Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR023C78076541440.0
Kwal_56.2308476277119530.0
YBR058C (UBP14)78178219080.0
CAGL0H10186g77878118700.0
KLLA0F18700g77077118260.0
Scas_718.49*82980117040.0
Sklu_1729.11361293256e-35
Scas_545.2*9183061463e-09
YMR223W (UBP8)4713771364e-08
KLLA0E10252g7962791321e-07
YDR069C (DOA4)9262571212e-06
YER144C (UBP5)8052551186e-06
Kwal_26.8090520641168e-06
YJL197W (UBP12)12542381179e-06
CAGL0K02563g586671169e-06
AFR627C12871141179e-06
YHL010C585651161e-05
Kwal_26.91514543631151e-05
CAGL0G05247g9472561151e-05
Scas_11.1*88441032e-05
CAGL0L01639g11471151142e-05
Kwal_34.162684491171132e-05
AFR007W8482771123e-05
KLLA0F25740g517731123e-05
Sklu_1544.24542471104e-05
Scas_618.5493521105e-05
Scas_609.97291731105e-05
Scas_692.394663641095e-05
CAGL0I06765g8872901105e-05
Scas_715.27171661106e-05
Scas_634.1412012101106e-05
Kwal_33.1362811601101062e-04
Kwal_14.20084242601052e-04
YFR010W (UBP6)499441052e-04
KLLA0C06974g4464011052e-04
AGR370W740541052e-04
YER098W (UBP9)7541751043e-04
AFR551W4694341025e-04
CAGL0I05522g7241841025e-04
KLLA0A10791g484441015e-04
AEL029W446441015e-04
AGR139C7891631017e-04
CAGL0K10494g495441007e-04
AGL079C506641008e-04
KLLA0E20449g697153990.001
KLLA0C03476g1252114990.001
CAGL0J11352g77152960.002
Scas_655.4875340960.002
Kwal_33.14430511256950.003
ABL145W749275940.004
KLLA0D08459g75052930.005
YIL156W (UBP7)1071128920.007
CAGL0A04477g77074920.008
YNL186W (UBP10)79252910.009
KLLA0E00979g774170890.018
Sklu_2425.8754153880.020
YBL067C (UBP13)68844880.024
CAGL0G02563g631107870.025
Sklu_1860.261574850.043
Scas_623.2*795260840.066
CAGL0K10252g126754840.078
Sklu_2079.379155830.091
CAGL0M13783g119652820.11
Kwal_55.19645970189800.22
Scas_698.71030109790.24
Sklu_1620.2772146780.33
Kwal_55.2126760436770.39
CAGL0M11198g46168770.39
CAGL0H05335g483154770.42
KLLA0A00396g1012126760.56
AGR389C77555760.60
CAGL0I07205g60345750.64
Scas_714.11126925750.76
Kwal_27.1084271120750.77
Kwal_55.21393123325741.0
Scas_695.748218731.2
Kwal_27.1144475721731.2
YOR138C67144721.6
Scas_664.17494201721.7
CAGL0H06721g1081253712.2
CAGL0I06600g81637712.4
KLLA0E02376g122022712.5
KLLA0C13970g375174692.9
KLLA0E10318g41451703.0
CAGL0F06523g76059703.0
ACL164C138920703.3
YOR124C (UBP2)127221703.3
Kwal_26.95981191135703.4
Kwal_14.1957444138693.8
KLLA0E08767g77121693.8
KLLA0A04433g35656684.0
AEL258W52675694.1
YNL022C49046685.0
Scas_555.691723685.4
AFR296C116921685.6
Scas_553.3*1025112678.0
Kwal_33.1386057843668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR023C
         (765 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH] (756967..7...  1600   0.0  
Kwal_56.23084                                                         756   0.0  
YBR058C (UBP14) [248] chr2 complement(353632..355977) Ubiquitin-...   739   0.0  
CAGL0H10186g complement(993354..995690) similar to sp|P38237 Sac...   724   0.0  
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...   707   0.0  
Scas_718.49*                                                          660   0.0  
Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement        129   6e-35
Scas_545.2*                                                            61   3e-09
YMR223W (UBP8) [4179] chr13 (716714..718129) Putative ubiquitin-...    57   4e-08
KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1...    55   1e-07
YDR069C (DOA4) [920] chr4 complement(584935..587715) Ubiquitin-s...    51   2e-06
YER144C (UBP5) [1573] chr5 complement(457801..460218) Ubiquitin-...    50   6e-06
Kwal_26.8090                                                           49   8e-06
YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific p...    50   9e-06
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    49   9e-06
AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH] (1572372.....    50   9e-06
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    49   1e-05
Kwal_26.9151                                                           49   1e-05
CAGL0G05247g complement(491024..493867) similar to sp|P32571 Sac...    49   1e-05
Scas_11.1*                                                             44   2e-05
CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces c...    49   2e-05
Kwal_34.16268                                                          48   2e-05
AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C (...    48   3e-05
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    48   3e-05
Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement          47   4e-05
Scas_618.5                                                             47   5e-05
Scas_609.9                                                             47   5e-05
Scas_692.39                                                            47   5e-05
CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces c...    47   5e-05
Scas_715.2                                                             47   6e-05
Scas_634.14                                                            47   6e-05
Kwal_33.13628                                                          45   2e-04
Kwal_14.2008                                                           45   2e-04
YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal...    45   2e-04
KLLA0C06974g complement(604344..605684) similar to sp|P50102 Sac...    45   2e-04
AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C (...    45   2e-04
YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal...    45   3e-04
AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH] complement(...    44   5e-04
CAGL0I05522g complement(521749..523923) some similarities with s...    44   5e-04
KLLA0A10791g join(complement(935718..935733),complement(934135.....    44   5e-04
AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH] complement(...    44   5e-04
AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH] (1010466..1...    44   7e-04
CAGL0K10494g 1022869..1024356 highly similar to sp|P43593 Saccha...    43   7e-04
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    43   8e-04
KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967 Saccha...    43   0.001
KLLA0C03476g 314815..318573 weakly similar to sp|P39538 Saccharo...    43   0.001
CAGL0J11352g complement(1101349..1103664) similar to sp|P53874 S...    42   0.002
Scas_655.4                                                             42   0.002
Kwal_33.14430                                                          41   0.003
ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH] complement(...    41   0.004
KLLA0D08459g complement(718046..720298) some similarities with s...    40   0.005
YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-spe...    40   0.007
CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces c...    40   0.008
YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-termin...    40   0.009
KLLA0E00979g 104991..107315 some similarities with sp|Q01477 Sac...    39   0.018
Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement       39   0.020
YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin C-...    39   0.024
CAGL0G02563g complement(235498..237393) weakly similar to sp|P36...    38   0.025
Sklu_1860.2 YMR304W, Contig c1860 839-2682                             37   0.043
Scas_623.2*                                                            37   0.066
CAGL0K10252g complement(997315..1001118) similar to sp|Q01476 Sa...    37   0.078
Sklu_2079.3 YDL122W, Contig c2079 1528-3903 reverse complement         37   0.091
CAGL0M13783g 1352648..1356238 similar to sp|P50101 Saccharomyces...    36   0.11 
Kwal_55.19645                                                          35   0.22 
Scas_698.7                                                             35   0.24 
Sklu_1620.2 YER151C, Contig c1620 788-3106                             35   0.33 
Kwal_55.21267                                                          34   0.39 
CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces...    34   0.39 
CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02...    34   0.42 
KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces cer...    34   0.56 
AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH] (1443891..1...    34   0.60 
CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces c...    33   0.64 
Scas_714.11                                                            33   0.76 
Kwal_27.10842                                                          33   0.77 
Kwal_55.21393                                                          33   1.0  
Scas_695.7                                                             33   1.2  
Kwal_27.11444                                                          33   1.2  
YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protei...    32   1.6  
Scas_664.17                                                            32   1.7  
CAGL0H06721g complement(667816..671061) similar to sp|P40453 Sac...    32   2.2  
CAGL0I06600g 639096..641546 similar to sp|Q01477 Saccharomyces c...    32   2.4  
KLLA0E02376g complement(218647..222309) gi|6136095|sp|O42726|UBP...    32   2.5  
KLLA0C13970g 1201452..1202579 similar to sp|P50101 Saccharomyces...    31   2.9  
KLLA0E10318g complement(911148..912392) similar to sp|P40087 Sac...    32   3.0  
CAGL0F06523g complement(642553..644835) similar to sp|P36009 Sac...    32   3.0  
ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..7196...    32   3.3  
YOR124C (UBP2) [4926] chr15 complement(554824..558642) Ubiquitin...    32   3.3  
Kwal_26.9598                                                           32   3.4  
Kwal_14.1957                                                           31   3.8  
KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces c...    31   3.8  
KLLA0A04433g complement(402462..403532) similar to sp|P32502 Sac...    31   4.0  
AEL258W [2248] [Homologous to ScYBR186W (PCH2) - SH] complement(...    31   4.1  
YNL022C (YNL022C) [4565] chr14 complement(591425..592897) Protei...    31   5.0  
Scas_555.6                                                             31   5.4  
AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C (...    31   5.6  
Scas_553.3*                                                            30   8.0  
Kwal_33.13860                                                          30   8.2  

>AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH]
           (756967..759309) [2343 bp, 780 aa]
          Length = 780

 Score = 1600 bits (4144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/765 (100%), Positives = 765/765 (100%)

Query: 1   MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNL 60
           MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNL
Sbjct: 1   MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNL 60

Query: 61  HQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSEEELYETVWSLVRINNA 120
           HQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSEEELYETVWSLVRINNA
Sbjct: 61  HQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSEEELYETVWSLVRINNA 120

Query: 121 CTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVPQDAM 180
           CTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVPQDAM
Sbjct: 121 CTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVPQDAM 180

Query: 181 PVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLT 240
           PVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLT
Sbjct: 181 PVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLT 240

Query: 241 SESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMR 300
           SESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMR
Sbjct: 241 SESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMR 300

Query: 301 DSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPS 360
           DSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPS
Sbjct: 301 DSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPS 360

Query: 361 TNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
           TNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL
Sbjct: 361 TNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420

Query: 421 DRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRL 480
           DRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRL
Sbjct: 421 DRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRL 480

Query: 481 HSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPG 540
           HSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPG
Sbjct: 481 HSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPG 540

Query: 541 LRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMGFSKNA 600
           LRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMGFSKNA
Sbjct: 541 LRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMGFSKNA 600

Query: 601 ALRALYNTGSEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVSMGLAER 660
           ALRALYNTGSEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVSMGLAER
Sbjct: 601 ALRALYNTGSEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVSMGLAER 660

Query: 661 HCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPPVSRDYGYPGDIPDYALSAVIC 720
           HCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPPVSRDYGYPGDIPDYALSAVIC
Sbjct: 661 HCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPPVSRDYGYPGDIPDYALSAVIC 720

Query: 721 HKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765
           HKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI
Sbjct: 721 HKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765

>Kwal_56.23084
          Length = 762

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/771 (49%), Positives = 528/771 (68%), Gaps = 33/771 (4%)

Query: 3   EVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQ 62
           E   QL+IPS IYKDDCGYCFET+ N +          H L+ICL CFQSFC  HV LHQ
Sbjct: 5   EDFTQLQIPSVIYKDDCGYCFETLHNES------QTTSHALHICLDCFQSFCKSHVPLHQ 58

Query: 63  QVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSEEELYETVWSLVRINNACT 122
            V ++    +HD  L V K ++ + ++  EK+LKLEV + SE+++Y+++W L++ N+   
Sbjct: 59  CVTKKEFARSHDFLLKVSKCKKAEQSQPIEKKLKLEVMERSEDDIYDSLWWLMKGND--- 115

Query: 123 ARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVPQDAMP- 181
             + +  + Q  +  V +K+ QI+  RS+ F+    +WQLEIK C H   F  P +    
Sbjct: 116 --IIADYKSQDFEADVQNKVAQILNARSNTFQRATESWQLEIKPCSHVTSFETPVNKSEC 173

Query: 182 VRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTS 241
           + + C +C L  NLWLCLHCGN+GCGR+QVGIEGHSHAL H++++   HPLAVKLGSL++
Sbjct: 174 LSDVCVECKLGSNLWLCLHCGNVGCGRQQVGIEGHSHALTHFEENPE-HPLAVKLGSLSN 232

Query: 242 ESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRD 301
            S DIYCY C+DEV F D +++  VL  +GI++  +VA+EK+LVELQVEQN +WDFQM D
Sbjct: 233 TSADIYCYFCDDEVQFQDLDKWHNVLEHWGINIRDKVAQEKSLVELQVEQNASWDFQMVD 292

Query: 302 SGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPST 361
           S       + +SK YGCGL+NLGNSCY+N+V+QVLFNGGV  W+LD LGDFP DVV+ S+
Sbjct: 293 SQGHELHHLRSSKRYGCGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSS 352

Query: 362 NLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD 421
           NLKCQLIKLRNAL+ +PE Y +GVKP++ K C+G  +EEFSSGRQQDA+EF +Y ID LD
Sbjct: 353 NLKCQLIKLRNALRTNPEMYPNGVKPSTFKDCVGGTHEEFSSGRQQDALEFFSYLIDLLD 412

Query: 422 RKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLH 481
           +K+F++ S  +PNDLM+F ++DR+ECT C  VKY +QV + LQ+PL +S+DPQ L+  L 
Sbjct: 413 KKLFNR-SEFHPNDLMKFSLQDRIECTSCHGVKYVTQVSDYLQVPLPESDDPQMLITNLE 471

Query: 482 SYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPGL 541
            Y  GE+++  CP+C+ +T A K+S  +T P TL+++  RIKL NW P KTS ++ +PG+
Sbjct: 472 RYLQGETVEFSCPKCNRVTEAVKSSGFQTYPETLVVSCSRIKLVNWVPTKTSQEVTMPGI 531

Query: 542 --RDEKRLKLSQFKAHG-RQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMGFSK 598
              D   L+L   K++G     E +    P+D S  P     F      V  ++ MGF++
Sbjct: 532 DAADTSLLQLGHLKSNGFNSESEHLL---PEDES--PG----FKAKPHCVSQLMEMGFTE 582

Query: 599 NAALRALYNTG-SEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVSMGL 657
           NA++RALY+TG S+ + A+NW+F+H+ED ++N  F  P    + + V+  AL+SMVSMGL
Sbjct: 583 NASIRALYHTGNSDTDSAMNWLFQHVEDDDINELFVAPNAPSKPSEVNPQALESMVSMGL 642

Query: 658 AERHCRKALILNDGDVTRSVEWVFNNADNLDDD--DTQESIDPPVSRDYGYPGDI-PDYA 714
               C KAL+L+ G+V+ SVEWVFNNADN DD   +TQ+ +D   S  YG   +   ++ 
Sbjct: 643 NPDLCHKALVLHKGNVSASVEWVFNNADNTDDTLLETQDGLD---SNSYGISDETKANFR 699

