Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL311C36234418220.0
Sklu_2334.231930613560.0
CAGL0M09020g34832812581e-174
YJR095W (SFC1)32230612271e-170
Kwal_47.1821633332912201e-169
KLLA0F03212g30530312101e-168
Scas_691.433432512131e-168
CAGL0L02079g2972983893e-44
Sklu_1149.22963003815e-43
YBR291C (CTP1)2992993791e-42
Kwal_26.79672972993632e-40
KLLA0E18810g3773013648e-40
Scas_489.42972943581e-39
Scas_640.253063043371e-36
Kwal_26.86692962863125e-33
YPR021C (AGC1)9022893212e-32
ACR109W2992953072e-32
Scas_602.88852973203e-32
AGL064W2962953002e-31
Scas_718.53243082953e-30
Scas_589.103163002917e-30
ADL049W9122852992e-29
KLLA0D07073g2973002872e-29
Sklu_2359.69022852983e-29
Kwal_27.125993042942863e-29
CAGL0K02365g9192862983e-29
YOR222W (ODC2)3073172839e-29
CAGL0D01606g3052902793e-28
Kwal_47.173218812892894e-28
ACR260W3112952751e-27
YPL134C (ODC1)3102922751e-27
CAGL0J04114g3032942741e-27
CAGL0K12210g3112952724e-27
Scas_667.223063072706e-27
YEL006W3353122691e-26
CAGL0H03839g2822982642e-26
YPR058W (YMC1)3072932628e-26
KLLA0B08503g3033072601e-25
KLLA0E13453g9062992692e-25
CAGL0J02002g3613022622e-25
Scas_582.73292932602e-25
KLLA0E15532g3263052584e-25
YBR104W (YMC2)3293032584e-25
Kwal_56.230113033032557e-25
CAGL0K08250g2972942548e-25
Scas_558.22893022539e-25
Scas_709.93653262571e-24
Kwal_0.2322742962521e-24
Scas_632.92923012531e-24
KLLA0F17864g3072992513e-24
Sklu_2442.82753032475e-24
Kwal_33.129883032902495e-24
Kwal_33.140503142992487e-24
Sklu_1926.23053122487e-24
Sklu_1275.13113062488e-24
CAGL0L05742g3052982461e-23
YJL133W (MRS3)3142942461e-23
YNL003C (PET8)2842982432e-23
YKR052C (MRS4)3042932363e-22
Sklu_2398.43093172363e-22
KLLA0C11363g5173172414e-22
Scas_578.3*5243082415e-22
AFR146W2812902336e-22
AGL047C3163242339e-22
Scas_379.23012952321e-21
YPR011C3263282331e-21
Kwal_23.30425423172362e-21
AAL014C2712912282e-21
Sklu_2127.52782872283e-21
Kwal_55.213353172852294e-21
Kwal_14.22103153202284e-21
YOR130C (ORT1)2922882266e-21
YLR348C (DIC1)2982992251e-20
YIL006W3732992271e-20
KLLA0D04950g2742932221e-20
Sklu_2431.53703572261e-20
Sklu_2374.75133172263e-20
KLLA0E02772g2842912195e-20
Kwal_26.76533252152198e-20
Scas_716.293163212181e-19
CAGL0G08910g2892942152e-19
KLLA0F04697g3073082162e-19
Scas_697.473282922172e-19
Scas_721.273743692182e-19
ADL264C3293062162e-19
CAGL0J05522g5193162193e-19
CAGL0C02013g3293312153e-19
YNL083W5453152184e-19
KLLA0E23705g3683412164e-19
CAGL0K10362g3012992126e-19
CAGL0G03135g3073162119e-19
Sklu_2432.52883012091e-18
YOR100C (CRC1)3273142111e-18
KLLA0D14036g4313262122e-18
CAGL0J09790g3002952092e-18
KLLA0D15015g3173092082e-18
Kwal_23.35293952882102e-18
Sklu_2363.23233222074e-18
AER419W4933022087e-18
Kwal_23.29133203382049e-18
Scas_702.103022982039e-18
Kwal_55.208683803102051e-17
Sklu_2037.23103202031e-17
YBR192W (RIM2)3773442051e-17
KLLA0A09383g3662552041e-17
YMR166C3683182041e-17
AEL253W3653662041e-17
Scas_662.123083122012e-17
Scas_714.183053061993e-17
CAGL0K07436g3072841993e-17
CAGL0J01661g3273242003e-17
Kwal_27.120813693212004e-17
Scas_721.1293232091985e-17
YGR096W (TPC1)3143141986e-17
AFR131C3443571987e-17
Kwal_23.47313143091978e-17
Sklu_2430.103242031969e-17
KLLA0F13464g3002921951e-16
Kwal_34.159073122991951e-16
YKL120W (OAC1)3242031951e-16
Sklu_2075.33453101961e-16
CAGL0F07711g3683131942e-16
Kwal_47.192282812761922e-16
CAGL0K02915g3423231933e-16
KLLA0C13431g3283051933e-16
KLLA0A00979g3433521933e-16
Sklu_2117.22983061923e-16
AAR036W3173121923e-16
YJR077C (MIR1)3112821914e-16
Scas_687.15*3283291924e-16
CAGL0M05225g3813461934e-16
CAGL0B04543g3172941915e-16
Kwal_23.39653073261906e-16
Kwal_33.154463053111897e-16
CAGL0K11616g3202031897e-16
Scas_562.123003051871e-15
Sklu_2194.33122671871e-15
ADL009W3793051891e-15
YDL198C (YHM1)3002981862e-15
Kwal_27.116262993061852e-15
AGR191W2983061852e-15
KLLA0B12826g3192031853e-15
YIL134W (FLX1)3113101844e-15
KLLA0F08547g3082681844e-15
AFR147C3152531826e-15
KLLA0E09680g3073071817e-15
CAGL0G01166g2953001791e-14
Scas_669.63733001765e-14
AGL065C3353161756e-14
YMR241W (YHM2)3142841747e-14
CAGL0F08305g3742651757e-14
KLLA0D09889g3642901758e-14
Sklu_1119.13072851721e-13
Sklu_2433.84203281741e-13
AER366W2933021692e-13
Kwal_23.43543432511703e-13
CAGL0B03883g3063121693e-13
YGR257C (MTM1)3662751704e-13
AFR542W3102641675e-13
Scas_673.173142841675e-13
AFL196W3612861686e-13
AFR253W3443241686e-13
Scas_645.93912801686e-13
Sklu_2115.42993111641e-12
Kwal_33.155973052851632e-12
CAGL0F00231g3072881623e-12
CAGL0H10538g2973161613e-12
Kwal_26.79723583341615e-12
Scas_696.93122951605e-12
Scas_717.203563321606e-12
Sklu_2260.53022851571e-11
CAGL0D04774g3223121571e-11
YHR002W (LEU5)3573201572e-11
YBR085W (AAC3)3073061543e-11
Kwal_23.57573072791534e-11
Kwal_55.213383232781526e-11
YMR056C (AAC1)3092831501e-10
KLLA0D04290g1881811451e-10
Scas_667.43082921491e-10
YPR128C (ANT1)3283041482e-10
KLLA0B14454g3052851482e-10
KLLA0E02750g3043041472e-10
Kwal_27.124813043091462e-10
AER184W3052941453e-10
Scas_715.453052871436e-10
Sklu_2127.43232991446e-10
Sklu_2435.23443231421e-09
AER450C3082791411e-09
KLLA0E18788g3813271412e-09
YER053C3002811392e-09
Kwal_27.114192983091383e-09
Scas_718.243373081383e-09
YBL030C (PET9)3183011384e-09
YFR045W2852071365e-09
AGR383W2933101357e-09
ABL023W3091921357e-09
KLLA0E08877g2943021349e-09
Scas_705.93233001312e-08
CAGL0F04213g3063061251e-07
