Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR024C47746824350.0
Kwal_56.2308747646711921e-161
KLLA0F18678g50446711701e-157
Scas_661.265234669791e-128
CAGL0K11968g4954619491e-124
YDR036C (EHD3)5004569481e-123
Scas_526.2304164780.14
AGL365C59979720.90
AER025C291160711.2
YFL047W (RGD2)714151701.8
Kwal_55.214591148118673.5
CAGL0K10296g24838655.1
AER051C77768649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR024C
         (468 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978) [...   942   0.0  
Kwal_56.23087                                                         463   e-161
KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces...   455   e-157
Scas_661.26                                                           381   e-128
CAGL0K11968g complement(1153196..1154683) similar to sp|P28817 S...   370   e-124
YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of t...   369   e-123
Scas_526.2                                                             35   0.14 
AGL365C [3947] [Homologous to NOHBY] (13929..15728) [1800 bp, 59...    32   0.90 
AER025C [2530] [Homologous to ScYOL081W (IRA2) - SH; ScYBR140C (...    32   1.2  
YFL047W (RGD2) [1637] chr6 (40421..42565) GTPase activating prot...    32   1.8  
Kwal_55.21459                                                          30   3.5  
CAGL0K10296g complement(1002739..1003485) similar to sp|P41734 S...    30   5.1  
AER051C [2556] [Homologous to ScYDL060W (TSR1) - SH] (731793..73...    29   9.7  

>AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978)
           [1434 bp, 477 aa]
          Length = 477

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/468 (97%), Positives = 454/468 (97%)

Query: 1   MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD 60
           MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD
Sbjct: 1   MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD 60

Query: 61  VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA 120
           VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA
Sbjct: 61  VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA 120

Query: 121 LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXX 180
           LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMT        
Sbjct: 121 LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQL 180

Query: 181 XXXXXXTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE 240
                 TGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE
Sbjct: 181 GYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE 240

Query: 241 FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE 300
           FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE
Sbjct: 241 FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE 300

Query: 301 KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA 360
           KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA
Sbjct: 301 KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA 360

Query: 361 KTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFKNYRYHNKFTLPTEAAVQAYIT 420
           KTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFKNYRYHNKFTLPTEAAVQAYIT
Sbjct: 361 KTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFKNYRYHNKFTLPTEAAVQAYIT 420

Query: 421 GTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMD 468
           GTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMD
Sbjct: 421 GTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMD 468

>Kwal_56.23087
          Length = 476

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 224/467 (47%), Positives = 316/467 (67%), Gaps = 5/467 (1%)

Query: 1   MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD 60
           M+RS++R    RR MS  VKF +   +RVVTL RPEKLNA++ ++C  I+P +QEYAKSD
Sbjct: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60

Query: 61  VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA 120
           V N+++  S+ APR+ CAGGD+  +A       L+   +FFQ EY++N +LATY KPVV 
Sbjct: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120

Query: 121 LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXX 180
           LMDGITMGGGVGL  HVPFR+ATENT+W MPE+DIG  PDVG +F+LP+I T        
Sbjct: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180

Query: 181 XXXXXXTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE 240
                 TG++L G DVYMAGLASHYV S     L+ RLG +P+T  ++E +  T   +EE
Sbjct: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVT-NSEEMWKITGDALEE 239

Query: 241 FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE 300
           FS  +P+ Y FKY+  +L+VIE  F  +   K +R  LE   +S++ S   + F++ TL+
Sbjct: 240 FSVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQ 299

Query: 301 KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA 360
           KL++KS VS ++  EQF RNSQ DI+SA+KQDL+T++N+  +  ++EF  A  HKLV+K+
Sbjct: 300 KLASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCEDT-VSEFSQATKHKLVDKS 358

Query: 361 KTPYEWKNTSPSVADISKLLAADPANPIDLLETF--GVTFKNYRYHNKFTLPTEAAVQAY 418
           K P++W  T+ +V ++S+L++   A  +  L+ F   +T+K Y YH++F LPTE  ++ Y
Sbjct: 359 KAPFQWTKTALTVEELSRLVSPRAATSVS-LQKFPDSLTWKKYPYHSQFMLPTEQNLKDY 417