Query: 715 LSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765
           LSAVICHKG+SV SGHYVAFIKK V+ E KWVLYNDEK++      N+ EI
Sbjct: 700 LSAVICHKGSSVHSGHYVAFIKKDVENETKWVLYNDEKMVVADDPSNITEI 750

>YBR058C (UBP14) [248] chr2 complement(353632..355977)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2346 bp, 781 aa]
          Length = 781

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/782 (49%), Positives = 532/782 (68%), Gaps = 36/782 (4%)

Query: 4   VVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQQ 63
           V++ + +P+ + KD+C YCFE+  N        A P+H LNICL CFQ+ C+ HV LH +
Sbjct: 5   VLENVNVPAVVSKDECIYCFESPYNEPLALN--ASPKHSLNICLNCFQATCNRHVPLHIR 62

Query: 64  VVRRVQQATHDLYLNVYKIERPK----ATESAEKRLKLEVQDLSEEELYETVWSLVRINN 119
           V        H  YL + K+E+PK       +  K++KL+V + SE++ + T+WSL R N 
Sbjct: 63  VTEYACDTIHSNYLTIAKVEKPKQENVEENNNNKKIKLQVIETSEDDTHNTIWSLQRFNG 122

Query: 120 ACTARLGSSKQKQK-MDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVP-- 176
               R   SK     + +T + K+E+I++ +S DF+D   +W LEI  CPH+E F +P  
Sbjct: 123 ENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQIPSK 182

Query: 177 -QDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVK 235
            ++ + + + C  CDL +NLWLCLHCGNIGCGREQ+GI+GHSHAL HY+ S NNHPLA+K
Sbjct: 183 PENTVNLNQ-CSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYR-SNNNHPLAIK 240

Query: 236 LGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNW 295
           LGSL+S + D+YCY+C+DE  FPD     + L  +GI+++ ++A EKTLV+LQVEQN NW
Sbjct: 241 LGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQNENW 300

Query: 296 DFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGD-FPR 354
            F+M DS  +  +K+ ASK YGCGLINLGNSCYLNSV+Q L NGGV +W+LD LG  FP 
Sbjct: 301 QFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPL 360

Query: 355 DVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLT 414
           DVV+P  NLKCQ IKL NA+K  PE Y +G+KP + KKCIG++++EFSS RQQDAMEFLT
Sbjct: 361 DVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAMEFLT 420

Query: 415 YFIDKLDRKVFSKASSS--NPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSND 472
           + +D LD+K FS +SS   NPNDL+RFM+EDRL+C  C  VKYS +  E +QIPL ++++
Sbjct: 421 FLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDE 480

Query: 473 PQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKT 532
           PQ +++R+ +YF G++++  C  C E   A K    K+ P TL++NPIRI+LQNW P+KT
Sbjct: 481 PQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIPVKT 540

Query: 533 SNQLFVPGLRD-EKRLKLSQFKAHGRQP-GEKIFEDSPDDNSNVPASAISFNPDEDKVIS 590
           SN+L +PGL D +  L +S + + G  P  E +  D  ++ S       SF P++  +  
Sbjct: 541 SNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRS-------SFTPNQCSISQ 593

Query: 591 IISMGFSKNAALRALYNTGSE-VERALNWIFEHMEDPELNAEFSVPGT--KKQAAVVDQG 647
           +I MGF++NA++RAL+NTG++  E A+NW+F+HM+DP+LN  F  P    KK    VD+ 
Sbjct: 594 LIEMGFTQNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEV 653

Query: 648 ALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPP-----VSR 702
           +L SM+SMGL    CRKALILN+GDV RSVEWVFN   N+DDD T    + P       +
Sbjct: 654 SLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFN---NMDDDGTFPEPEVPNEEQQQKK 710

Query: 703 DYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENL 762
           D GY    P YAL+AVICHKGNSV SGHYV FI+K V  + KWVLYNDEKL+A    E++
Sbjct: 711 DLGYSTAKP-YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIEDM 769

Query: 763 QE 764
           ++
Sbjct: 770 KK 771

>CAGL0H10186g complement(993354..995690) similar to sp|P38237
           Saccharomyces cerevisiae YBR058c UBP14 ubiquitin
           specific protease, hypothetical start
          Length = 778

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/781 (48%), Positives = 520/781 (66%), Gaps = 39/781 (4%)

Query: 3   EVVKQLKIPSTIYKDDCGYCFETMINP--------NFGDGGPAEPEHQLNICLGCFQSFC 54
           ++++ L++P+ I K++C YCFET  NP           D   A   H LNICL CFQ+ C
Sbjct: 4   QILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDSTKAA--HTLNICLVCFQAVC 61

Query: 55  HEHVNLHQQVVRRVQQATHDLYLNVYKIERPKATESAE--------KRLKLEVQDLSEEE 106
             H   H +V +    A H  YLNV K+ + +     E        K++KL+V + S +E
Sbjct: 62  PRHTPFHIEVGKH-NDAQHFDYLNVAKVRKYEDMLDGEEDEDTNSSKKIKLQVIEKSRDE 120

Query: 107 LYETVWSLVRINNACTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKA 166
            Y  VWSL+   ++ ++     K  +  +     K++ ++  +S D  D A  W+L+IK 
Sbjct: 121 DYNDVWSLLHFESSQSSPHIVLKSNE-ANAAQTEKVDHVLNAKSQDLADQANVWELDIKP 179

Query: 167 CPHSEQFVVPQ-DAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQ 225
           C H + F        P+   C  C+L +NLW+CL+CGN+GCGREQVGIEGHSHAL+H++ 
Sbjct: 180 CKHVDSFSFANVQEKPLETHCSSCELTQNLWICLYCGNLGCGREQVGIEGHSHALEHFK- 238

Query: 226 SENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLV 285
           S+N+H LA+KLGSL+S S D+YCY+C+DEV F D       LAK+GID++ + A EKTLV
Sbjct: 239 SKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQVLKTTLAKYGIDMDKKSADEKTLV 298

Query: 286 ELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWN 345
           ELQVEQNMNWDF+M D   +  K++ AS+E GCGLINLGNSCYLNS +Q LFNGGVK W+
Sbjct: 299 ELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLINLGNSCYLNSTLQCLFNGGVKGWD 358

Query: 346 LDMLGDFPR-DVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSG 404
            DMLG+ P  +VV+P+ NLK QL KLR ALK  P  Y+ G++P S KKCIG  +EEFSSG
Sbjct: 359 TDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKKCIGGSHEEFSSG 418

Query: 405 RQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQ 464
           RQQDA+EF TYF+D+LD+K+F K S  NPNDLM+FM+EDRL+C +C  VKYS++   ++Q
Sbjct: 419 RQQDALEFFTYFVDELDKKLF-KNSDYNPNDLMKFMMEDRLQCQECHGVKYSTETSNVIQ 477

Query: 465 IPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKL 524
           +PL +SND Q L +R+++YF+GE ++  CP C ++  A K   ++T P TL+INPIRIK+
Sbjct: 478 LPLQESNDAQDLEERINAYFSGEVIEFKCPNCKKMVNAVKKPAMRTFPDTLVINPIRIKI 537

Query: 525 QNWTPIKTSNQLFVPGLRDEKR-LKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNP 583
           +NWTP+KTSN L +PGL      L+L+Q+K +G Q   K  E   +D+++     I F  
Sbjct: 538 ENWTPVKTSNLLTIPGLETPTEVLELTQYKGNGLQ---KDTETQLNDDND----EIQFEV 590

Query: 584 DEDKVISIISMGFSKNAALRALYNTGS-EVERALNWIFEHMEDPELNAEFSVPGTKKQAA 642
           +E  V  ++ MGF++NA +RALY+TG+ + E A+NW+F H+ED ++NAEF  P  KK   
Sbjct: 591 NETFVNQLMEMGFTENACVRALYHTGNKDPELAMNWLFGHIEDADVNAEFIPP--KKAKN 648

Query: 643 VVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPP-VS 701
            V+   +  MV MGL  + CRKALILN+ DVTRSV+WVFNN D  DD + +E  +    S
Sbjct: 649 DVNPEHISMMVGMGLDPKLCRKALILNNHDVTRSVDWVFNNMD--DDGEIEELKEQSDTS 706

Query: 702 RDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNEN 761
           + YG+    P Y LSA+ICHKGNSV SGHYVAFI+K VDG+P WVLYNDEK++     E 
Sbjct: 707 KTYGHHDAKP-YELSAIICHKGNSVHSGHYVAFIRKMVDGKPTWVLYNDEKIVVSNNFEE 765

Query: 762 L 762
           +
Sbjct: 766 M 766

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/771 (47%), Positives = 501/771 (64%), Gaps = 35/771 (4%)

Query: 8   LKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQQVVRR 67
           + +P  I  DDC YCFETM N + G       EH L ICL CFQSF  EH  LHQ+VV  
Sbjct: 9   INVPRVIDTDDCVYCFETMKNKDEG------REHSLFICLRCFQSFSEEHWELHQEVVLS 62

Query: 68  VQQATHDLYLNVYKIERPK------ATESAEKRLKLEVQDLSEEELYETVWSLVRINNAC 121
              +THDLYL V+K+ +PK       T   EK+LKLEV+D++E++LY+T W L  + +  
Sbjct: 63  ETGSTHDLYLRVFKVLKPKQEREEAGTPPLEKKLKLEVKDVNEDDLYDTHWLLGSVEHGE 122

Query: 122 TARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVP---QD 178
                 S     +      K+ +I++T+SS ++DM+ TW LE+K+CPH + F +    + 
Sbjct: 123 LL----SSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNLEKR 178

Query: 179 AMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGS 238
              + ++C DC L  NLWLCLHCGN+ CGREQVGIEG+SHALKHY+ S + H LA+KLGS
Sbjct: 179 EGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYE-STDGHALAIKLGS 237

Query: 239 LTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQ 298
           LT+++ DIYCYSC+++V F    +   +L  + +++  + +KEKTLVELQVEQ++ WDFQ
Sbjct: 238 LTADAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAK-SKEKTLVELQVEQSLKWDFQ 296

Query: 299 MRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVF 358
           M DS  +  K +    EYG GL+NLGNSCYLNSV+QVL NGG+++WNLD LG FP DVV+
Sbjct: 297 MVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVY 356

Query: 359 PSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFID 418
           P TNL CQLIK+RNA+ +   +Y  G+KP + KK IG  +EEFSSGRQQD++EF +Y  D
Sbjct: 357 PRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSD 416

Query: 419 KLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMD 478
           KLDR++F K +++NPNDL RF ++D+++C  C  VK+  QV E++Q+PL   +  Q L+D
Sbjct: 417 KLDREIF-KNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLID 475

Query: 479 RLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFV 538
           RL+ YF+GE ++  C    +I  A+K     + P TL+INPIRI+L NW P KTS Q+ V
Sbjct: 476 RLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVV 535

Query: 539 PGLRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMGFSK 598
           PG+RD+  L +S FKA G   GE++ E+   D         SF  +E  +  +  MGFS+
Sbjct: 536 PGVRDDALLDMSPFKATGICEGEEVEEEEESD---------SFQFNELFLGQLEQMGFSR 586

Query: 599 NAALRALYNTG-SEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVSMGL 657
           NA  RAL+ TG S+   A  W+F+HMEDP LN  F    +      VD  AL+SM +MGL
Sbjct: 587 NATKRALFETGNSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTAMGL 646

Query: 658 AERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPPVSRDYGYPGD---IPDYA 714
             + CRKALIL +GDV  SVEWVF++ D+  +    E       + +G P        Y 
Sbjct: 647 DSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSIASAKYK 706

Query: 715 LSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765
           L+AVICHKGNSV SGHYVAFIKK V+G+ +WVLYNDEK++      N ++I
Sbjct: 707 LTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDI 757

>Scas_718.49*
          Length = 829

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/801 (44%), Positives = 505/801 (63%), Gaps = 59/801 (7%)

Query: 3   EVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQ 62
           +V   L +P++I KD C YCFE++ N            H L+IC+ CFQ+ C  H  LH 
Sbjct: 38  QVFTNLAVPTSIAKDQCIYCFESLYN---NITATFNTTHSLDICISCFQATCPNHSLLHY 94

Query: 63  QVVRRVQQATHDLYLNVYKIERPKAT---------ESAEKRLKLEVQDLSEEELYETVWS 113
           +V +    + H  YLN+ K ERP ++         ES  K++KL++   SE+ELYET WS
Sbjct: 95  KVTQHSSDSPHGHYLNLSKWERPASSPSSASMNNDESNNKKIKLQIDTKSEDELYETKWS 154

Query: 114 LVRINNACT---ARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHS 170
             +I+   +       ++   + + +  ++K+  IIR +S    +   +W+LE+ +C H+
Sbjct: 155 FQKISTDGSLLEPLFDNNTNTETLSSNTLNKINDIIRAKSKTLVEETQSWELELNSCSHT 214

Query: 171 ------EQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQ 224
                 E  + P  A    + C DCDLD NLWLCLHCGN+GCGR QVGI+G+SHAL H+ 
Sbjct: 215 RSLQSGESSISPTPA--ALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFD 272

Query: 225 QSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSA--VLAKFGIDLEGQVAKEK 282
            +  +HPLA+KLGSL+ ES+D+YCY CNDEV F     F A  +L  + ID+  ++  EK
Sbjct: 273 -THKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEK 331

Query: 283 TLVELQVEQNMNWDFQMRDS-GNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGV 341
           +L+ELQVEQNMNW+F+M DS GNE  + +  SKE GCG INLGNSCYLNSV+Q LFN GV
Sbjct: 332 SLIELQVEQNMNWNFKMVDSHGNELIQ-LPPSKELGCGFINLGNSCYLNSVLQCLFNDGV 390

Query: 342 KDWNL---DMLG-DFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGED 397
            +W     +++G +FP D V+P+TNLKCQLIK+ NA K++PE Y  G+KP S K  +G+ 
Sbjct: 391 PNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQS 450

Query: 398 NEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSS 457
           N+EF S  QQDA EFLT+ +++L++ +F K   +NPN++M+F++ED+++C  C +VKYS 
Sbjct: 451 NKEFKSNNQQDATEFLTFLLEQLEKTLFKK--DNNPNNIMKFIMEDKIQCQSCGNVKYSY 508

Query: 458 QVCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLI 517
           +  E +Q+PL  +N+PQ L++ L ++FNGE++D  CP C +  VATK    KT+P TL+I
Sbjct: 509 EPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVI 568

Query: 518 NPIRIKL--QNWTPIKTSNQLFVPGLRDEKR--LKLSQFKAHGRQPG-EKIF-EDSPDDN 571
           +P RI    + WTPIKTS +L +P L D     L LS F + G  P  E +F ED  +DN
Sbjct: 569 SPHRISFEKETWTPIKTSAELTLPNLDDSSNELLDLSSFISKGFDPTKETLFPEDVNEDN 628