KLLA0E12353g3052901197e-07
Kwal_55.211063283071198e-07
KLLA0B11319g3552621135e-06
ADR036C3401591073e-05
YDL119C3073301002e-04
KLLA0D04312g10398905e-04
Scas_328.1227135870.005
Scas_613.2417787810.024
KLLA0E22880g43679820.039
Scas_671.1*12380740.089
KLLA0D10483g122039663.8
AEL060C42940636.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL311C
         (355 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   706   0.0  
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        526   0.0  
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   489   e-174
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   477   e-170
Kwal_47.18216                                                         474   e-169
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   470   e-168
Scas_691.4                                                            471   e-168
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...   154   3e-44
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement        151   5e-43
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...   150   1e-42
Kwal_26.7967                                                          144   2e-40
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...   144   8e-40
Scas_489.4                                                            142   1e-39
Scas_640.25                                                           134   1e-36
Kwal_26.8669                                                          124   5e-33
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   128   2e-32
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   122   2e-32
Scas_602.8                                                            127   3e-32
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...   120   2e-31
Scas_718.5                                                            118   3e-30
Scas_589.10                                                           116   7e-30
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   119   2e-29
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   115   2e-29
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         119   3e-29
Kwal_27.12599                                                         114   3e-29
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   119   3e-29
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   113   9e-29
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   112   3e-28
Kwal_47.17321                                                         115   4e-28
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...   110   1e-27
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   110   1e-27
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   110   1e-27
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   109   4e-27
Scas_667.22                                                           108   6e-27
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   108   1e-26
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...   106   2e-26
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   105   8e-26
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   104   1e-25
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   108   2e-25
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...   105   2e-25
Scas_582.7                                                            104   2e-25
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...   103   4e-25
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   103   4e-25
Kwal_56.23011                                                         102   7e-25
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...   102   8e-25
Scas_558.2                                                            102   9e-25
Scas_709.9                                                            103   1e-24
Kwal_0.232                                                            101   1e-24
Scas_632.9                                                            102   1e-24
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   101   3e-24
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                         100   5e-24
Kwal_33.12988                                                         100   5e-24
Kwal_33.14050                                                         100   7e-24
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         100   7e-24
Sklu_1275.1 , Contig c1275 314-1249                                   100   8e-24
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    99   1e-23
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    99   1e-23
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    98   2e-23
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    96   3e-22
Sklu_2398.4 , Contig c2398 9476-10405                                  96   3e-22
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    97   4e-22
Scas_578.3*                                                            97   5e-22
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    94   6e-22
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    94   9e-22
Scas_379.2                                                             94   1e-21
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    94   1e-21