Query: 419 ITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKC 465
           ITG D SGRS+A   AE +KYF+++NP S+GK G  Y+ + I  RKC
Sbjct: 418 ITGNDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKC 464

>KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces
           cerevisiae YDR036c singleton, start by similarity
          Length = 504

 Score =  455 bits (1170), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/467 (46%), Positives = 309/467 (66%), Gaps = 8/467 (1%)

Query: 7   RGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIV 66
           R  V + +  S VKF+ ++TARVVTL+RP+KLNA++ E+C +ILP +QEYAKS V NV++
Sbjct: 21  RLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVI 80

Query: 67  FDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGIT 126
            +S+ +PRAFC+GGD+  +AK ++    +   +FF  EY++N  LAT  KPV+++MDGIT
Sbjct: 81  LNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGIT 140

Query: 127 MGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXXXXXXXX 186
           MGGGVGL+ H+PFR+ATENT+WAMPE+DIG  PDVG +F++P++ T              
Sbjct: 141 MGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCM 200

Query: 187 TGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITR-------KADETFANTNAVIE 239
           TG++L GAD Y+AG+ASHYV   Q   L+ RL  + +T        + DE F   N  IE
Sbjct: 201 TGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDVVNHAIE 260

Query: 240 EFSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATL 299
           EF++PLP  Y+FKY  +EL+VIE+ F    S K++   L+   +    S+ A+ FA  T 
Sbjct: 261 EFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTK 320

Query: 300 EKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEK 359
           + L++KS VS EI +E F+RNS  DIQ+A+ QDLIT+T +  + +L EF  A  HKL+EK
Sbjct: 321 QMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPDLCEFAEATSHKLLEK 380

Query: 360 AKTPYEWKNTSPSVADISKLLAADPANPIDLLETFG-VTFKNYRYHNKFTLPTEAAVQAY 418
            KTPY+WK     +A IS L++ + +NP+ L+     VTF  Y +H+K+ LP E  V+ Y
Sbjct: 381 NKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKY 440

Query: 419 ITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKC 465
           ITG D  GR  AVT+ E VK+F + NP ++ K G +Y+V  IIDRKC
Sbjct: 441 ITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKC 487

>Scas_661.26
          Length = 523

 Score =  381 bits (979), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 285/466 (61%), Gaps = 20/466 (4%)

Query: 19  VKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSACAPRAFCA 78
           V F   +TARVVTLNRP KLNA+N E+C S+  ++ EY+KSD  N+I+  S+   R+ CA
Sbjct: 52  VLFSMQDTARVVTLNRPAKLNALNFEMCQSMFQILNEYSKSDATNLIIVKSSDKGRSLCA 111

Query: 79  GGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGITMGGGVGLTIHVP 138
           GGD+  +A        +K  +FF+ EY++N  +ATYPKP+V  M+GITMGGGVGL++H P
Sbjct: 112 GGDVATVAVQNLNGNHKKAIEFFEAEYSLNLQMATYPKPIVTYMNGITMGGGVGLSVHTP 171

Query: 139 FRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXXXXXXXXTGEVLQGADVYM 198
           FR+ATENTKWAMPE+DIG  PDVG +FALPR++T              TGEVL G D YM
Sbjct: 172 FRIATENTKWAMPEMDIGFFPDVGTTFALPRLVTMANNHSQMALYLCLTGEVLNGEDAYM 231

Query: 199 AGLASHYVESTQHGALKERLGTVPITRK--ADET------FANTNAVIEEFSSPLPDGYQ 250
            GLASHYV S    +L+ RLG +  T+   AD        F   N  I EFS+ LP  Y+
Sbjct: 232 LGLASHYVNSENLQSLEVRLGELTPTKHITADPAKSSAIFFDMVNGTINEFSTNLPMDYK 291