Query: 572 SNVPASAISFNPDEDKVISIISMGFSKNAALRALYNTG--SEVERALNWIFEHMEDPELN 629
           +       +F P+E  V  ++ MGF++N A +ALY+TG  ++ E AL W+ +HM+D +  
Sbjct: 629 N-------TFKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQ 681

Query: 630 AEFSVPGTKKQ---AAVVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADN 686
            EF  P   K    AA VDQ +L +M+ MGL E+   KAL+LN GD+  S+EWVFNN D 
Sbjct: 682 DEFVPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPD- 740

Query: 687 LDDDDTQESIDPPVSRDYGYPG--DIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPK 744
            D+ +      P    +    G  D   Y L+AV+CHKGNS  SGHYVAFI+K +D E K
Sbjct: 741 -DNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELK 799

Query: 745 WVLYNDEKLMAVGGNENLQEI 765
           WVLYNDEK++    ++N+ EI
Sbjct: 800 WVLYNDEKIVV---SDNIDEI 817

>Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement
          Length = 136

 Score =  129 bits (325), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (65%), Gaps = 7/129 (5%)

Query: 1   MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNL 60
           + E  K L +PS+IYKDDCGYCFETM N +          H LNICL CFQSFC +HV+L
Sbjct: 3   LVEQFKNLAVPSSIYKDDCGYCFETMYNSD------DSTNHHLNICLSCFQSFCVDHVHL 56

Query: 61  HQQVVRRVQQATHDLYLNVYKIERPKATES-AEKRLKLEVQDLSEEELYETVWSLVRINN 119
           HQ +V +    +HDLYL + K  +P+  E   EK+LKLEV++ SE+E+YET W +V+I N
Sbjct: 57  HQSIVGKELSESHDLYLKLKKTRKPEVEEQRMEKKLKLEVKEQSEDEIYETKWWVVQIQN 116

Query: 120 ACTARLGSS 128
             +  L SS
Sbjct: 117 GSSKLLISS 125

>Scas_545.2*
          Length = 918

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 118/306 (38%), Gaps = 69/306 (22%)

Query: 315 EYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQ------LI 368
           ++  GL N+GNSCYLN ++Q L   G  +     L +F    +  ++ L  +        
Sbjct: 556 DFIVGLQNIGNSCYLNCIIQCLL--GTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFA 613

Query: 369 KLRNALKIH--PEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDR---- 422
           +L + +  H  P+   + V+PA  K  +G  N  F +  QQD  EF  + +D L      
Sbjct: 614 RLIHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQ 673

Query: 423 -------KVFSKASSSNPNDLM----------RFMVED--------------RLECTKCE 451
                  K  S A+  N   L           RF+  D              RL+C  C+
Sbjct: 674 CGSNPPLKELSSAAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQCEVCK 733

Query: 452 HVKYSSQVCEILQIPL--LDSNDPQFLMDRLHSYFNGESLDIH----CPQCSEITVATKN 505
           H   + Q   +L +P+  +       ++D    +   E LD      CP C +   +TK 
Sbjct: 734 HTSTTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWLCPTCKKKQRSTKK 793

Query: 506 SMLKTAPATLLINPIRI--------KLQNWTPIKTSNQLFV--------PGLRDE--KRL 547
             +   P  L+I+  R            ++  I    Q +V        PG+RDE  KR 
Sbjct: 794 LTITRLPRNLIIHLKRFDNNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDELPKRG 853

Query: 548 KLSQFK 553
           ++  FK
Sbjct: 854 QIPPFK 859

>YMR223W (UBP8) [4179] chr13 (716714..718129) Putative
           ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [1416 bp, 471 aa]
          Length = 471

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 148/377 (39%), Gaps = 73/377 (19%)

Query: 175 VPQDAMPVRETCGDCDLDRN--LWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPL 232
           VP++       CG C    +   ++CL CG  GC         HSH L H +Q  +    
Sbjct: 35  VPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWN-------HSHFLSHSKQIGH---- 83

Query: 233 AVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQN 292
              +  + S +  ++C+ C D +   D     A+LAK+  D+       KT+V       
Sbjct: 84  ---IFGINSNNGLLFCFKCEDYIGNIDLIN-DAILAKYWDDV-----CTKTMVP------ 128

Query: 293 MNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLF-NGGVKDWNLDMLGD 351
                + RD  +              GLIN+G++C+++S++Q L  N      ++  +  
Sbjct: 129 ---SMERRDGLS--------------GLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHS 171

Query: 352 FPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKK---------CIGEDNEEFS 402
               V  P     C L K+ + L       Q      S  +         C  + N+  +
Sbjct: 172 NNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLA 231

Query: 403 SGRQQDAMEFLTYFIDKL---------DRKVFSKASSSNPNDLMRFMVEDRLE----CTK 449
              QQDA EF  + I+++         + K  S+A++     ++  + E  LE    C  
Sbjct: 232 GYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPG 291

Query: 450 CEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESL---DIHCPQCSEITVATKNS 506
           C++    + +   L +  LD  D + L + L S+   E L   + HC +C+    A K  
Sbjct: 292 CQN-NSKTTIDPFLDLS-LDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQL 349

Query: 507 MLKTAPATLLINPIRIK 523
            +   P+ L++   R +
Sbjct: 350 GIHKLPSVLVLQLKRFE 366

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 6/59 (10%)

Query: 708 GDIPD--YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           G +PD  Y L  ++ HKG +V  GHY+AF K  + G  +W  +ND  + ++   E L+E
Sbjct: 404 GKVPDIIYELIGIVSHKG-TVNEGHYIAFCK--ISG-GQWFKFNDSMVSSISQEEVLKE 458

>KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1
           Kluyveromyces lactis deubiquitinating enzyme,
           hypothetical start
          Length = 796

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 102/279 (36%), Gaps = 65/279 (23%)

Query: 315 EYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNAL 374
           ++  GL+NLGNSCYLN ++Q L   G  + +   L +  R  V  ++ L  + +      
Sbjct: 429 DFAIGLVNLGNSCYLNCIIQCLL--GCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFS 486

Query: 375 KIHPEKYQHG--------------VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
           ++  + YQ G              V P   K   G  N  F   +QQD  EF  + +D L
Sbjct: 487 QLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFKGKQQQDCQEFCQFLLDGL 546

Query: 421 DRKVFSKASSSNPN-------------------------------------DLMRFMVED 443
              +      +NP                                      DL +     
Sbjct: 547 HEDL--NQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTDFSVIVDLFQGQYAS 604

Query: 444 RLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLD----IHCPQCSEI 499
           +L C  C H   + Q   +L +P+  +     + D    +   E+L+     +CP C + 
Sbjct: 605 QLRCKICAHTSTTYQAFSVLSVPVPRARSCT-IYDCFKEFTKLETLEKDELWYCPYCKQR 663

Query: 500 TVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFV 538
             +TK  ++   P  L+I+     L+ +  +   N +FV
Sbjct: 664 QPSTKQIIITRLPNNLIIH-----LKRFDNMMNKNNVFV 697

>YDR069C (DOA4) [920] chr4 complement(584935..587715)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), involved in recycling ubiquitin from protein
           substrates targeted to the proteasome and the vacuole
           [2781 bp, 926 aa]
          Length = 926

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 94/257 (36%), Gaps = 51/257 (19%)

Query: 315 EYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNAL 374
           ++  GL NLGNSCY+N ++Q +   G  +     L D     +  ++ L  + I  +   
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCIL--GTHELTQIFLDDSYAKHININSKLGSKGILAKYFA 616

Query: 375 KIHPEKYQH--------GVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDR---- 422
           ++    Y+          + P   K   G  N  F +  QQD  EF  + +D L      
Sbjct: 617 RLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQ 676

Query: 423 -------KVFSKASSSNPNDLM----------RFMVED--------------RLECTKCE 451
                  K  S+ + +    L           RF+  D              RL+C  C 
Sbjct: 677 CGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVCS 736

Query: 452 HVKYSSQVCEILQIPLLDSNDPQFLM--DRLHSYFNGESLDIH----CPQCSEITVATKN 505
           H   + Q   +L IP+   N    +   D    +   E+L++     CP C +   +TK 
Sbjct: 737 HTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQ 796

Query: 506 SMLKTAPATLLINPIRI 522
             +   P  L+++  R 
Sbjct: 797 LTITRLPRNLIVHLKRF 813

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 694 ESIDPPVSRDYGYP--GDIP--DYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYN 749
           + + PP   D   P  G IP   Y L  V CH G ++  GHY A++KK +  +  W+ ++
Sbjct: 841 DGVFPPGVNDDELPIRGQIPPFKYELYGVACHFG-TLYGGHYTAYVKKGL--KKGWLYFD 897

Query: 750 DEKLMAV 756
           D K   V
Sbjct: 898 DTKYKPV 904

>YER144C (UBP5) [1573] chr5 complement(457801..460218)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), homologous to Doa4p and human Tre-2 [2418
           bp, 805 aa]
          Length = 805

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 96/255 (37%), Gaps = 63/255 (24%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVV-FPSTNLKCQLIKLRNALKIH 377
           GL N+GN CY+N ++Q L   G  D     L +   + + F S+     L+    A+ ++
Sbjct: 447 GLENIGNCCYMNCILQCLV--GTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVN 504

Query: 378 PEKYQHG-----------VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFS 426
              ++HG           V+    KK  G  N  +S   QQD  EF  + +D L   +  
Sbjct: 505 -NMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 427 KASSSNPNDLM---------------------RFMVED--------------RLECTKCE 451
             S  +   L                      RF++ D              RL+C  CE
Sbjct: 564 NGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQVCE 623

Query: 452 HVKYSSQVCEILQIPLLDSNDPQF----LMDRLHSYFNGESLDI----HCPQCSEITVAT 503
           H   + Q   +L +P+     P+     ++D    +   E L +     CP+C +   +T
Sbjct: 624 HTSTTYQTFSVLSVPV-----PRVKTCNILDCFREFTKCERLGVDEQWSCPKCLKKQPST 678

Query: 504 KNSMLKTAPATLLIN 518
           K   +   P  L+IN
Sbjct: 679 KQLKITRLPKKLIIN 693

>Kwal_26.8090
          Length = 520

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 186 CGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESND 245
           C  C ++ NLW+CL CGNIGCGR         HA++H++++ +   + V    +   + D
Sbjct: 285 CSTCGVNENLWICLICGNIGCGRYNF-----KHAVQHFKETAHFFAMDVATQRVWDYAGD 339

Query: 246 IYCY 249
            Y +
Sbjct: 340 NYVH 343

>YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific
           protease, ubiquitin C-terminal hydrolase [3765 bp, 1254
           aa]
          Length = 1254

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 94/238 (39%), Gaps = 57/238 (23%)

Query: 289 VEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQ-----------VLF 337
           +E N +W        N F            GL+NLGN+CY+NS +Q            L+
Sbjct: 341 IEGNHHW------PSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLY 394

Query: 338 NGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGED 397
           +G   + N +    +   V    ++L  +L + R ++     +      P+  K  IG  
Sbjct: 395 DGYEDEINEENPLGYHGYVARAFSDLVQKLFQNRMSIM----QRNAAFPPSMFKSTIGHF 450

Query: 398 NEEFSSGRQQDAMEFLTYFIDKLD-------RKVFSKASSSNPND------LMRFMVEDR 444
           N  FS   QQD+ EFL + +D L        +K +++  S +P D      +++ + +D 
Sbjct: 451 NSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPGDDVNDWNVVKKLADDT 510

Query: 445 LECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVA 502
            E     H+K +  V   L + +  S                    ++CP+C  +++ 
Sbjct: 511 WEM----HLKRNCSVITDLFVGMYKST-------------------LYCPECQNVSIT 545

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 183 RETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSE 242
           +E C +C    NLW+CL CG++GCGR         HA+KH++++ +   +  K   +   
Sbjct: 304 KEKCSECGSSENLWICLICGHVGCGR-----YNSRHAIKHFEETSHCFAMDSKTDRVWDY 358

Query: 243 SNDIYCY 249
           + D Y +
Sbjct: 359 AGDNYVH 365

>AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH]
           (1572372..1576235) [3864 bp, 1287 aa]
          Length = 1287

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 18/114 (15%)

Query: 318 CGLINLGNSCYLNSVVQ-----------VLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQ 366
            GL NLGN+CY+NS +Q            L+NG  K+ N++        + +   ++   
Sbjct: 346 IGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQA 405

Query: 367 LIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
           L   R++             P + K  IG  N  FS  +QQD+ EFL + +D L
Sbjct: 406 LFGKRHSAAT-------SYSPRNFKNTIGHLNSMFSGYQQQDSQEFLAFLLDGL 452

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 185 TCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESN 244
           TCG  D   NLW+CL CGN+GCGR         HA+KHY+++ +   + ++   +   + 
Sbjct: 303 TCGSTD---NLWICLICGNVGCGR-----YNSKHAIKHYEETLHCFAMDIRTQRVWDYAG 354

Query: 245 DIYCY 249
           D Y +
Sbjct: 355 DNYVH 359

>Kwal_26.9151
          Length = 454

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 75/363 (20%), Positives = 143/363 (39%), Gaps = 66/363 (18%)

Query: 196 WLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESNDIYCYSCNDEV 255
           ++CL CG  GC  +Q       H   H ++       A  +  + S +  ++C+ C + V
Sbjct: 57  FMCLQCGVCGCWNKQ-------HFALHSKK-------AGHIFGVNSSNGLLFCFKCVEYV 102

Query: 256 AFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKE 315
                               G      +++      N NWD    D   + +  +   ++
Sbjct: 103 T-------------------GNEMLTNSML------NKNWD----DISVKSSVPLAKGRD 133

Query: 316 YGCGLINLGNSCYLNSVVQVLF-NGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRN-- 372
             CGL+N+G++C+++S++Q L  N  V    ++ +     D+   ++   C L ++ +  
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQVHFSRCDIQDSASCFSCALDRIVSNF 193

Query: 373 ---ALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL--DRKVFSK 427
              A        Q G     +  C  + N   +   QQDA EF  +F+++L  D    + 
Sbjct: 194 YGPAADASFTSQQKGF--VDLLLCSWKINRNLAGYSQQDAHEFWQFFLNQLHADHVRVTG 251

Query: 428 ASSSNPNDL-------MRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRL 480
             SS P +         +  +   + CT C H   +     ++ + L   N  + L+D L
Sbjct: 252 KKSSKPEECNCISHSAFQGSLRSSILCTDC-HDGSNITFDPMMDLSLEIKNKNK-LVDCL 309

Query: 481 HSYFNGESL---DIHCPQCSEITVATKNSMLKTAPATLLINPIRIK-LQNWTPIKTSNQL 536
            S+  GE+L   +  CP C  +    K   +   P  L++   R + L N   +K + ++
Sbjct: 310 KSFHEGETLTDFNHRCPNCGSVQNPIKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKI 369

