8  MSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYYLMTSFDS 67
          M++++    YKK RGTM+YTPT+ Q + G + EK+  F ++LYW+YYIHLP+YLMTS D+
Sbjct: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60

>Kwal_27.10949
          Length = 84

 Score = 70.1 bits (170), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (66%)

Query: 8  MSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYYLMTSFDS 67
          M+    +   + + GTM+Y PTD + + G   EKV  F E+LYWMYYIHLPYYLMT+ D+
Sbjct: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60

>Scas_718.48*
          Length = 88

 Score = 62.4 bits (150), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 14/68 (20%)

Query: 8  MSSKRADNCYKKDRGTMVYTPTD--------AQQATGKVHEKVYKFFESLYWMYYIHLPY 59
          ++S  A  C      TM++ PT+        A    G + EKV +  E LYWMYYIHLPY
Sbjct: 3  LTSATASQC------TMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPY 56

Query: 60 YLMTSFDS 67
          YLMTSFDS
Sbjct: 57 YLMTSFDS 64

>YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein
          associated with serine palmitoyltransferase and
          required for optimal enzyme activity [243 bp, 80 aa]
          Length = 80

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 5/54 (9%)

Query: 19 KDRGTMVYTPT--DAQQATGK---VHEKVYKFFESLYWMYYIHLPYYLMTSFDS 67
          + + +MVY PT  +A++  GK   +   + +  E LYW YYIHLP+YLM SFDS
Sbjct: 3  QHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDS 56

>YDR296W (MHR1) [1124] chr4 (1055204..1055884) Protein involved in
           repair, recombination and maintenance of mitochondrial
           DNA, functions as a transcriptional repressor in a
           manner dependent on Ssn3p and Ssn8p [681 bp, 226 aa]
          Length = 226

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 5/48 (10%)

Query: 6   DTMSSKRADNCYKKDRGTMV-----YTPTDAQQATGKVHEKVYKFFES 48
           D    K +D   KKD    V     Y PT  Q+A   + E + K FE+
Sbjct: 100 DVAQRKESDKLRKKDSNGHVWYSGQYRPTYCQEAVADLRESLLKVFEN 147

>Scas_621.5
          Length = 1914

 Score = 26.6 bits (57), Expect = 4.7,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 3/40 (7%)

Query: 15   NCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYY 54
            NCYK D GT+   P D +    +V E++   F+     +Y
Sbjct: 1521 NCYKDDEGTV---PDDIKPILDRVRERMISTFDDESLEFY 1557

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.130    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,777,077
Number of extensions: 83699
Number of successful extensions: 188
Number of sequences better than 10.0: 9
Number of HSP's gapped: 187
Number of HSP's successfully gapped: 9
Length of query: 105
Length of database: 16,596,109
Length adjustment: 76
Effective length of query: 29
Effective length of database: 13,965,141
Effective search space: 404989089
Effective search space used: 404989089
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)