Query: 251 FKYNKEELDVIERFFHY--DVSYKELRKNLEAFASSNANSEVARNFAKATLEKLSTKSTV 308
           FK+  ++LDVIE  F      S +E+ ++L+ +A     SE   +F      KL+TKS  
Sbjct: 292 FKFTTDQLDVIESCFDITRHTSIEEILRSLDQYAK----SEAGISFCTEIKNKLATKSMT 347

Query: 309 SAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNE-LAEFENAVIHKLVEKAKTPYEWK 367
           S +I  +  + NS+ DI SA+++DL T++N+  N E ++EF  A  HKLV+K KTPY WK
Sbjct: 348 SMQIALKVLKENSRDDINSALRRDLFTASNMCVNEEGVSEFSEATKHKLVDKQKTPYPWK 407

Query: 368 NTSPSVADISK-LLAADPANPIDLLETFG-VTFKNYRYHNKFTLPTEAAVQAY---ITGT 422
           + S    ++ + +++   + P+ L E F  +T+  Y YH+K+ LP+E +++ Y   ++G 
Sbjct: 408 HNSVISPNLLRAMVSPKLSTPVSLWENFSNITWDQYPYHSKYQLPSEQSIKQYLRRVSGH 467

Query: 423 DQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMD 468
                S  +T+ E +K+FT  N +++ K     + N+I +RKC MD
Sbjct: 468 QDGATSAFITKNEVLKHFTRTNKLTKDKSDVALICNIICERKCNMD 513

>CAGL0K11968g complement(1153196..1154683) similar to sp|P28817
           Saccharomyces cerevisiae YDR036c, hypothetical start
          Length = 495

 Score =  370 bits (949), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/461 (42%), Positives = 282/461 (61%), Gaps = 20/461 (4%)

Query: 19  VKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSACAPRAFCA 78
           V F    TAR+VTLNRP+KLNA+N E+C SI   + EY+KSD AN+I+  S  +PR+ CA
Sbjct: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94

Query: 79  GGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGITMGGGVGLTIHVP 138
           GGD+  +A++      E   + F+ EY++N+ LATY KPVV  MDGITMGGGVGL+IH P
Sbjct: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154

Query: 139 FRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXXXXXXXXTGEVLQGADVYM 198
           FR+ATENTKWAMPE DIG  PDVG +FALPR++T              TG+V+ G D Y+
Sbjct: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214

Query: 199 AGLASHYVESTQHGALKERLG----TVPITRKADETFANTNAVIEEFSSPLPDGYQFKYN 254
            GLASHY+  +    L+ RLG     + I   +DE F + N  IEEF++PLP  ++FK++
Sbjct: 215 LGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFS 274

Query: 255 KEELDVIERFFHYDVSYKE----LRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSA 310
           K++L+VIE+ F  D+S  E    +   LEAF  +    + AR+    T +KL +KS  S 
Sbjct: 275 KDQLEVIEKCF--DISSGESINAIFSKLEAFEGTPEMMQFARD----TKKKLESKSMTSM 328

Query: 311 EITREQFRRNSQRDIQSAMKQDLITSTNLLRNNE-LAEFENAVIHKLVEKAKTPYEWKN- 368
           ++     + NS+ DI+SA+K+DL T+ N+  N+  +AEF  A  HKL++K K PY WK  
Sbjct: 329 QVGIRLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQR 388

Query: 369 TSPSVADISKLLAADPANPIDLLE-TFGVTFKNYRYHNKFTLPTEAAVQAYITGTDQSGR 427
           T  +   ++ L+A  P+ P+ L+     VT+  Y +  K+ LP +  ++  +    + G 
Sbjct: 389 TELTPQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG- 447

Query: 428 SMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMD 468
              + + + VKYFT+FNP ++ K+G E   +L+ D K   D
Sbjct: 448 --PIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWKLSFD 486

>YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of the
           enoyl-coA hydratase/isomerase protein family [1503 bp,
           500 aa]
          Length = 500