Query: 537 FVP 539
             P
Sbjct: 370 AYP 372

>CAGL0G05247g complement(491024..493867) similar to sp|P32571
           Saccharomyces cerevisiae YDR069c DOA4 ubiquitin-specific
           protease, hypothetical start
          Length = 947

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 96/256 (37%), Gaps = 51/256 (19%)

Query: 316 YGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALK 375
           +  GL N+GNSCY+N ++Q +   G  + +   L +     +  ++ L  + +  R   +
Sbjct: 581 FTVGLENMGNSCYMNCILQCIM--GTNELSQIFLNNSYEKHININSKLGSKGVLARYFAR 638

Query: 376 I----HPEKYQHG-----VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL------ 420
           +    H   Y        V+P   +  I   N  F +  QQD  EF  + +D L      
Sbjct: 639 LAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLNQ 698

Query: 421 ----------------DRKVFSKASSSNPN-------------DLMRFMVEDRLECTKCE 451
                            R++ S   +S+               DL +     RL+C+ C 
Sbjct: 699 CGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVIIDLFQGQYASRLKCSVCS 758

Query: 452 HVKYSSQVCEILQIPLLDSNDPQF-LMDRLHSYFNGESLD----IHCPQCSEITVATKNS 506
           +   + Q   +L +PL         LMD  + +   E L+     +CP C +   +TK  
Sbjct: 759 NTSTTYQPFSVLSVPLPTGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPSTKQL 818

Query: 507 MLKTAPATLLINPIRI 522
            +   P  L+I+  R 
Sbjct: 819 TITRLPRNLIIHLKRF 834

>Scas_11.1*
          Length = 88

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  VI H+G + +SGHY AFI+  +D E KW  +ND+K+  +
Sbjct: 19  YDLIGVITHQGANSESGHYQAFIRDEMD-ENKWYKFNDDKVSVI 61

>CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces
           cerevisiae YJL197w UBP12 ubiquitin C-terminal hydrolase,
           hypothetical start
          Length = 1147

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 18/115 (15%)

Query: 318 CGLINLGNSCYLNSVVQVL----------FNGGV-KDWNLDMLGDFPRDVVFPSTNLKCQ 366
            GL NLGN+CY+NS +Q L          F GG  ++ NLD    +   V     NL   
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNL--- 345

Query: 367 LIKLRNALKIHPEKYQH-GVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
              ++N    H  + Q+    P   K  +G+ N  F+   QQD+ EFL + +D L
Sbjct: 346 ---IQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYMQQDSQEFLAFLLDSL 397

>Kwal_34.16268
          Length = 449

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 14/117 (11%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLG-DFPRDVVFPSTNLKCQLI-KLRNALK 375
            GL NLGN+CY+NS +Q L+   +K    ++L    PR+   PS     QL+ +LR   +
Sbjct: 60  VGLKNLGNTCYMNSTLQALYQ--IKPLRDEVLNYKVPREK--PSEEQHHQLVSELRRCFQ 115

Query: 376 IHPEKYQHGVKP----ASVKKC---IGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVF 425
              +K Q  V P    A ++KC     E ++E    +QQDA E  T   + L R VF
Sbjct: 116 QLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIFNSL-RVVF 171

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  VI H+G + +SGHY +FI+  VD E KW  +ND+K+  +
Sbjct: 380 YNLIGVITHQGANSESGHYQSFIRDEVD-ENKWYRFNDDKVSII 422

>AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C
           (UBP5) - SH] complement(448632..451178) [2547 bp, 848
           aa]
          Length = 848

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/277 (20%), Positives = 105/277 (37%), Gaps = 64/277 (23%)

Query: 316 YGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALK 375
           +  GL+N GNSCY++ ++Q L   G ++     L +  ++ +  ++ L  + +  R   +
Sbjct: 486 FSVGLVNCGNSCYMSCIIQCLL--GTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQ 543

Query: 376 IHPEKYQHG-------------VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDR 422
           +  + YQ+G             V P   K   G  N  F    QQD  EF  + +D L  
Sbjct: 544 LIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDGLHE 603

Query: 423 KVFSKASSSNP------------NDLM-----------RFMVED--------------RL 445
            +      +NP             ++M           R++  D              +L
Sbjct: 604 DL--NQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQL 661

Query: 446 ECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLD----IHCPQCSEITV 501
           +C  C+    + Q   +L +P + S     L D    +   E+L+      CP C +   
Sbjct: 662 QCKVCQRTSTTYQPFSVLSVP-VPSTRTCTLTDCFTEFTKIETLEQEEQWSCPSCKKRQP 720

Query: 502 ATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFV 538
           +TK   +   P  L+I+     L+ +  +   N +FV
Sbjct: 721 STKKITITRLPRNLIIH-----LKRFDNMLNKNNVFV 752

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 166 ACPHSEQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQ 225
            C +S+   V  + +P    C +C    NLW+CL CG++GCGR         HA+ HY+Q
Sbjct: 253 VCRYSQLKDVNNEPLP---RCLECGETNNLWICLICGHLGCGR-----YNSQHAICHYEQ 304

Query: 226 SENNHPLAVKLGS 238
           S  NH  A+ L +
Sbjct: 305 S--NHCFAMDLTT 315

>Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement
          Length = 454

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 110/247 (44%), Gaps = 23/247 (9%)

Query: 319 GLINLGNSCYLNSVVQVLF-NGGVKDWNLDMLGDFPRDVVFPSTNLKC---QLIK-LRNA 373
           GL+N+G++C+++S++Q L  N  +   ++D L     D+   S+ + C   Q+I     A
Sbjct: 137 GLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHSTTCDLQNSSSCMSCAVDQIISDFYGA 196

Query: 374 LKIH-PEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD----RKVFSKA 428
            K    E  Q G    ++  C    N+  +   QQDA EF  + +++L     R    KA
Sbjct: 197 SKSETSETNQQGF--VNLLSCSWRKNKNLAGYSQQDAHEFWQFLLNQLHNDHLRATNQKA 254

Query: 429 SSSNPNDLMRF-----MVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSY 483
           S  N  + +        ++  + C +C++ + ++   +++    LD  +   L + L ++
Sbjct: 255 SLKNDCNCISHRSFQGFLKSSIVCPECQNDRKTT--IDLMMDLSLDIKNKSTLHECLDNF 312

Query: 484 FNGESL---DIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQ-NWTPIKTSNQLFVP 539
              E L   + HC +C+    A +   +   P  L++   R +   N + +K +N +  P
Sbjct: 313 HKKEQLTDFNYHCEKCNTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFP 372

Query: 540 GLRDEKR 546
              D  +
Sbjct: 373 TYLDMSK 379

>Scas_618.5
          Length = 493

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 707 PGDIPD--YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           PG+ P   Y L  +I H+G + +SGHY AFI+   D E KW  +ND+K+  V
Sbjct: 416 PGENPSSVYNLVGIITHQGANSESGHYQAFIRDETD-ENKWYKFNDDKVSVV 466

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 15/114 (13%)

Query: 318 CGLINLGNSCYLNSVVQVLFN-GGVKD--WNLDMLGDFPRDVVFPSTNLKCQLIKLRNAL 374
            GL N+GN+CY+N+ +Q LF    ++D   N D     P+D +         +++++   
Sbjct: 107 IGLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQDEMHHKI-----VLEMKRCF 161

Query: 375 KIHPEKYQHGVKPAS----VKKCIGEDNEEFSSG---RQQDAMEFLTYFIDKLD 421
           +    K    V P      ++KC  +  E  + G   +QQDA E  T      D
Sbjct: 162 ENLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFD 215

>Scas_609.9
          Length = 729

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 20/173 (11%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKAS--SSNPN-------- 434
           V P    K + ++N  F+S  QQDA EFL + +++L   + +  S  S+ P         
Sbjct: 401 VSPVEFVKVLKKENILFNSMMQQDAHEFLNFLLNELSEYLQNHISHPSNKPTDIPFKNYV 460

Query: 435 -DLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQF-LMDRLHSYFNGESLD-- 490
            DL + ++ +R++C  C+++  +S+    L  P+    D    + D L  Y   E L+  
Sbjct: 461 IDLFQGVLTNRIKCLTCDNI--TSRDEPFLDFPIGVKGDENIDIQDVLRCYHTREMLNGS 518

Query: 491 --IHCPQCSEITVATKNSMLKTAPATLLINPIRIKL--QNWTPIKTSNQLFVP 539
              +C QC  +  A +   LK  P TL ++  R K   +  T IK  N++  P
Sbjct: 519 NKFYCSQCCGLQEAERIVGLKQLPHTLALHLKRFKYSEEQNTNIKLFNKVQYP 571

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L+ V+ H G S Q GHYV+  K    G   W+L++DE + +V
Sbjct: 588 YELTGVVIHMGGSPQHGHYVSLCKNDKFG---WLLFDDETVESV 628

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 5/46 (10%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLK 364
           G  N GN+CY NSV+Q L+N  + +  L++L    RD   P T ++
Sbjct: 138 GYENFGNTCYCNSVLQCLYN--LTELRLNLLEYPARD---PKTRIR 178

>Scas_692.39
          Length = 466

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 77/364 (21%), Positives = 144/364 (39%), Gaps = 74/364 (20%)

Query: 196 WLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESNDIYCYSCNDEV 255
           ++CL C  +GC          SH + H ++    H   +      S +  ++C+ C D +
Sbjct: 59  FMCLQCDFVGCWNG-------SHFITHMKRF--GHVFGI-----NSSNGLLFCFKCMDYI 104

Query: 256 AFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKE 315
              +   +S +L K+  D+       KT +  Q         + RD        +F    
Sbjct: 105 GHLETINYS-MLNKYWDDIS-----TKTTIPSQ---------ERRDG-------LF---- 138

Query: 316 YGCGLINLGNSCYLNSVVQVLF-NGGVKDWNLDMLGDFPRDVVFPSTNLKCQL----IKL 370
              GL+N+G++C+++S++Q L  N  + ++++         +   S  + C L    I+ 
Sbjct: 139 ---GLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNSSLCMSCALDAMIIEF 195

Query: 371 RNALKIHP----------EKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
               K+ P                    S+  C  + NE F+   QQDA EFL YF+++L
Sbjct: 196 YGQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKINENFAGYSQQDAHEFLQYFLNQL 255

Query: 421 DRKVFSKASSSN---------PNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSN 471
            +  + + SS N          + + +  ++  + C +C++   S  + +      LD  
Sbjct: 256 HQD-YKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQND--SKTIIDPFMDLSLDIK 312

Query: 472 DPQFLMDRLHSYFNGESL---DIHCPQCSEITVATKNSMLKTAPATLLINPIRIK-LQNW 527
           D   L   L S+   E L   + HC +C+      K   +   P  L++   R +   N 
Sbjct: 313 DKTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLPPMLVLQLKRFEHFVNG 372

Query: 528 TPIK 531
           T +K
Sbjct: 373 TNVK 376

>CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces
           cerevisiae YDR069c DOA4 ubiquitin-specific protease,
           hypothetical start
          Length = 887

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 110/290 (37%), Gaps = 61/290 (21%)

Query: 316 YGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALK 375
           +  GL N+GNSCY+N ++Q +F    +   + + G + + +    + L  + +   N  K
Sbjct: 523 FTVGLENMGNSCYINCIIQCIF-ATTELIKIFLNGTYAKHIN-KQSKLGSKGVLSHNFAK 580

Query: 376 IHPEKYQ----------HG-VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD--- 421
           +  + Y+          HG VK    K      N  F    QQD +EF  + +D L    
Sbjct: 581 LLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDGLHEDL 640

Query: 422 ---------RKVFSKASSSNPN-----------------------DLMRFMVEDRLECTK 449
                    +++  +A     N                       DL +     +L C  
Sbjct: 641 NQCGANPPLKELSPEAEKMRENLSLRVASSIEWERYLTTDFSIIVDLFQGQYASQLRCKV 700

Query: 450 CEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLDI----HCPQCSEITVATKN 505
           C     + Q   +L +P + S     L+D    +   E+L++     CP C +   +TK 
Sbjct: 701 CNRTSTTYQAFSVLSVP-VPSGKSCGLLDCFIEFTKTENLEVDEQWFCPSCKKKQPSTKK 759

Query: 506 SMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPGLRDEKRLKLSQFKAH 555
             +   P  L+I+     L+ +  +   N +FV   R  + L L+ F A+
Sbjct: 760 LTITRLPRNLIIH-----LKRFDNMMNKNNIFV---RYPQILDLTPFWAN 801

>Scas_715.2
          Length = 717

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTY----FIDKLDRKVFSKASSSNPNDLMRFM 440
           V P      +  +N  F S   QDA EFL +    F D+LDR      + +  N++ +  
Sbjct: 388 VSPVQFVNMLRRENVLFDSMMHQDAHEFLNFMLNDFSDRLDR---DNQAKNFINEIFQGT 444

Query: 441 VEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESL-----DIHCPQ 495
           + +++ C  C++V    +    L I + ++ D    + R+  Y++   +       +C Q
Sbjct: 445 LTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTD--IQRVLKYYSQREMLNGSNKFNCSQ 502

Query: 496 CSEITVATKNSMLKTAPATLLINPIRIKL--QNWTPIKTSNQLFVP 539
           C  +  A +   LK  P TL+++  R K   Q  + IK  ++++ P
Sbjct: 503 CCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYP 548

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 709 DIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVG 757
           D   Y LS ++ H G+  Q GHYVA  K    G   W+ Y+DE + +V 
Sbjct: 561 DTIKYELSGIVIHVGDGPQMGHYVALCKTEKYG---WLFYDDETVESVS 606

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 9/51 (17%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIK 369
           G  N GN+CY NSV+Q L+N  + ++ L++L        +P  NL  Q ++
Sbjct: 127 GYENFGNTCYCNSVLQCLYN--LPEFRLNILQ-------YPERNLMDQRVR 168

>Scas_634.14
          Length = 1201

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 83/210 (39%), Gaps = 56/210 (26%)

Query: 318 CGLINLGNSCYLNSVVQ-----------VLFNGGVKDWNLDMLGDFPRDVVFPSTNL-KC 365
            GL+NLGN+CY+NS +Q            L++G  K+ N D    +   V    + L +C
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSELIRC 380

Query: 366 ----QLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFID--- 418
               +L++                 P   K  IG  N  FS   QQD+ EFL + +D   
Sbjct: 381 LFGDKLVQFS------------AYAPNHFKATIGHFNSMFSGYLQQDSQEFLAFLLDSLH 428

Query: 419 ----KLDRKVF-SKASSSNPNDLMRFMVEDRL-ECTKCEHVKYSSQVCEILQIPLLDSND 472
               ++D+K +  K S  +  DL  F +  +L + T   H+  +  V   L + L  S  
Sbjct: 429 EDLNRIDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRNDSVITDLFVGLYKST- 487

Query: 473 PQFLMDRLHSYFNGESLDIHCPQCSEITVA 502
                             + CP+C  I++ 
Sbjct: 488 ------------------LECPECQNISIT 499

>Kwal_33.13628
          Length = 1160

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 318 CGLINLGNSCYLNSVVQVLFN-GGVKDWNLDMLGDFPRDVVFPSTNLKCQ------LIKL 370
            GL NLGNSCY+NS +Q L +   ++D+ L   G F +D+   S  L  Q         L
Sbjct: 298 VGLSNLGNSCYMNSALQCLVHIPELRDYFL--YGGFEQDIN-TSNPLGYQGQIAQAFAAL 354

Query: 371 RNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
             +L            P + K  IG  N  F+   QQD+ E L + +D L
Sbjct: 355 VKSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGL 404

>Kwal_14.2008
          Length = 424

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 96/260 (36%), Gaps = 60/260 (23%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNL--KCQLIKLRNALKI 376
           GL+NLGNSCY+N ++Q L   G ++     L D  ++ V  ++ L  K  L K  + L I
Sbjct: 57  GLVNLGNSCYMNCIIQCLL--GTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQL-I 113

Query: 377 HPEKYQ---------------HGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL- 420
           H  + Q               + V+P   K   G  N  F +  QQD  EF  + +D L 
Sbjct: 114 HNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKTTSQQDCQEFCQFLLDGLH 173

Query: 421 -----------------------DRKVFSKASS-----------SNPNDLMRFMVEDRLE 446
                                  ++     ASS           S   DL +     +L 
Sbjct: 174 EDLNQCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLM 233

Query: 447 CTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLD----IHCPQCSEITVA 502
           C  C     + Q   +L +P+        L+D    +   E+L+      CP+C     +
Sbjct: 234 CKVCGRTSTTYQPFSVLSVPVPRGARCN-LLDCFEEFTKIETLEKDEQWSCPRCKVKQPS 292

Query: 503 TKNSMLKTAPATLLINPIRI 522
           TK   +   P  L+I+  R 
Sbjct: 293 TKKITITRLPRNLIIHLKRF 312

>YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal
           hydrolase associated with the 26S proteaseome, involved
           in ubiquitin turnover [1500 bp, 499 aa]
          Length = 499

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  VI H+G + +SGHY AFI+  +D E KW  +ND+K+  V
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELD-ENKWYKFNDDKVSVV 472

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNL-----KCQLIKLRN 372
            G  N+GN+CYLN+ +Q L+   V D    +L   P   V  S        K  +I+++ 
Sbjct: 109 VGFKNMGNTCYLNATLQALYR--VNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKR 166

Query: 373 ALKIHPEKYQHGVKPA----SVKKCIGEDNEEFSSG---RQQDAMEFLT 414
             +    K    V P     +++KC  +  E  S G   +QQDA E  T
Sbjct: 167 CFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFT 215

>KLLA0C06974g complement(604344..605684) similar to sp|P50102
           Saccharomyces cerevisiae YMR223w UBP8, start by
           similarity
          Length = 446

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 157/401 (39%), Gaps = 91/401 (22%)

Query: 166 ACPHSEQFV--------VPQDAMPVRETCGDCDL-DRNL--WLCLHCGNIGCGRE----Q 210
            CPH  Q V        V ++   VR      D  +R +    C+ CG I CG      Q
Sbjct: 2   VCPHMNQVVSNQKLGDAVLKECETVRYLLRHADFKNRTMRTMRCMDCGEISCGSTFICLQ 61

Query: 211 VGIEG---HSHALKHYQQSENNHPLAVKLGSL---TSESNDIYCYSCNDEVAFPDPNRFS 264
            G  G   ++H L H Q          KLG +    S +  ++C+ C D           
Sbjct: 62  CGFCGCWNNNHFLDHSQ----------KLGHIFGVNSSNGLVFCFRCGD----------- 100

Query: 265 AVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLG 324
                F  DL  ++   +            WD  M  +  E    +   ++   GL+N+G
Sbjct: 101 -----FMADLVAEIPASQ------------WDTVMEKT--ELPASL--HRDGLQGLVNMG 139

Query: 325 NSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHG 384
           ++C+++S++Q + +     +  D+L     +     +  KC    L    +I  + Y +G
Sbjct: 140 STCFMSSIIQTIIHNPY--FVEDLLSHKHCNNCDIKSGTKCVSCALD---EIACDFYGNG 194

Query: 385 ---VKPASVKKCI-------GEDNEEFSSGRQQDAMEFLTYFIDKLDR---KVFSKASSS 431
               K +SV K            N       QQDA E+  + +++L     +VF  + + 
Sbjct: 195 PGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTDHARVFGSSKAP 254

Query: 432 N----PNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGE 487
           +     + + +  +++ L+C++C   K  + +  I+ + L   N+P+ L D L  +   E
Sbjct: 255 DCQCITHRIFQGYLKNTLQCSQCGFSK--TTIDPIMDLSLEIKNNPK-LEDCLDHFQREE 311

Query: 488 SL-DIH--CPQCSEITVATKNSMLKTAPATLLINPIRIKLQ 525
           +L D H  C  C +     K   L  AP  L+I   R + Q
Sbjct: 312 TLTDFHYECQSCKQNQGVVKQLTLHKAPNVLVIQLKRFEHQ 352

>AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C
           (UBP13) - SH] complement(1416093..1418315) [2223 bp, 740
           aa]
          Length = 740

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 712 DYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765
           DY L+ ++ H G   Q GHYVA  K  + G   W+LY+DE + +VG +  L+ I
Sbjct: 591 DYELNGIVIHMGGGPQHGHYVAICKHELFG---WLLYDDETVESVGEDAVLRFI 641

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 9/43 (20%)

Query: 307 TKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDML 349
           T K+F       GL N GN+CY NSV+Q L+N  +K+  +++L
Sbjct: 95  TPKVF-------GLENYGNTCYCNSVLQCLYN--LKELRVNVL 128

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 76/169 (44%), Gaps = 16/169 (9%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD-------RKVFSKASSSNPNDLM 437
           V P+     + ++N  F+S   QDA EFL + ++ L        +++  K+  +  + L 
Sbjct: 409 VSPSHFVSVLRKENVLFNSMMHQDAHEFLNFLMNALSDSLQLQLQRLPDKSPENFIHTLF 468

Query: 438 RFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQF-LMDRLHSYFNGESLD----IH 492
           +  + + ++C  C+++  + +      IP+  S D +  + D L  +   E L+     +
Sbjct: 469 QGTMNNSIKCLTCDNITSNEEPFFDFAIPV--SEDEELNVQDILRDFHQREMLNGANKFY 526

Query: 493 CPQCSEITVATKNSMLKTAPATLLINPIRIKL--QNWTPIKTSNQLFVP 539
           C  C+ +  A +   +K  P  L ++  R K   ++ + IK  N +  P
Sbjct: 527 CDSCNGLQEAERTVGIKELPELLPLHLKRFKYSEKHQSNIKLFNVIHYP 575

>YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal
           hydrolase, has similarity to Ubp13p [2265 bp, 754 aa]
          Length = 754

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 77/175 (44%), Gaps = 22/175 (12%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD--------RKVFSKASSSNPN-- 434
           V P    K + ++N  F++  QQDA EFL + ++           R  F    + N N  
Sbjct: 412 VSPTEFVKILKKENVLFNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDN 471

Query: 435 ---DLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDR-LHSYFNGESLD 490
              DL +  + +R++C  C+++  +S+    L  P+    D +  + + L SY   E L+
Sbjct: 472 FITDLFKGTLTNRIKCLTCDNI--TSRDEPFLDFPIEVQGDEETDIQKMLKSYHQREMLN 529

Query: 491 ----IHCPQCSEITVATKNSMLKTAPATLLINPIRIKL--QNWTPIKTSNQLFVP 539
                +C +C  +  A +   LK  P  L ++  R K   +  + IK  N++  P
Sbjct: 530 GVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYP 584

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQ 763
           Y LS V+ H G+  Q GHYV   +    G   W+LY+DE + ++     LQ
Sbjct: 601 YELSGVVIHMGSGPQHGHYVCICRNEKFG---WLLYDDETVESIKEETVLQ 648

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 319 GLINLGNSCYLNSVVQVLFN 338
           G  N GN+CY NSV+Q L+N
Sbjct: 135 GYENFGNTCYCNSVLQCLYN 154

>AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH]
           complement(1427056..1428465) [1410 bp, 469 aa]
          Length = 469

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 90/434 (20%), Positives = 160/434 (36%), Gaps = 107/434 (24%)

Query: 164 IKACPHSEQFV--------VPQDAMPVRETCGDCDL-DRNL----------------WLC 198
           +  CPH EQ +        V ++ + VR    +CD   R L                ++C
Sbjct: 1   MMVCPHMEQVIQTAKVGDAVVKECITVRYLIRNCDAKSRYLRAMRCSECFQINCGSSFMC 60

Query: 199 LHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFP 258
           L CG +GC  E       SH L H ++    H   V      + +  ++C+ C D ++  
Sbjct: 61  LQCGFVGCWNE-------SHFLHHSKKV--GHIFGVN-----ATNGLLFCFRCRDYIS-- 104

Query: 259 DPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGC 318
                                 +   V + +    +W+  +R S      +     E   
Sbjct: 105 ----------------------DNEFVHMDIMPK-HWNEVLRRSSIPAPHR----GEGLL 137

Query: 319 GLINLGNSCYLNSVVQVLFN-GGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKL------- 370
           GL+N+G++C+++SV+Q   +   V  + L+ L     DV    + + C + ++       
Sbjct: 138 GLVNMGSTCFMSSVIQTFLHLPHVLQYMLERLHYATCDVQDSLSCISCAVDEIVANLYGQ 197

Query: 371 ---------------RNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTY 415
                            AL     K Q G    ++  C  + N   +   QQDA EF  +
Sbjct: 198 VKEEAASGVAGPGASTQALSQSLSKQQQGF--INLLTCSWKINRNLAGYSQQDAHEFWQF 255

Query: 416 FIDKLDRKVF------SKASSSNPNDLMRF--MVEDRLECTKCEHVKYSSQVCEILQIPL 467
            +++L           SK S+      M F   +E  + C++C H    + V  I+ + L
Sbjct: 256 LLNQLHTDYIRIHGPPSKKSACGCILHMLFQGYLESSIVCSEC-HGNNKTTVDPIMDLSL 314

Query: 468 LDSNDPQFLMDRLHSYFNGESL---DIHCPQCSEITVATKNSMLKTAPATLLINPIRIK- 523
              N    L + L S+   ESL   +  C  C   +   +   +   P  L++   R + 
Sbjct: 315 GIQNKST-LHECLDSFHRRESLTDFNYCCKNCMSTSNPIRQLSMAKLPPVLMLQLKRFEH 373

Query: 524 LQNWTPIKTSNQLF 537
           L N T +K ++ +F
Sbjct: 374 LINGTSVKINDYIF 387

>CAGL0I05522g complement(521749..523923) some similarities with
           sp|P39967 Saccharomyces cerevisiae YER098w UBP9 or
           sp|P38187 Saccharomyces cerevisiae YBL067c UBP13,
           hypothetical start
          Length = 724

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 76/184 (41%), Gaps = 22/184 (11%)

Query: 376 IHPEKYQHGV-KPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD------RKVFSKA 428
           I   +Y  GV  PA   K +   N  F+S  QQDA EFL + ++ +       +  + K+
Sbjct: 385 ITENRYLSGVVSPAEFVKLLKRQNPLFNSTMQQDAHEFLNFLLNNISDFAGKYKSNYLKS 444

Query: 429 SSSNPNDLMRFMVED--------RLECTKCEHVKYSSQVCEILQIPLLDSNDPQF-LMDR 479
           S+    ++    V+D        R++C  C+ V  S+     L  P+   ND    + D 
Sbjct: 445 SNEEECEISHDFVKDQFEGVLLNRIKCLTCDCV--SANEEPFLDFPIEIQNDEAINIQDT 502

Query: 480 LHSYFNGESL----DIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQ 535
             S++  E L      +C +C  +  A K    +  P TL ++  R K       K  N+
Sbjct: 503 FRSFYQREILCGPNKFYCNECCGLQEAEKTVGFEKLPKTLALHLKRFKCDGIVNSKLFNK 562

Query: 536 LFVP 539
           +  P
Sbjct: 563 IEYP 566

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L+ V+ H G S   GHYV+  K    G   W++Y+DE + ++
Sbjct: 583 YELTGVVLHVGASPTHGHYVSICKHEKYG---WLMYDDETIESI 623

>KLLA0A10791g
           join(complement(935718..935733),
           complement(934135..935573)) similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease singleton, start by similarity
          Length = 484

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  V+ H+G +  SGHY AF++   D E KW  YND+K+  V
Sbjct: 415 YNLIGVVTHQGANSDSGHYQAFVRDDAD-ENKWYKYNDDKVYVV 457

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQL-IKLRNALKI 376
            GL N+GN+CY N+ +Q L+   +K     +L         P+ +L  QL I+LRN    
Sbjct: 106 MGLRNMGNTCYFNASLQALYR--IKPLREKVLA-----YNEPNPDLHGQLVIQLRNCFNA 158

Query: 377 HPEKYQHGVKPASVKKCIGEDNEEF-----SSG--RQQDAMEFLTYFIDKLDRKVFSKAS 429
             ++ +    P  +   + +   +F     S+G  +QQDA E  T  +  +D  VF ++ 
Sbjct: 159 FAQRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTID-TVFGESL 217

Query: 430 SSNPNDLMRFMVEDRLECTKCE 451
           SS      +  V+D L  T  +
Sbjct: 218 SSKFEIEFQTTVKDTLNETDVQ 239

>AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH]
           complement(580062..581402) [1341 bp, 446 aa]
          Length = 446

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  VI H+G + +SGHY AF++   D + KW  +ND+K+ A+
Sbjct: 377 YDLIGVITHQGANSESGHYQAFMRDEFD-DDKWYKFNDDKVTAI 419

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 17/21 (80%)

Query: 318 CGLINLGNSCYLNSVVQVLFN 338
            G++N+GN+CY+N+ +Q L+ 
Sbjct: 60  MGIVNMGNTCYMNATLQGLYG 80

>AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH]
           (1010466..1012835) [2370 bp, 789 aa]
          Length = 789

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 71/163 (43%), Gaps = 30/163 (18%)

Query: 319 GLINLGNSCYLNSVVQVLF--------------NGGVKDWNL--DMLGDFPRDVVFPSTN 362
           G++N GN C+++SV+QVL                 GVK W L   +LG     + F    
Sbjct: 350 GIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLLGSC---LEFYKEF 406