Kwal_23.3042                                                           96   2e-21
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    92   2e-21
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         92   3e-21
Kwal_55.21335                                                          93   4e-21
Kwal_14.2210                                                           92   4e-21
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    92   6e-21
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    91   1e-20
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    92   1e-20
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    90   1e-20
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            92   1e-20
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       92   3e-20
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    89   5e-20
Kwal_26.7653                                                           89   8e-20
Scas_716.29                                                            89   1e-19
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    87   2e-19
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    88   2e-19
Scas_697.47                                                            88   2e-19
Scas_721.27                                                            89   2e-19
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    88   2e-19
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    89   3e-19
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    87   3e-19
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    89   4e-19
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    88   4e-19
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    86   6e-19
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    86   9e-19
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       85   1e-18
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    86   1e-18
KLLA0D14036g complement(1203522..1204817) some similarities with...    86   2e-18
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    85   2e-18
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    85   2e-18
Kwal_23.3529                                                           86   2e-18
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          84   4e-18
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    85   7e-18
Kwal_23.2913                                                           83   9e-18
Scas_702.10                                                            83   9e-18
Kwal_55.20868                                                          84   1e-17
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         83   1e-17
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    84   1e-17
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    83   1e-17
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    83   1e-17
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    83   1e-17
Scas_662.12                                                            82   2e-17
Scas_714.18                                                            81   3e-17
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    81   3e-17
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    82   3e-17
Kwal_27.12081                                                          82   4e-17
Scas_721.129                                                           81   5e-17
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    81   6e-17
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    81   7e-17
Kwal_23.4731                                                           80   8e-17
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         80   9e-17
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    80   1e-16
Kwal_34.15907                                                          80   1e-16
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    80   1e-16
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                80   1e-16
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    79   2e-16
Kwal_47.19228                                                          79   2e-16
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    79   3e-16
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    79   3e-16
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    79   3e-16
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            79   3e-16
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    79   3e-16
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    78   4e-16
Scas_687.15*                                                           79   4e-16
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    79   4e-16
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    78   5e-16
Kwal_23.3965                                                           78   6e-16
Kwal_33.15446                                                          77   7e-16
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    77   7e-16
Scas_562.12                                                            77   1e-15
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            77   1e-15
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    77   1e-15
