Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR025W37937219930.0
Kwal_27.1095138137313630.0
KLLA0F18656g38435813440.0
Kwal_27.1050071193740.45
Sklu_2414.8105178720.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR025W
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR025W [4335] [Homologous to NOHBY] complement(761515..762654) ...   772   0.0  
Kwal_27.10951                                                         529   0.0  
KLLA0F18656g complement(1714588..1715742) similar to ca|CA2493|I...   522   0.0  
Kwal_27.10500                                                          33   0.45 
Sklu_2414.8 YKL205W, Contig c2414 16296-19451                          32   0.82 

>AGR025W [4335] [Homologous to NOHBY] complement(761515..762654)
           [1140 bp, 379 aa]
          Length = 379

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MNQRGIATAVTAEPPSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPRT 60
           MNQRGIATAVTAEPPSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPRT
Sbjct: 1   MNQRGIATAVTAEPPSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPRT 60

Query: 61  KYLVALVVGLQLLSAYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPK 120
           KYLVALVVGLQLLSAYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPK
Sbjct: 61  KYLVALVVGLQLLSAYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPK 120

Query: 121 HNRLFSIFCKPAESGIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTFF 180
           HNRLFSIFCKPAESGIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTFF
Sbjct: 121 HNRLFSIFCKPAESGIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTFF 180

Query: 181 ATFQIFFYALRPMMVVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGSL 240
           ATFQIFFYALRPMMVVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGSL
Sbjct: 181 ATFQIFFYALRPMMVVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGSL 240

Query: 241 HPCSGHFIAEHYLFSIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALET 300
           HPCSGHFIAEHYLFSIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALET
Sbjct: 241 HPCSGHFIAEHYLFSIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALET 300

Query: 301 YSYYGILNAVTWNVGLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFIF 360
           YSYYGILNAVTWNVGLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFIF
Sbjct: 301 YSYYGILNAVTWNVGLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFIF 360

Query: 361 KYDVTLYNRVRR 372
           KYDVTLYNRVRR
Sbjct: 361 KYDVTLYNRVRR 372

>Kwal_27.10951
          Length = 381

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/373 (65%), Positives = 295/373 (79%), Gaps = 2/373 (0%)

Query: 1   MNQRGIATAV-TAEPPSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPR 59
           +  +G++    T + P+    V VLHNFYW++ KEPHA RR  IL++HPEVKKLMGHEPR
Sbjct: 3   ITHKGLSLGSETMDAPAVSEPVPVLHNFYWSTHKEPHAVRRHAILKSHPEVKKLMGHEPR 62

Query: 60  TKYLVALVVGLQLLSAYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKP 119
           TK++VA VV LQ   AY+LR+T PLS KF   AYV+GATA QN++LAIHELSHNLAF+KP
Sbjct: 63  TKFIVAGVVALQCTVAYLLRNTHPLSFKFWLCAYVIGATANQNIFLAIHELSHNLAFRKP 122

Query: 120 KHNRLFSIFCKPAESGIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTF 179
            HN+LFS+F      G+P+AASF PYHQLHHKFLGDE+YDTD+PT LE ++LSN+LGK F
Sbjct: 123 LHNKLFSVFTN-TPIGVPYAASFAPYHQLHHKFLGDELYDTDIPTNLEVLVLSNILGKAF 181

Query: 180 FATFQIFFYALRPMMVVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGS 239
           FATFQIFFYALRPM V  IP++  H++NV  Q  FD IWI  FG   F YF++SSFLAGS
Sbjct: 182 FATFQIFFYALRPMFVTSIPMSFLHLINVAYQLTFDYIWINTFGWKSFMYFIISSFLAGS 241

Query: 240 LHPCSGHFIAEHYLFSIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALE 299
           LHPCSGHFIAEHY+ ++EEAI GGK+  K+   E E ++ TD S V R DVEF+++YALE
Sbjct: 242 LHPCSGHFIAEHYMLNLEEAIAGGKLVFKNTPCETEAIHSTDASQVNRKDVEFKREYALE 301