Query: 363 LKCQLIKLRN---------ALKIHPEKYQHGVKPASVKKCIGEDN--EEFSSGRQQDAME 411
            K    K +N         + K +       + P    KCI +    ++   G Q+DA E
Sbjct: 407 EKLHADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKLPMFKDLQWGHQEDAEE 466

Query: 412 FLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVK 454
           FLT+F+D+L  +  S  +S + +D++  +     +  K E V+
Sbjct: 467 FLTHFLDQLHEEFVSSINSLSCSDMIHLLQSLSDDDLKAEFVR 509

>CAGL0K10494g 1022869..1024356 highly similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease, start by similarity
          Length = 495

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L  VI H+G + +SGHY AFI+   D E KW  +ND+K+  +
Sbjct: 426 YDLIGVITHQGANSESGHYQAFIRDESD-ENKWYKFNDDKVSPI 468

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDF-PRDVVFPSTNLKCQ---LIKLRNA 373
            GL N+GN+CYLN+ +Q LF     D   D++  + P  V     N +     +++L+  
Sbjct: 109 LGLQNMGNTCYLNATLQALFRA---DELKDLILQYDPSKVTNSDANDEIHYKIVLELKRT 165

Query: 374 LKIHPEKYQHGVKPA----SVKKCIGEDNEEFSSG---RQQDAMEFLTYFIDKL 420
            +   ++    V P     +++KC  +  E    G   +QQDA E  T     L
Sbjct: 166 FETLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTL 219

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 186 CGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVKLGSLTSESND 245
           C  C    NLW+CL CG++GCGR         HA++HY+ S +   + +    +   + D
Sbjct: 268 CDVCGSSENLWVCLICGHMGCGR-----YNSKHAIQHYESSSHCFAMDIATKRVWDYAGD 322

Query: 246 IYCY 249
            Y +
Sbjct: 323 NYVH 326

>KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967
           Saccharomyces cerevisiae YER098w UBP9 ubiquitin
           carboxyl-terminal hydrolase, start by similarity
          Length = 697

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 16/153 (10%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL------DRKVFSKASSSNPN---D 435
           V P++    + ++N  FSS   QDA EFL Y +++L      D ++ +    S P    D
Sbjct: 379 VSPSNFVNILKQENILFSSSMHQDAHEFLNYLLNELSDTLKRDMELDTDKLESKPTFIED 438

Query: 436 LMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQF-LMDRLHSYFNGESL----D 490
           L +  + +  +C  C+ +    +    L  P+    D +  + D L++Y + E L     
Sbjct: 439 LFKGSLCNSTKCFTCDTITARDE--PFLDFPIEIQEDEEIKIQDILNNYKHRELLTGANK 496

Query: 491 IHCPQCSEITVATKNSMLKTAPATLLINPIRIK 523
            +C +C  +  A +   LK+ P TL I+  R K
Sbjct: 497 FYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFK 529

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 319 GLINLGNSCYLNSVVQVLFN 338
           G  N GN+CY NSV+Q L+N
Sbjct: 116 GYENFGNTCYCNSVLQCLYN 135

>KLLA0C03476g 314815..318573 weakly similar to sp|P39538
           Saccharomyces cerevisiae YJL197w UBP12 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 1252

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 20/114 (17%)

Query: 319 GLINLGNSCYLNSVVQ-----------VLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQL 367
           GL NLGN+CY+NS +Q            L+ G  ++ N++       DV     +L   L
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLYSL 399

Query: 368 IKLRNALKIHPEKYQHGV-KPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
                     P   Q     P + K  IG  N  F+   QQD+ EFL + +D L
Sbjct: 400 FA--------PSYGQSTFYAPRNFKNTIGHYNSLFAGYGQQDSQEFLAFLLDGL 445

>CAGL0J11352g complement(1101349..1103664) similar to sp|P53874
           Saccharomyces cerevisiae YNL186w UBP10, start by
           similarity
          Length = 771

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           Y L +V+ H+G S+ SGHY+A  K+  DG   W  Y+DE +  +   E L+E
Sbjct: 662 YELLSVVVHEGRSLSSGHYIAHCKQP-DG--SWATYDDEYINKITEREVLKE 710

>Scas_655.4
          Length = 875

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/340 (20%), Positives = 129/340 (37%), Gaps = 73/340 (21%)

Query: 251 CNDEVAFPDPN-----RFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNWDFQMRDSGNE 305
            N+ V+ P P      +F+  +A  G +L  ++ K             NW       G E
Sbjct: 360 TNESVSAPAPAPEQFYQFNETIADQGSNLPSRIIK-------------NW-------GPE 399

Query: 306 FTKKIFASKEYGCGLINLGNSCYLNSVVQVLFN-GGVKDWNLDML-GDFPRDVVFPSTNL 363
           F  +         GL+N G +CY N+ VQ + +   ++ +  D+L G +   +   S ++
Sbjct: 400 FANR------KPKGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYKETISPKSVSV 453

Query: 364 KCQLIKLRN-ALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDR 422
                 LR  AL+   +K    + P  +   +   N   S  +Q+D+ E+    + +L  
Sbjct: 454 MLAETSLRMWALQDKKKKNLGYINPKKLIASLETINCMMSEWQQEDSHEYFMSLMSRLQE 513

Query: 423 KVFS---KASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLL----------- 468
                  K + S   D+   +++  + C  C  V  + Q    L + L            
Sbjct: 514 DSVPPGHKMTESMIYDIFGGLLKQIVTCKSCGGVSTTEQPFYDLSLHLKGKKNTTTVTDA 573

Query: 469 -----------DSND------PQFLMDR-LHSYFNGESLDIH-------CPQCSEITVAT 503
                      D+ND       +F +++ +  +FN E + +        C +C + T AT
Sbjct: 574 DGNEKTQHESKDNNDDASQLSKRFSIEKSIKDFFNPELIRVDKEKKGYVCEKCHKTTNAT 633

Query: 504 KNSMLKTAPATLLINPIRIKLQNWTPIKTSNQLFVPGLRD 543
           K S +  AP TLL++  + +    T  K    +  P   D
Sbjct: 634 KRSSILRAPETLLVHLKKFRFNGTTSSKMKQAVSYPMYLD 673

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVG 757
           Y L +V+ H+G S+ SGHY+A  ++  DG   W  Y+DE +  + 
Sbjct: 691 YELLSVVVHEGRSLSSGHYIAHCRQP-DGS--WATYDDEYINKIS 732

>Kwal_33.14430
          Length = 511

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/256 (20%), Positives = 99/256 (38%), Gaps = 32/256 (12%)

Query: 319 GLINLGNSCYLNSVVQVLFN-GGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
           GL+N G +CY N+ VQ L +   ++ +  D+L    +  + P +  +      +      
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQSVTQVLAETTKRMWSNE 184

Query: 378 PEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFS---KASSSNPN 434
             K Q  + P  +   + + N   S  +Q+D+ E+    I +L         K + S   
Sbjct: 185 SSKNQF-INPKKLIGRLDDINCMMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTESILY 243

Query: 435 DLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSN----------------DPQ--FL 476
           D+   ++   + C  C  V  + Q    L + L                    +PQ  F 
Sbjct: 244 DIFGGLLRQEVTCKSCGEVSKTEQPIYDLSLHLKGKKNSSQGESAKNSSEYEEEPQRRFS 303

Query: 477 MDR-LHSYFNGESLDIH--------CPQCSEITVATKNSMLKTAPATLLINPIRIKLQNW 527
           +++ +  +FN E +           C +C + T A+K++ L  AP TLL++  + +    
Sbjct: 304 IEKSIRDFFNPELIKADKATKEGYVCEKCHKTTNASKHNFLLRAPETLLVHLKKFRFNGT 363

Query: 528 TPIKTSNQLFVPGLRD 543
           +  K    +  P   D
Sbjct: 364 SSSKLKQAVSYPMFLD 379

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           Y L +V+ H+G S+ SGHY+A  K+  DG   W  Y+DE +  +   + L+E
Sbjct: 395 YQLISVVVHEGRSLSSGHYIAHCKQP-DGS--WSTYDDEYINKISEKQMLKE 443

>ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH]
           complement(124841..127090) [2250 bp, 749 aa]
          Length = 749

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 106/275 (38%), Gaps = 54/275 (19%)

Query: 319 GLINLGNSCYLNSVVQVLFN-GGVKDWNLDMLGDFPRDVVFPS--TNLKCQLIKLRNALK 375
           GL+N G +CY N+ VQ + +   ++ +  D+     +DV+ PS  + +  +  K   +L+
Sbjct: 352 GLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGKYKDVISPSSVSQVLAETSKRMWSLE 411

Query: 376 IHPEKYQHGVKPASVKKCIG--ED-NEEFSSGRQQDAMEFLTYFIDKLDRKVFS---KAS 429
               K  + + P   KK IG  ED N   S   Q+D+ E+    I +L         K +
Sbjct: 412 NGKSKASY-INP---KKLIGRLEDINCMMSVWNQEDSHEYFMSLISRLQEDSVPRGHKMT 467

Query: 430 SSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPL---------------------- 467
            S   D+   +++ R++C  C  V  + Q    L + L                      
Sbjct: 468 ESLIYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHLKGKKLAKGDDSTVDDSITGDVK 527

Query: 468 -----LDSNDPQFLMDRLHS-------YFNGESLD-------IHCPQCSEITVATKNSML 508
                  S D   L  R +S       +FN E +          C +C   T A K +M+
Sbjct: 528 NSAAPSGSTDGAELPKRRYSIEKSIRDFFNPELIKKVDNKEGYVCEKCKATTNAIKRNMI 587

Query: 509 KTAPATLLINPIRIKLQNWTPIKTSNQLFVPGLRD 543
             AP TLL++  + +    +  K    +  P   D
Sbjct: 588 LRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMD 622

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEI 765
           Y L +V+ H+G S+ SGHY+A  K+  DG   W  Y+DE +  +     L+E+
Sbjct: 638 YQLISVVVHEGRSLSSGHYIAHCKQP-DG--TWATYDDEYINKITERNVLKEV 687

>KLLA0D08459g complement(718046..720298) some similarities with
           sp|P53874 Saccharomyces cerevisiae YNL186w UBP10
           derepression of telomeric silencing, hypothetical start
          Length = 750

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           Y L +V+ H+G S+ SGHY+A  K+  DG   W  Y+DE +  +   + L+E
Sbjct: 639 YQLISVVVHEGRSLSSGHYIAHCKQP-DGS--WATYDDEYINKISEKQLLKE 687

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 48/264 (18%), Positives = 106/264 (40%), Gaps = 42/264 (15%)

Query: 319 GLINLGNSCYLNSVVQVLFN-GGVKDWNLDML-GDFPRDVVFPSTNLKCQLIKLRNALKI 376
           GL+N G +CY N+ VQ + +   ++ +   +L G+F +D V   +N    L+        
Sbjct: 363 GLLNHGVTCYTNAAVQAMVHIPAIQHYLFQLLRGNF-KDTV--KSNCVSMLLAETTMRMW 419

Query: 377 HPEKYQHG-VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKA---SSSN 432
             +  ++  + P  +   + + N   S+  Q+D+ E+    + +L      K    + S 
Sbjct: 420 SSDSTKNTYINPDKLINALEDINCMMSAWNQEDSHEYFMSLMSRLQEDSVPKGHKMTESI 479

Query: 433 PNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPL------------------------- 467
             D+   +++  ++C+ C  +  + Q    L + L                         
Sbjct: 480 IYDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLHLKGRKTTDQDQNSVGQDNSIDNSVDQ 539

Query: 468 LDSNDPQFLMDR-LHSYFNGESLD-------IHCPQCSEITVATKNSMLKTAPATLLINP 519
             S+  +F +++ +  +FN E +          C +C ++T A K++ +  AP TL+++ 
Sbjct: 540 QQSSKRRFSIEKSIRDFFNPELIKRVDNKEGYTCEKCKKVTNALKSNKIIRAPETLVVHL 599

Query: 520 IRIKLQNWTPIKTSNQLFVPGLRD 543
            + +    +  K    +  P   D
Sbjct: 600 KKFRFNGTSSSKMKQAVSYPMFLD 623

>YIL156W (UBP7) [2521] chr9 (48091..51306) Putative
           ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase) [3216 bp, 1071 aa]
          Length = 1071

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFP-STNLKCQLIKLRNALKI 376
            GL NLGN+CY+NS++Q LF    K +    +    +  + P  +N      KL N+L +
Sbjct: 609 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSM 666

Query: 377 HPEK-YQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKLDRKVFSKASSS 431
              K Y +G   V P    K I +   +      QQD  EFL   +D+L  ++  +   +
Sbjct: 667 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSDQQHVA 726

Query: 432 N--PNDLM 437
           N  PN L+
Sbjct: 727 NDYPNLLL 734

>CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces
           cerevisiae YBL067c UBP13 or sp|P39967 Saccharomyces
           cerevisiae YER098w UBP9 ubiquitin carboxyl-terminal
           hydrolase, hypothetical start
          Length = 770

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 690 DDTQESIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYN 749
           D     +D  VS  +  P    +Y LS ++ H G   Q GHY++  K    G   W+L++
Sbjct: 591 DKVSYPLDLKVSSTFN-PSISKNYELSGIVVHMGGGPQHGHYISLCKNEKFG---WLLFD 646

Query: 750 DEKLMAVGGNENLQ 763
           DE + A+     LQ
Sbjct: 647 DETVEAISEQAVLQ 660

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 69/164 (42%), Gaps = 27/164 (16%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTY-------FIDK-----LDRKVFSKASSSN 432
           V P++  + +  +N  FSS   QDA EFL +       F+DK     L+ K++  +    
Sbjct: 417 VTPSAFIEMLKRENVLFSSMMHQDAHEFLIFLLNEISDFLDKQNKNALNSKIYDSSQGRR 476

Query: 433 PNDLMRFMVED--------RLECTKCEHVKYSSQVCEILQIPL-LDSNDPQFLMDRLHSY 483
            +  ++  V D        R++C  C++     +    L  P+ +  N    + + L S+
Sbjct: 477 NSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDE--PFLDFPIEVQENVDIDIQEILESF 534

Query: 484 FNGESL----DIHCPQCSEITVATKNSMLKTAPATLLINPIRIK 523
              E L      +C +C  +  A +   LK  P TL ++  R K
Sbjct: 535 HQKEMLHGPNKFYCDECCGLQEAERVVGLKQLPKTLALHLKRFK 578

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDML 349
           G  N GN+CY NSV+Q L+N  + ++  DML
Sbjct: 151 GYENFGNTCYCNSVLQCLYN--LPEFRNDML 179

>YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-terminal
           hydrolase, involved in telomeric silencing [2379 bp, 792
           aa]
          Length = 792

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           Y L +V+ H+G S+ SGHY+A  K+  DG   W  Y+DE +  +   + L+E
Sbjct: 674 YQLLSVVVHEGRSLSSGHYIAHCKQP-DGS--WATYDDEYINIISERDVLKE 722