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    76   2e-15
Kwal_27.11626                                                          76   2e-15
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    76   2e-15
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    76   3e-15
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    75   4e-15
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    75   4e-15
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    75   6e-15
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    74   7e-15
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    74   1e-14
Scas_669.6                                                             72   5e-14
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    72   6e-14
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    72   7e-14
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    72   7e-14
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    72   8e-14
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             71   1e-13
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       72   1e-13
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    70   2e-13
Kwal_23.4354                                                           70   3e-13
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    70   3e-13
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    70   4e-13
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    69   5e-13
Scas_673.17                                                            69   5e-13
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    69   6e-13
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    69   6e-13
Scas_645.9                                                             69   6e-13
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            68   1e-12
Kwal_33.15597                                                          67   2e-12
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    67   3e-12
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    67   3e-12
Kwal_26.7972                                                           67   5e-12
Scas_696.9                                                             66   5e-12
Scas_717.20                                                            66   6e-12
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         65   1e-11
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    65   1e-11
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    65   2e-11
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    64   3e-11
Kwal_23.5757                                                           64   4e-11
Kwal_55.21338                                                          63   6e-11
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    62   1e-10
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    60   1e-10
Scas_667.4                                                             62   1e-10
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    62   2e-10
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    62   2e-10
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    61   2e-10
Kwal_27.12481                                                          61   2e-10
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    60   3e-10
Scas_715.45                                                            60   6e-10
Sklu_2127.4 , Contig c2127 6322-7293                                   60   6e-10
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         59   1e-09
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    59   1e-09
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    59   2e-09
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    58   2e-09
Kwal_27.11419                                                          58   3e-09
Scas_718.24                                                            58   3e-09
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    58   4e-09
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    57   5e-09
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    57   7e-09
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    57   7e-09
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    56   9e-09
Scas_705.9                                                             55   2e-08
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    53   1e-07
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    50   7e-07
Kwal_55.21106                                                          50   8e-07
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    48   5e-06
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    46   3e-05
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    43   2e-04
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    39   5e-04
Scas_328.1                                                             38   0.005
Scas_613.24                                                            36   0.024
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    36   0.039
Scas_671.1*                                                            33   0.089
KLLA0D10483g complement(884177..887839) similar to sp|Q02773 Sac...    30   3.8  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    29   6.5  