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 269/456 (58%), Gaps = 13/456 (2%)

Query: 19  VKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSACAPRAFCA 78
           V F   +TARV+TLNRP+KLNA+N E+  S+   + EYAKSD  N+++  S+  PR+FCA
Sbjct: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98

Query: 79  GGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGITMGGGVGLTIHVP 138
           GGD+  +A         K   FF  EY++N+ +ATY KP+V  MDGITMGGGVGL+IH P
Sbjct: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158

Query: 139 FRVATENTKWAMPELDIGLHPDVGVSFALPRIMTXXXXXXXXXXXXXXTGEVLQGADVYM 198
           FR+ATENTKWAMPE+DIG  PDVG +FALPRI+T              TGEV+ GAD YM
Sbjct: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218

Query: 199 AGLASHYVESTQHGALKERLGTVPITRKADET----FANTNAVIEEFSSPLPDGYQFKYN 254
            GLASHYV S    AL++RLG +      D      F   N  I+EF SPLP  Y FKY+
Sbjct: 219 LGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYS 278

Query: 255 KEELDVIERFFHY--DVSYKELRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSAEI 312
            E+L+VIE  F+   + + +++  NL  +  S       + FA+    KL TKS  S +I
Sbjct: 279 NEKLNVIEACFNLSKNGTIEDIMNNLRQYEGSAE----GKAFAQEIKTKLLTKSPSSLQI 334

Query: 313 TREQFRRNSQRDIQSAMKQDLITSTNLLRNNE-LAEFENAVIHKLVEKAKTPYEW-KNTS 370
                + NS+  I+SA+K+DL T+ N+  N + L EF  A  HKL++K + PY W K   
Sbjct: 335 ALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQ 394

Query: 371 PSVADISKLLAADPANPIDLLE-TFGVTFKNYRYHNKFTLPTEAAVQAYITGTDQSGRSM 429
             V+ ++ + +  P+ P+ LL  T  VT+  Y YH+K+ LPTE  + AYI          
Sbjct: 395 LFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGA 454

Query: 430 AVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKC 465
            VT  E + +F    P  RGK+G + +  ++ +RKC
Sbjct: 455 KVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKC 490

>Scas_526.2
          Length = 304

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 75/164 (45%), Gaps = 10/164 (6%)

Query: 12  RRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIVFDSAC 71
           R++MS  V +       ++ LN P  LN++  +    I  ++++    D   + V  S+ 
Sbjct: 29  RQKMSKRVSYTIEGPIFIIKLNDPRHLNSLTFDDFVYIAMLLEKANSDDSIFITVLQSSA 88

Query: 72  APRAFCAGG--DIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLA----TYPKPVVALMDGI 125
             + F +GG  + VL +K  + D +  +++      + N  +A    T+ K +V  ++G 
Sbjct: 89  --KFFSSGGKFEAVLESKG-KEDDIGSLNNLIGMISSPNVFVANAFRTHEKLLVCCLNGP 145

Query: 126 TMGGGVGLTIHVPFRVATENTKWAM-PELDIGLHPDVGVSFALP 168
            +G    + +      A +++ + + P  ++G   +VG S  LP
Sbjct: 146 AVGLSACIVMLCDLVYARDDSVYLLFPFSNLGFVAEVGSSVTLP 189

>AGL365C [3947] [Homologous to NOHBY] (13929..15728) [1800 bp, 599
           aa]
          Length = 599

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 386 NPIDLLETFGVTFKN-YRYHNKFTLPTEAAV-----QAYITGTDQSGRSMAVTRAETVKY 439
           NP  LL    + FK  YR    F L   A+V     QA I  T   G+  A T +ET++ 
Sbjct: 413 NP--LLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKH-ASTCSETIR- 468