>KLLA0E00979g 104991..107315 some similarities with sp|Q01477
           Saccharomyces cerevisiae YER151c UBP3 ubiquitin-specific
           proteinase singleton, hypothetical start
          Length = 774

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 37/170 (21%)

Query: 319 GLINLGNSCYLNSVVQVLFN-------------GGVKDWN---------LDMLGDFPRDV 356
           G+ N G+ C+++SV+Q+L +               V   N         +D+   F R+ 
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 357 VFPSTNLKCQLIKLR--------NALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQD 408
           +    N   +  K +        N + I PE +   +  +++ K      ++ + GRQ+D
Sbjct: 398 IVNELNETRENSKTKSKSSNLNENIISIDPEPFYKSI--STLPKF-----KDLTWGRQED 450

Query: 409 AMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQ 458
           A EFLT+ +D+L  +     ++ N ND++      + +  K   +KY S+
Sbjct: 451 AEEFLTHMLDQLHEEFIGSINTLNSNDILNIFQSLQEDDQKVFFLKYISK 500

>Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement
          Length = 754

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 71/153 (46%), Gaps = 17/153 (11%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLD---RKVFSKASSSNPND-----L 436
           V P S  + +  +N  FS+   QDA EFL + +++L    ++  S  S   PND     L
Sbjct: 421 VSPTSFVEILKRENVLFSTMMHQDAHEFLNFLLNELSDSLQRQISDDSIITPNDNFIDRL 480

Query: 437 MRFMVEDRLECTKCEHVKYSSQVCEILQIPL-LDSN---DPQFLMDRLHS--YFNGESLD 490
            +  + ++ +C  C+++  +S+    L  P+ ++ N   D Q ++   H     NG S  
Sbjct: 481 FKGTMTNQTKCLTCDNI--TSRDEPFLDFPIEVNGNCETDIQEMLSDFHQKEMLNG-SNK 537

Query: 491 IHCPQCSEITVATKNSMLKTAPATLLINPIRIK 523
            +C +C  +  A +   LK  P  L ++  R K
Sbjct: 538 FYCDKCCGLQEAERIVGLKQLPHILALHLKRFK 570

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 2/31 (6%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDML 349
           G  N GN+CY NSV+Q L+N  + ++ L++L
Sbjct: 147 GYENFGNTCYCNSVLQCLYN--LTEFRLNVL 175

>YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin
           C-terminal hydrolase [2067 bp, 688 aa]
          Length = 688

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           Y L+ ++ H G   Q GHYV+  K    G   W+L++DE + AV
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHEKFG---WLLFDDETVEAV 642

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 74/160 (46%), Gaps = 23/160 (14%)

Query: 385 VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL-------DRKVFSK--ASSSNP-- 433
           V P+S    +  +N  F++   QDA EF  + +++L       ++K+ +    S S P  
Sbjct: 410 VSPSSFVDVLKRENVLFNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDSEPSK 469

Query: 434 -----NDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQF-LMDRLHSYFNGE 487
                +DL +  + ++++C  C+++  +S+    L  P+    D +  + + L SY   E
Sbjct: 470 SKNFISDLFQGTLTNQIKCLTCDNI--TSRDEPFLDFPIEVQGDEETDIQEILKSYHQRE 527

Query: 488 SLD----IHCPQCSEITVATKNSMLKTAPATLLINPIRIK 523
            L+     +C +C  +  A +   LK  P TL ++  R K
Sbjct: 528 MLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFK 567

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 319 GLINLGNSCYLNSVVQVLFN 338
           G  N GN+CY NSV+Q L+N
Sbjct: 141 GYENFGNTCYCNSVLQCLYN 160

>CAGL0G02563g complement(235498..237393) weakly similar to sp|P36026
           Saccharomyces cerevisiae YKR098c UBP11 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 631

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 319 GLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHP 378
           G+ N+GN+CY+NS++Q LF G  +  +L +   F  ++    TN   + + + N L +  
Sbjct: 214 GIRNMGNTCYMNSMLQCLF-GSTQFRDLFLTDKF--EMFKAETN--SESLSIANDLSLLF 268

Query: 379 EK-YQHG---VKPASVKKCIGEDNEEFSSGR-QQDAMEFLTYFIDKL 420
           +K YQ+G   + P S  +       +F     QQD  EFL + +++L
Sbjct: 269 KKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLERL 315

>Sklu_1860.2 YMR304W, Contig c1860 839-2682
          Length = 615

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 691 DTQESIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYND 750
           D    +DP +S       D   Y L  V+ H G+ + +GHY   IK ++  E +W  ++D
Sbjct: 424 DLSPYLDPEISSS---NADSYIYDLHGVLVHTGD-ISTGHYYTMIKPSI--EDQWYRFDD 477

Query: 751 EKLMAVGGNENLQE 764
           +K+  V  N+  +E
Sbjct: 478 DKVWRVTKNQVFEE 491

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 79/209 (37%), Gaps = 15/209 (7%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
            G  N G +CYLNS++Q  F      +   ++   P D   P+ ++   L +    L   
Sbjct: 206 VGFKNQGATCYLNSLLQSYF---FTKYFRKLVYQIPTDKESPNNSVPLALQRAFFQL--- 259

Query: 378 PEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLM 437
            +K    +    + +  G D  +  +  Q D  E     +D+L+ K+         N++ 
Sbjct: 260 -QKSNEPLDTLELTRSFGWDTGD--AFTQHDVQELNRILMDRLENKMKGTDVDGKLNEV- 315

Query: 438 RFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLD---IHCP 494
              V       KC +V Y S   E      L+  + + L +   +Y   E +D    +  
Sbjct: 316 --FVGKMRSYIKCVNVDYESSRVEDFWDIQLNVKNLRGLQESFKNYIEVEMMDGENQYAA 373

Query: 495 QCSEITVATKNSMLKTAPATLLINPIRIK 523
           Q   +  A K  + ++ P  L +   R +
Sbjct: 374 QGYGLQDAKKGVVFESFPPVLHLQLKRFE 402

>Scas_623.2*
          Length = 795

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 53/260 (20%), Positives = 91/260 (35%), Gaps = 70/260 (26%)

Query: 319 GLINLGNSCYLNSVVQVLF-----------NGGVKDWNLD--------MLGDFPRDVVFP 359
           GL N+ NSCY+N ++Q L            N  +K  N++        ++  F + +   
Sbjct: 430 GLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLI--- 486

Query: 360 STNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDK 419
             ++  Q +K   +L  +P      VK    K      +  +S  +QQD  EF  + +D 
Sbjct: 487 -QDMHSQQVKTGRSLFSYP------VKTIDFKNACASVSSIYSGSQQQDCQEFCEFLLDG 539

Query: 420 LDRKV-----------------------------------FSKASSSNPNDLMRFMVEDR 444
           L   +                                   F   + S   DL       +
Sbjct: 540 LHEDLNQCGGNPPARELTDQEERLREGLCMRVASSMAWENFLHNNFSLIIDLFAGQYGSQ 599

Query: 445 LECTKCEHVKYSSQVCEILQIPLLDSNDPQ--FLMDRLHSYFNGESLD----IHCPQCSE 498
           L C  C++   + Q   +L +P+  S+      ++D    +   E LD      CPQC  
Sbjct: 600 LRCCVCQYTSTTYQPFTLLSVPVPLSSRVSRCSIIDCFQEFTKCERLDKDEEWFCPQCKR 659

Query: 499 ITVATKNSMLKTAPATLLIN 518
              +TK   +   P  L+I+
Sbjct: 660 KQPSTKQLKITRLPKNLIIH 679

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYND 750
           Y L+AV CH G ++ SGHY A++ K  D    W  ++D
Sbjct: 734 YQLNAVACHMG-TLGSGHYTAYVNKGPDV--GWYYFDD 768

>CAGL0K10252g complement(997315..1001118) similar to sp|Q01476
           Saccharomyces cerevisiae YOR124c UBP2 ubiquitin-specific
           proteinase, hypothetical start
          Length = 1267

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 284 LVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLF 337
           L ++ +E+N N      ++GN        ++ +  G+ N+GN+CYLNS++Q  F
Sbjct: 689 LTKIALERNSNLLLNFLETGN-INPNSLPAENWPTGINNIGNTCYLNSLLQFYF 741

>Sklu_2079.3 YDL122W, Contig c2079 1528-3903 reverse complement
          Length = 791

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 682 NNADNLDDDDTQESIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIK 736
           N A    D+D +  + PP+   Y  P     Y+L +VI H G     GHY+AF K
Sbjct: 677 NGAQIDGDNDERLDVPPPIPSSYTVPACPLTYSLRSVIVHYGTH-NYGHYIAFRK 730

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 292 NMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVL 336
           NM   +  R S  E  +++     Y  GL+N GN+C++NSV+Q L
Sbjct: 76  NMLGGWGQRRSEQE--ERVLKKGGYVGGLVNDGNTCFMNSVLQSL 118

>CAGL0M13783g 1352648..1356238 similar to sp|P50101 Saccharomyces
           cerevisiae YMR304w UBP15, hypothetical start
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 713 YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQE 764
           Y L  V+ H G+ + +GHY   IK  +  E +W  ++DE++  V  N+  +E
Sbjct: 439 YNLHGVLVHAGD-ISTGHYYTLIKPGL--EDQWYRFDDERVWKVTKNQVFEE 487

>Kwal_55.19645
          Length = 970

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 72/189 (38%), Gaps = 43/189 (22%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
            GL N+GN+CY+NS++Q LF    + +    L     D      +   QL K  N L   
Sbjct: 556 TGLRNMGNTCYINSMLQCLF--ATRKFRDLFLSPKYEDYFSKRYSNPHQLSKYFNIL--F 611

Query: 378 PEKYQHG----VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL------------- 420
            + Y +G    V    +K C     +      QQD  EFL + + +L             
Sbjct: 612 KKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELSESNHVAND 671

Query: 421 --------------DRKVFSKASSSN-------PND-LMRFMVEDRLECTKCEHVKYSSQ 458
                         D+K + K   SN       P D + +  +E+ L C +C H  Y+  
Sbjct: 672 YPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRCGHSSYNYS 731

Query: 459 VCEILQIPL 467
           +  +L + +
Sbjct: 732 MFYVLSLAI 740

>Scas_698.7
          Length = 1030

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 11/109 (10%)

Query: 318 CGLINLGNSCYLNSVVQVLF-NGGVKDWNL-DMLGDFPRDVVFPSTNLKCQLIKLRNALK 375
            GL NLGN+CY+NS++Q LF     +D  L      F     FP++ +      L     
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFPNSPMISNSFNL----- 662

Query: 376 IHPEKYQHG---VKPAS-VKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420
           +  + Y +G   V P S +K C     +      QQD  EFL   +D+L
Sbjct: 663 LFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRL 711

>Sklu_1620.2 YER151C, Contig c1620 788-3106
          Length = 772

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 24/146 (16%)

Query: 319 GLINLGNSCYLNSVVQVLF--NGGVKDWNLDMLGDFPR--DVVFPSTNLKCQLI------ 368
           G++N GN C+++SV+QVL      +   N+       +    V PS +   +L       
Sbjct: 334 GIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKIGSSVSPSLDACLELYRRFDKQ 393

Query: 369 ------------KLRNALKIHPEKYQHGVKPASVKKCIGE--DNEEFSSGRQQDAMEFLT 414
                       KL N   +        +KP    K + +     +   G Q+DA EFLT
Sbjct: 394 TCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLSKLPKFRDLRWGHQEDAEEFLT 453

Query: 415 YFIDKLDRKVFSKASSSNPNDLMRFM 440
           + +D+L  +  +   + N +D+M  +
Sbjct: 454 HLLDQLHEEFITSIDALNESDIMNLL 479

>Kwal_55.21267
          Length = 604

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 585 EDKVISIISMGFSKNAALRALYNTGSEVERALNWIF 620
           E  + S++ MG +++ A+ AL  T  +VE ++N+IF
Sbjct: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38

>CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces
           cerevisiae YMR223w UBP8, start by similarity
          Length = 461

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 699 PVSRDYGYPGDIPD--YALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAV 756
           P  +D   P + P   Y L  +I H G SV  GHYVAF K   +GE  W  +ND  +  +
Sbjct: 385 PYLKDNQNPDEDPSILYELIGIISHTG-SVNEGHYVAFCKIE-NGE--WFKFNDSMVTKI 440

Query: 757 GGNENLQE 764
              + L+E
Sbjct: 441 LEKDVLKE 448

>CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02863
           Saccharomyces cerevisiae YPL072w UBP16, hypothetical
           start
          Length = 483

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 64/154 (41%), Gaps = 23/154 (14%)

Query: 315 EYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVV-------FPSTNLK--- 364
           +Y  GL+N GN CY NSV+Q L        ++D   D+    V         S  L+   
Sbjct: 69  KYTTGLVNKGNYCYANSVIQAL-------SSIDYFSDYINKFVIGIDENEISSAGLEKTD 121

Query: 365 CQLIKLRNALKIHPEKYQHGV---KPASVKKCIGEDNEEFS---SGRQQDAMEFLTYFID 418
            + + L  AL     K Q  +     A +K  +     + S   S  Q DA EFL   ++
Sbjct: 122 TEALLLHRALADLLRKLQMVIFEPTNADIKHLVSVLEWKVSGRLSRAQNDAHEFLQVLLE 181

Query: 419 KLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEH 452
           +L  ++ +   +S+        + +  +C +C+H
Sbjct: 182 QLHVELSNSHKTSSCKFPFAGTIIESYKCLQCQH 215

>KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces
           cerevisiae YIL156w UBP7 ubiquitin carboxy terminal
           hydrolase, start by similarity
          Length = 1012

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
            GL N+GN+CY+NS++Q LF G  +  +L + G + R +    +N    +I    +L + 
Sbjct: 588 TGLRNMGNTCYINSMLQCLF-GCSQFRDLFLGGKYHRYLNPKRSN---TIISKWFSL-LF 642

Query: 378 PEKYQHG----VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVF--SKASSS 431
            + Y +G    V    +K C     +      QQD  EFL + +D L  ++   +K ++ 
Sbjct: 643 RKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKVAND 702

Query: 432 NPNDLM 437
            PN L+
Sbjct: 703 YPNLLL 708

>AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH]
           (1443891..1446218) [2328 bp, 775 aa]
          Length = 775

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 288 QVEQNMNWDFQMRDSGN------EFTKKIFASKEYGCGLINLGNSCYLNSVVQVL 336
           QV  N   DF+ R  G       E  K+         GL+N GN+C++NSV+Q L
Sbjct: 52  QVAGNFTRDFRHRMLGRWAPQSAELEKQAHQHGGNVGGLVNDGNTCFINSVIQSL 106

>CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces
           cerevisiae YOR138c, hypothetical start
          Length = 603

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 646 QGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDD 690
           +G + S++ MG+A     +AL   +GDV  ++ ++FN  + +D+D
Sbjct: 4   EGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEIDND 48