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/344 (100%), Positives = 344/344 (100%)

Query: 12  QGAGGPPSVPVVYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFE 71
           QGAGGPPSVPVVYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFE
Sbjct: 12  QGAGGPPSVPVVYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFE 71

Query: 72  ALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKM 131
           ALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKM
Sbjct: 72  ALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKM 131

Query: 132 AIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHG 191
           AIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHG
Sbjct: 132 AIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHG 191

Query: 192 AAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG 251
           AAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG
Sbjct: 192 AAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG 251

Query: 252 SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEE 311
           SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEE
Sbjct: 252 SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEE 311

Query: 312 GFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGSAK 355
           GFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGSAK
Sbjct: 312 GFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGSAK 355

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/306 (84%), Positives = 276/306 (90%), Gaps = 2/306 (0%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRR-ANEGTKPPGFLRTGANIY 108
           S KKS+NPAVNL+AGGTAGLFEALCCHPLDTIKVRMQIYRR A EG KPPGF++TG NIY
Sbjct: 3   SKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIY 62

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
           + EGLLA YKGLGAVVIGIIPKMAIRFSSYEFYR+ LAD+QTG VSTGNTFLAGVGAG T
Sbjct: 63  TEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTT 122

Query: 169 EAVLVVNPMEVVKIRLQAQHLH-GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
           EAVLVVNPMEVVKIRLQAQHLH   A   +YRNA+QA YLIVKEEGIGALYRGVSLTAAR
Sbjct: 123 EAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAAR 182

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
           QATNQGANFTVYSKL E LQE+H +  LPSWETS IGL+SGAIGPFSNAPLDTIKTRLQK
Sbjct: 183 QATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 242

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEG 347
           DKST N+S W RI TIG+QL++EEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR HLE 
Sbjct: 243 DKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLET 302

Query: 348 LGLFGS 353
           LG+F S
Sbjct: 303 LGIFKS 308

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  489 bits (1258), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 249/328 (75%), Positives = 266/328 (81%), Gaps = 32/328 (9%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRR------------------------- 90
           NP VNLVAGGTAGLFEALCCHPLDTIKVRMQIY+R                         
Sbjct: 10  NPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVG 69

Query: 91  ---ANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 147
              A    KPPGF+RTG NIY+ EG LA YKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD
Sbjct: 70  GGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 129

Query: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAE--QQKYRNAIQAA 205
           +QTGVVST NTF+AGVGAGVTEAVLVVNPMEVVKIRLQAQHL+   +  + KY NA+QA 
Sbjct: 130 KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAG 189

Query: 206 YLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGL 265
           Y I+KEEGI ALYRGVSLTAARQATNQGANFTVYSKL E LQEYHG++ LPSWETS IGL
Sbjct: 190 YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL 249

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKST--RNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           +SGAIGPFSNAPLDTIKTRLQKDKST  +  S W RI  IG QL++EEGFRALYKGITPR
Sbjct: 250 ISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPR 309

Query: 324 VMRVAPGQAVTFTVYEFVRRHLEGLGLF 351
           VMRVAPGQAVTFTVYEFVRRHLE LG+F
Sbjct: 310 VMRVAPGQAVTFTVYEFVRRHLENLGVF 337

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  477 bits (1227), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 238/306 (77%), Positives = 260/306 (84%), Gaps = 6/306 (1%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN--EGTKPPGFLRTGANIYS 109
           KK+++PA+NL+AGGTAGLFEALCCHPLDTIKVRMQIYRR    E  KPPGF++TG  IY 
Sbjct: 5   KKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQ 64

Query: 110 GEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTE 169
            EG LA YKGLGAVVIGIIPKMAIRFSSYEFYRTLL ++++G+VSTGNTF+AGVGAG+TE
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITE 124

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQ--KYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
           AVLVVNPMEVVKIRLQAQHL  +      KY NAI AAY IVKEEG+ ALYRGVSLTAAR
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAAR 184

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
           QATNQGANFTVYSKL E LQ YH    LPSWETS IGL+SGAIGPFSNAPLDTIKTRLQK
Sbjct: 185 QATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 244

Query: 288 DKST--RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           DKS      S   +I TIG QL++EEGFRALYKGITPRVMRVAPGQAVTFTVYE+VR HL
Sbjct: 245 DKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