Query: 300 TYSYYGILNAVTWNVGLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFI 359
           TYSYYG LN  TWNVGLHNEHHDFPFIAWSKLWELNRMCPE+Y+ LPKH SW +V+WDF+
Sbjct: 302 TYSYYGCLNFFTWNVGLHNEHHDFPFIAWSKLWELNRMCPEYYQNLPKHHSWCKVIWDFV 361

Query: 360 FKYDVTLYNRVRR 372
              DVTLYNRV+R
Sbjct: 362 LHDDVTLYNRVKR 374

>KLLA0F18656g complement(1714588..1715742) similar to
           ca|CA2493|IPF7227 Candida albicans putative fatty acid
           desaturase (by homology), start by similarity
          Length = 384

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/358 (68%), Positives = 289/358 (80%), Gaps = 1/358 (0%)

Query: 15  PSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPRTKYLVALVVGLQLLS 74
           PSAD D +VL NFYW++ KEPHA RR  I++ HPEV++LMGHEP TK+++  VV LQL  
Sbjct: 18  PSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHEPLTKWIIIGVVSLQLSL 77

Query: 75  AYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPKHNRLFSIFCKPAES 134
           +Y LR+T P + KF   AYV+GATA QN++LAIHELSHNLAFKKP HN+LF+IF      
Sbjct: 78  SYYLRNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFKKPVHNKLFAIFTN-TPI 136

Query: 135 GIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTFFATFQIFFYALRPMM 194
           GIP++ASFGPYHQLHHKFLGDE+YDTD+PT  EAVLLSN+LGK+FFATFQIFFYA RPM 
Sbjct: 137 GIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKSFFATFQIFFYAFRPMF 196

Query: 195 VVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGSLHPCSGHFIAEHYLF 254
           V RI  T  H+LNV+ QF+F+ IWI  FG   + YFL+SSFLAGSLHPCSGHFIAEHYL 
Sbjct: 197 VTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAGSLHPCSGHFIAEHYLL 256

Query: 255 SIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALETYSYYGILNAVTWNV 314
           +IEEAI+GGK+ +K    E +P+ VTDES V R DVEFRK YALETYSYYG+LN  TWNV
Sbjct: 257 NIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYALETYSYYGLLNFFTWNV 316

Query: 315 GLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFIFKYDVTLYNRVRR 372
           GLHNEHHDFPF+AWS+LWELN +CPEFY  LPKH SW +VL+DFI   DV LYNRV+R
Sbjct: 317 GLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDFITHDDVVLYNRVKR 374

>Kwal_27.10500
          Length = 711

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 12/93 (12%)

Query: 113 NLAFKKPKHNRLFSIFCKPAESGIPFAASFGPYHQLH-----HKFLGDEVYDTDVPTVLE 167
           ++AF KP+           A+  I +A+ F  +H +H      +++  E  + D P VLE
Sbjct: 315 DIAFYKPRA------LYHTAKDSIQYASKFSLWHMMHAALQLTEYIAFEALE-DEPRVLE 367

Query: 168 AVLLSNVLGKTFFATFQIFFYALRPMMVVRIPI 200
             +  ++LGK FF+      +    +++V IPI
Sbjct: 368 PAVYFDLLGKKFFSMSAKDLFTWNVVLLVVIPI 400

>Sklu_2414.8 YKL205W, Contig c2414 16296-19451
          Length = 1051

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query: 77  MLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPKHNRLFSIFCKPAESGI 136
           +LR   PL LKF+A  Y    + TQ  +     LS  LAF K    +LF+I  KP  S +
Sbjct: 341 ILRQVSPLVLKFMAHEY---DSVTQQCFTF---LSQYLAFLK----KLFAIGGKPG-SAV 389

Query: 137 PFAASFGPYHQLHHKFLG 154
              +   P  Q H +FL 
Sbjct: 390 AMNSKRLPLDQEHLEFLN 407

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,377,198
Number of extensions: 523223
Number of successful extensions: 1451
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1482
Number of HSP's successfully gapped: 8
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)