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 585 EDKVISIISMGFSKNAALRALYNTGSEVERALNWIF 620
           E  V S++ MG +++ A +AL     +VE ALN+IF
Sbjct: 4   EGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIF 39

>Scas_714.11
          Length = 1269

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 314 KEYGCGLINLGNSCYLNSVVQVLFN 338
           K++  G+ N+GN+CYLNS++Q  F+
Sbjct: 709 KDWPAGINNIGNTCYLNSLLQYYFS 733

>Kwal_27.10842
          Length = 711

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 319 GLINLGNSCYLNSVVQVLFN 338
           G  N GN+CY NSV+QVL+N
Sbjct: 144 GYENFGNTCYCNSVLQVLYN 163

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 71/184 (38%), Gaps = 38/184 (20%)

Query: 370 LRNALK-----IHPEKYQHGV-KPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL--- 420
           L  ALK     I   KY  GV  P    + + ++N  FS+   QDA EFL + ++++   
Sbjct: 360 LYTALKDLYESITENKYLTGVVSPIQFVETLKKENVLFSTMMHQDAHEFLNFLLNEVSDY 419

Query: 421 ----DRKVFSKASSSNPND------LMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLD- 469
                 ++       NP D      L +  + +R +C  C++  Y ++       P LD 
Sbjct: 420 LGAHSEQIAQGLDVKNPGDINFVNRLFQGTLTNRTKCLTCDNTTYRNE-------PFLDF 472

Query: 470 --------SNDPQFLMDRLHS--YFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINP 519
                     D Q  +   H     NG +   +C  C  +  A +   LK  P  L ++ 
Sbjct: 473 AIEVQQDSETDIQTTLADFHQKELLNGAN-KFYCDVCCGLQEAERVVGLKQLPFYLALHM 531

Query: 520 IRIK 523
            R K
Sbjct: 532 KRFK 535

>Kwal_55.21393
          Length = 1233

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 313 SKEYGCGLINLGNSCYLNSVVQVLF 337
           ++ +  GL N+GN+CYLNS++Q  F
Sbjct: 698 ARNWPTGLNNIGNTCYLNSLLQYYF 722

>Scas_695.7
          Length = 482

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 319 GLINLGNSCYLNSVVQVL 336
           GLIN GNSC++NSV+Q L
Sbjct: 28  GLINNGNSCFMNSVLQAL 45

>Kwal_27.11444
          Length = 757

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 316 YGCGLINLGNSCYLNSVVQVL 336
           Y  GLIN GN+C++NSV+Q L
Sbjct: 96  YVGGLINDGNTCFMNSVIQSL 116

>YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protein
           containing a UBA (ubiquitin associated) or TS-N domain
           [2016 bp, 671 aa]
          Length = 671

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 584 DEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPE 627
           D   V S++ MG     A+ AL  TG  +E A+N+IF + E PE
Sbjct: 3   DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-ELPE 45

>Scas_664.17
          Length = 494

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 83/201 (41%), Gaps = 28/201 (13%)

Query: 315 EYGCGLINLGNSCYLNSVVQVLFN-GGVKDWNLDMLGDFPRDVVFPSTN-LKCQLIKLRN 372
           ++  GL+N GN C++NS +Q L     +  +    L D       P  N L   L++L+ 
Sbjct: 73  KFTTGLVNPGNDCFINSSIQALVPLDKLTTYLSATLEDEKTASTLPLHNGLATMLLELQQ 132

Query: 373 ALKIHPEKYQHGVKPASVKKCIGEDNEEFS---SGRQQDAMEFLTYFIDKLDRK--VFSK 427
            L+  P       K  S K+ I +    F    S +Q DA EF    +++L+ +      
Sbjct: 133 -LRSDP-------KSVSSKRFIQQLETIFGGKISRQQNDAHEFTQLILERLNEENLTLDH 184

Query: 428 ASSSNPNDLMRFMVEDRLECTKCEHVKY-SSQVCEILQIPLLDSNDPQFLMDRLHSYFNG 486
           A  + P    + +V + L C +C    + + Q   I ++ L     PQ    +L    NG
Sbjct: 185 ADLTVP---FKGIVGNHLVCLQCGRTSHVNEQPFYIYELTL-----PQQGSVKLSDLVNG 236

Query: 487 ESLDI----HCPQCSEITVAT 503
           E ++      C  C  + + T
Sbjct: 237 EQMETIENYSCMYCKTVAMLT 257

>CAGL0H06721g complement(667816..671061) similar to sp|P40453
           Saccharomyces cerevisiae YIL156w UBP7, hypothetical
           start
          Length = 1081

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 103/253 (40%), Gaps = 58/253 (22%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
            GL NLGN+CY+N ++Q LF    +  NL + G +    + P+ N +  +        + 
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATN-ELKNLFISGKYREYQMKPNDNKESAISN--TFANLF 704

Query: 378 PEKYQHG----VKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSN- 432
            + Y +G    V    +K C     +      QQD  EFL + +++L  ++ ++ +  N 
Sbjct: 705 NKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIND 764

Query: 433 -PNDLM----RFMV-----------------------------EDRLECTKC--EHVKYS 456
            PN L+    + MV                             E+ L+C +C  E V YS
Sbjct: 765 YPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYS 824

Query: 457 SQVCEILQIPLLDSNDPQF-------LMDRLHSYFNGESLD----IHCPQCSEITVATKN 505
           +    +L + L   + P F       L D ++ + + E L       CP+C    V  + 
Sbjct: 825 T--FYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRF 882

Query: 506 SMLKTAPATLLIN 518
           +  +T+  T+L N
Sbjct: 883 TS-RTSTQTILPN 894

>CAGL0I06600g 639096..641546 similar to sp|Q01477 Saccharomyces
           cerevisiae YER151c UBP3 ubiquitin-specific proteinase,
           hypothetical start
          Length = 816

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 404 GRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFM 440
           G Q+DA EFLT+ +D+L  ++ S   S + N+++  +
Sbjct: 488 GHQEDAEEFLTHLLDQLHEELISAIDSLSENEILNLL 524

>KLLA0E02376g complement(218647..222309)
           gi|6136095|sp|O42726|UBP2_KLULA Kluyveromyces lactis
           Ubiquitin carboxyl-terminal hydrolase 2 (Ubiquitin
           thiolesterase 2) (Ubiquitin-specific processing protease
           2) (Deubiquitinating enzyme 2), start by similarity
          Length = 1220

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 316 YGCGLINLGNSCYLNSVVQVLF 337
           +  G+ N+GN+CYLNS++Q  F
Sbjct: 696 WPAGINNVGNTCYLNSLLQFFF 717

>KLLA0C13970g 1201452..1202579 similar to sp|P50101 Saccharomyces
           cerevisiae YMR304w UBP15, start by similarity
          Length = 375

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 67/174 (38%), Gaps = 14/174 (8%)

Query: 318 CGLINLGNSCYLNSVVQVL-FNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKI 376
            G  N G +CYLNS++Q   F    +     ++   P +   P+ ++   L +    L+ 
Sbjct: 197 VGFKNQGATCYLNSLLQSYHFTKLFR----KLVYQIPTEDENPTNSVALALQRAFYLLQT 252

Query: 377 HPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDL 436
             E     +    + K  G D  +  +  Q D  E     +D+L+ ++   +     N+L
Sbjct: 253 SKEP----LDTTELTKSFGWDTGD--AFTQHDVQELNRILMDRLEHRMKGTSVEGKINEL 306

Query: 437 MRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQFLMDRLHSYFNGESLD 490
               V     C KC +V Y S   E      L+  D + L +    Y   E ++
Sbjct: 307 ---FVGKMKSCIKCINVDYESSRVEDFWDIQLNVKDMKNLQESFEQYIEVELMN 357

>KLLA0E10318g complement(911148..912392) similar to sp|P40087
           Saccharomyces cerevisiae YER143w DDI1 induced in
           response to DNA alkylation damage singleton, start by
           similarity
          Length = 414

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 571 NSNVPASAISFNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFE 621
           N  VP+ A      E  +  ++ +GFS+  A+ AL  TG  V+ A + +F+
Sbjct: 370 NQTVPSFA------ESDIKKLVDLGFSRKEAINALNKTGGNVDYAASLLFQ 414

>CAGL0F06523g complement(642553..644835) similar to sp|P36009
           Saccharomyces cerevisiae YKL078w JA2, hypothetical start
          Length = 760

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 10/59 (16%)

Query: 550 SQFKAHGRQPGEKIFEDS---PDDNSNVPASAISFNPDEDKVISIIS---MGFSKNAAL 602
           SQ K++ +    KIF+++   PDD+  +       N +ED++ +I+     GFSKN A+
Sbjct: 631 SQLKSYCK----KIFDNTHLKPDDDDEISGEQFKLNANEDEIKTILKCFLSGFSKNTAI 685

>ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..71961)
           [4170 bp, 1389 aa]
          Length = 1389

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 318 CGLINLGNSCYLNSVVQVLF 337
            G+ N+GN+CYLNS++Q  F
Sbjct: 677 TGINNIGNTCYLNSLLQYYF 696

>YOR124C (UBP2) [4926] chr15 complement(554824..558642)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), cleaves at the C-terminus of ubiquitin [3819
           bp, 1272 aa]
          Length = 1272

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 318 CGLINLGNSCYLNSVVQVLFN 338
            G+ N+GN+CYLNS++Q  F+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFS 756

>Kwal_26.9598
          Length = 1191

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 54/135 (40%), Gaps = 9/135 (6%)

Query: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377
            G  N G +CYLNS++Q  F   +      M+   P D   P+ ++   L +    L   
Sbjct: 202 IGFKNQGATCYLNSLLQSYFFTKLFR---KMVYKIPSDNESPNDSVSLALQRSFYLL--- 255

Query: 378 PEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLM 437
            EK +  +    + +  G D  E  +  Q D  E     +D+L+ ++         NDL 
Sbjct: 256 -EKSKEPLDTLELTRSFGWDTGE--AFTQHDVQELNRILMDRLETRMKGTEVEGTLNDLF 312

Query: 438 RFMVEDRLECTKCEH 452
              ++  + C   ++
Sbjct: 313 VGKMKSYIRCVNVDY 327

>Kwal_14.1957
          Length = 444

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 59/138 (42%), Gaps = 20/138 (14%)

Query: 319 GLINLGNSCYLNSVVQVLF--NGGVKDWNLDMLGDFPR--DVVFPSTNLKCQLIKLRNAL 374
           G++N GN C+++S++QVL      V   NL  +    +  +  F   +   +L +  + +
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKTSAKMGNTGFLLLDACLELYRKFDKV 69

Query: 375 KIHPEKYQH--------------GVKPASVKKCIGE--DNEEFSSGRQQDAMEFLTYFID 418
               EK                  +KP    K + +    ++   G Q+DA EFLT+ +D
Sbjct: 70  TFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRWGHQEDAEEFLTHLLD 129

Query: 419 KLDRKVFSKASSSNPNDL 436
           +L  +      S + ND+
Sbjct: 130 QLHEEFVQSIDSLSDNDV 147

>KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces
           cerevisiae YDL122w UBP1 ubiquitin-specific protease
           singleton, start by similarity
          Length = 771

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 316 YGCGLINLGNSCYLNSVVQVL 336
           Y  GL+N GN+C++NSV+Q L
Sbjct: 82  YVGGLVNDGNTCFMNSVLQCL 102

>KLLA0A04433g complement(402462..403532) similar to sp|P32502
           Saccharomyces cerevisiae YLR291c GCD7 translation
           initiation factor eIF2b, 43 kDa subunit, start by
           similarity
          Length = 356

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 576 ASAISFNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAE 631
            SAI +   ED ++ I   G+S   A    Y  G+ V R L+ I +  E+ + +AE
Sbjct: 38  VSAIRWTSTEDLILQIKKFGYSLEKAQPYEYTCGNVVRRVLSMIRDETEEEQTSAE 93

>AEL258W [2248] [Homologous to ScYBR186W (PCH2) - SH]
           complement(152451..153911,153967..154086) [1581 bp, 526
           aa]
          Length = 526

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 411 EFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDS 470
           +F+   ID+++   FS++S  N N+    +       T+ +++K       +    LLDS
Sbjct: 363 QFVCLLIDEVETIAFSRSSLINKNETTDAIRVVNTLLTQLDNMKKYKNFLTLATSNLLDS 422

Query: 471 NDPQFLMDRLHSYFN 485
            DP F+ DR    FN
Sbjct: 423 MDPAFI-DRADGIFN 436

>YNL022C (YNL022C) [4565] chr14 complement(591425..592897) Protein
           of unknown function, localizes to the nuclear membrane
           throughout the cell cycle [1473 bp, 490 aa]
          Length = 490

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 66  RRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSEEELYETV 111
           +R+Q   H +   V K + P  +E  + +LKL+V++LSE  L E +
Sbjct: 101 KRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLKVRELSELVLSEDI 146

>Scas_555.6
          Length = 917

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%)

Query: 404 GRQQDAMEFLTYFIDKLDRKVFS 426
           GRQ+DA EFLT+ +D+L  ++ S
Sbjct: 590 GRQEDAEEFLTHLLDQLHEELVS 612

>AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C
           (UBP11) - SH] (972525..976034) [3510 bp, 1169 aa]
          Length = 1169

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 318 CGLINLGNSCYLNSVVQVLFN 338
            GL N+ N+CY+NS++Q LF+
Sbjct: 746 TGLRNMSNTCYINSMLQCLFS 766

>Scas_553.3*
          Length = 1025

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 18/112 (16%)

Query: 412 FLTYFIDKLDRKVFSKASSSNPNDLMR-FMVEDRLECTKCEHVKYSSQVCEILQIPLLDS 470
           + T F ++ D + F+      P  + + FM ED+L C K   +KY S+ C+  Q P+ D 
Sbjct: 110 YYTAFGNRYDEEHFACTICKEPCGVKKCFMFEDQLYC-KYHFLKYFSKRCKGCQYPISD- 167

Query: 471 NDPQFLMDRLHSYFNGESLDIHC--PQCSEITVATKNSMLKTAPATLLINPI 520
              Q++          E  D+HC  P+C  I    K   +  +P TL ++P+
Sbjct: 168 ---QYIE-------FPEGNDVHCWHPECYGI---HKYWHVDLSPETLGLSPL 206

>Kwal_33.13860
          Length = 578

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 545 KRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDK 587
           KR KL+   A     GEK  + SP  +++ PASA + +P + K
Sbjct: 87  KRTKLTALVAAANSVGEKTPDSSPRKDAHRPASATAAHPTQSK 129

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,634,835
Number of extensions: 1212887
Number of successful extensions: 3911
Number of sequences better than 10.0: 104
Number of HSP's gapped: 3882
Number of HSP's successfully gapped: 154
Length of query: 765
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 656
Effective length of database: 12,822,747
Effective search space: 8411722032
Effective search space used: 8411722032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)