Query: 346 EGLGLF 351
           E LG+F
Sbjct: 305 ENLGIF 310

>Kwal_47.18216
          Length = 333

 Score =  474 bits (1220), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 242/329 (73%), Positives = 265/329 (80%), Gaps = 29/329 (8%)

Query: 49  MSSKK-STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANE-GTKPPGFLRTGAN 106
           MS++K S++PA+NLVAGGTAGLFEALCCHPLDTIKVRMQIY RA E G +  GF+ T  +
Sbjct: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAG 166
           I + EG LA YKGLGAVVIGIIPKMAIRF+SYEF+RTLLADRQTGVVSTGNTF+AGVGAG
Sbjct: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120

Query: 167 VTEAVLVVNPMEVVKIRLQAQHL---------------------------HGAAEQQKYR 199
           +TEAV+VVNPMEVVKIRLQAQH+                              A   KYR
Sbjct: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYR 180

Query: 200 NAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWE 259
           NAIQAAY+IVKEEG  ALYRGVSLTAARQATNQGANFTVYS L  RLQEYH +  LPSWE
Sbjct: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240

Query: 260 TSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319
           TSLIGL+SGA+GPFSNAPLDTIKTRLQKDKST   S W RI  IGRQL++EEGFRALYKG
Sbjct: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300

Query: 320 ITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           ITPRVMRVAPGQAVTFTVYE +R+ LEGL
Sbjct: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEGL 329

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  470 bits (1210), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 239/303 (78%), Positives = 262/303 (86%), Gaps = 1/303 (0%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRA-NEGTKPPGFLRTGANIY 108
           S +KS+NPAVNL+AGG AGL E LCCHPLDTIKVRMQIY+ A   G K PGF++TG  IY
Sbjct: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
             EG LAFYKGLGAVVIGI PKMAIRFSSYEFYRTLLAD++TG VSTGNTF+AGVGAG+T
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122

Query: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
           EAV+VVNPMEVVKIRLQAQHL+      KY+NA+QA Y IVKEEG  ALYRGVSLTAARQ
Sbjct: 123 EAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182

Query: 229 ATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
           ATNQGANFTVYSKL E LQ YH  + LPSWETSLIGL+SGAIGPFSNAPLDTIKTRLQKD
Sbjct: 183 ATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           KST+N+S   RIT IG+QL+QEEGFRALYKGITPRVMRVAPGQAVTFT YEF+R+ LE  
Sbjct: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELEKT 302

Query: 349 GLF 351
           G+F
Sbjct: 303 GVF 305

>Scas_691.4
          Length = 334

 Score =  471 bits (1213), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/325 (73%), Positives = 262/325 (80%), Gaps = 17/325 (5%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104
           P  + + KKS+ P +NLVAGGTAGLFEALCCHPLDTIKVRMQI +R  EG +P GF+ TG
Sbjct: 2   PQKNPNDKKSS-PLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKR-TEGMRPHGFITTG 59

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVG 164
            NIYS EG LA YKGLGAVVIGIIPKMAIRFSSYEFYR  L D++T  ++TGNTFLAGVG
Sbjct: 60  RNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVG 119

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ---------------KYRNAIQAAYLIV 209
           AG+TEAVLVVNPMEVVKIRLQAQHL+    Q                KY NAI AAY IV
Sbjct: 120 AGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIV 179

Query: 210 KEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA 269
           KEEG GALYRGVSLTAARQATNQGANFTVYS L + LQ+YH  ++LPSWETS IGL+SGA
Sbjct: 180 KEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGA 239

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
           IGPFSNAPLDTIKTRLQKDKS  + S W +I  IG QL++EEGFRALYKGITPRVMRVAP
Sbjct: 240 IGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAP 299

Query: 330 GQAVTFTVYEFVRRHLEGLGLFGSA 354
           GQAVTFTVYEFVR+HLE L  FG +
Sbjct: 300 GQAVTFTVYEFVRKHLETLNFFGGS 324

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score =  154 bits (389), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 156/298 (52%), Gaps = 10/298 (3%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K  +P  + VAG  AG  EA   +P +  K R+Q+  ++++ ++ P  L    N    +G
Sbjct: 6   KKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLI--YNTAKTQG 63