Query: 440 FTEFNPVSRGKVGTEYVVN 458
             + +P+SR  VG EYV++
Sbjct: 469 --QVSPLSRWLVGVEYVLS 485

>AER025C [2530] [Homologous to ScYOL081W (IRA2) - SH; ScYBR140C (IRA1)
            - SH] (675431..684166) [8736 bp, 2911 aa]
          Length = 2911

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 308  VSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKAKTPYEWK 367
            ++ +I R   R   ++++ S +   LI S  LL  +      + VIH  V++A    EWK
Sbjct: 2271 ITTQIIRRLIRITMKQELHSILYAQLIFSNILLEGDLTELLFDEVIHHCVDRASEGSEWK 2330

>YFL047W (RGD2) [1637] chr6 (40421..42565) GTPase activating protein
           (GAP) containing a Fes/CIP4 domain, a
           dishevelled-Egl-10-pleckstrin homology domain, a Rho-GAP
           domain, and a PEST motif, has similarity to Rga2p [2145
           bp, 714 aa]
          Length = 714

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 61/151 (40%), Gaps = 21/151 (13%)

Query: 254 NKEELDVI----ERFFH----YDVSYKELRKNLEAFASSNANSEVARNFAKATLEKLSTK 305
           NK E DV      RFF+     D  YK +++ L+   +    ++        +L    + 
Sbjct: 178 NKYEEDVAREKDHRFFNRIAGIDFDYKTMKETLQLLLTKLPKTDYKLPLISYSL----SN 233

Query: 306 STVSAEITREQFRRNSQRDIQSA--MKQDLITSTNLLRNNELAEFENAVIHKLVEKAKTP 363
           +    EIT+      S +DI  A    QDL+       N    ++ N V +  V   K  
Sbjct: 234 TNNGGEITKFLLDHMSLKDIDQAETFGQDLL-------NLGFLKYCNGVGNTFVNSKKFQ 286

Query: 364 YEWKNTSPSVADISKLLAADPANPIDLLETF 394
           Y+WKNT+   A++    + +P     L+  F
Sbjct: 287 YQWKNTAYMFANVPMPGSEEPTTGESLISRF 317

>Kwal_55.21459
          Length = 1148

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 262  ERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSAEITR----EQF 317
            E+   YD   + L  +L+  A      +  RNF K+  E L TK++  A+I      +QF
Sbjct: 971  EKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAKIRSHKGLKQF 1030

Query: 318  RRNSQRDIQSAMKQDLITSTNLLRN-NELAEFENAVIHKLVEKAKTPYEWKNTSPSVA 374
                  ++QS M  D  + + LL + ++L +  + ++ K +E A   Y      P  A
Sbjct: 1031 LDEPAPELQS-MDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKAKVEPGTA 1087

>CAGL0K10296g complement(1002739..1003485) similar to sp|P41734
           Saccharomyces cerevisiae YOR126c EST2 isoamyl acetate
           hydrolytic enzyme, hypothetical start
          Length = 248

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 122 MDGITMGGGVGLTIHVPFRVATE-----NTKWAMPELD 154
           +DG ++G G+G   +    V T      NT+W +P LD
Sbjct: 31  IDGFSLGSGLGAVYNRKLDVVTRGFSGYNTRWCLPVLD 68

>AER051C [2556] [Homologous to ScYDL060W (TSR1) - SH]
           (731793..734126) [2334 bp, 777 aa]
          Length = 777

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 274 LRKNLEAFASSNANSEVARNFAKATLEKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDL 333
           ++K  + F S +A+    +   K  +E+ +        + R+Q R+N+ +     ++Q  
Sbjct: 10  VKKGHKTFKSKHASKGALKRLHKGKVEQETAAGVKGVRVVRKQDRKNAAK----QLRQQK 65

Query: 334 ITSTNLLR 341
           I+ST+ LR
Sbjct: 66  ISSTSQLR 73

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,130,621
Number of extensions: 584535
Number of successful extensions: 1913
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1942
Number of HSP's successfully gapped: 32
Length of query: 468
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 363
Effective length of database: 12,961,219
Effective search space: 4704922497
Effective search space used: 4704922497
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)