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL 172
           + A Y G  A ++G   K A RF  Y+  R LL D++TG +S     LAG+GAG+ E+V+
Sbjct: 64  VGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLESVV 123

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATN 231
            V P E +K  L         + Q    ++   Y+ +VK+EG   LY GV   + RQA N
Sbjct: 124 AVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAAN 183

Query: 232 QGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
           Q      Y+K+   +Q+Y G+   + L S  T ++G  SG +  ++  P+DT+KTR+Q  
Sbjct: 184 QAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSL 243

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
            +++  S     TTI     +EEG +  +KG TPR+ R+     + FT+YE V  +L 
Sbjct: 244 TASKYSSTLNCFTTI----YKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLYLS 297

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score =  151 bits (381), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 157/300 (52%), Gaps = 16/300 (5%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           MS  K  +P+ + +AG  AG  EA   +P +  K R+Q+  +A++ ++ P  L    N  
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLI--YNTA 58

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
             +G+ + Y G  A ++G   K  +RF  ++  + LL D +TG +S     +AG+GAG+ 
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLL 118

Query: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRN----AIQAAYLIVKEEGIGALYRGVSLT 224
           E+V+ V P E +K  L        +   KY N     ++    +V+++G+  LYRGV   
Sbjct: 119 ESVVAVTPFEAIKTALIDDK---QSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPV 175

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
           + RQA NQ      Y+K+   +Q+Y  +   + L S  T ++G  SG +  ++  P+DT+
Sbjct: 176 SMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTV 235

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
           KTR+Q   S R  S     TTI     +EEG +A +KG TPR+ R+     + FTVYE V
Sbjct: 236 KTRMQSLDSKRYSSTINCFTTI----FKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKV 291

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 91/197 (46%), Gaps = 21/197 (10%)

Query: 61  LVAGGTAGLFEALCC-HPLDTIKVRMQIYRRA------NEGTKPPGFLRTGANIYSGEGL 113
           ++AG  AGL E++    P + IK  +   +++      N G    G LR    +   +GL
Sbjct: 109 VIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGK---GMLRNYTALVRKQGL 165

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR----QTGVVSTGNTFLAGVGAGVTE 169
              Y+G+  V +      A+R   Y   + ++ D     +   +S+G TF+ G  +G+  
Sbjct: 166 SGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIV- 224

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            V    P++ VK R+Q+       + ++Y + I     I KEEG+ A ++G +    R  
Sbjct: 225 TVYTTMPIDTVKTRMQS------LDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLF 278

Query: 230 TNQGANFTVYSKLMERL 246
            + G  FTVY K++  L
Sbjct: 279 LSGGIVFTVYEKVLTVL 295

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 83/201 (41%), Gaps = 16/201 (7%)

Query: 149 QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLI 208
           Q+  V    +F+AG  AG  EA  V  P E  K RLQ       A     RN +   Y  
Sbjct: 3   QSKQVDPSKSFIAGCLAGAVEAS-VTYPFEFAKTRLQLLDKASKAS----RNPLVLIYNT 57

Query: 209 VKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSG 268
            K +GIG++Y G            G  F  +  +   L++    + L      + GL +G
Sbjct: 58  AKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGE-LSGPRGVIAGLGAG 116

Query: 269 AI-GPFSNAPLDTIKTRLQKDKST------RNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
            +    +  P + IKT L  DK +       N    +R  T    LV+++G   LY+G+ 
Sbjct: 117 LLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYT---ALVRKQGLSGLYRGVL 173

Query: 322 PRVMRVAPGQAVTFTVYEFVR 342
           P  MR A  QAV    Y  ++
Sbjct: 174 PVSMRQAANQAVRLGCYNKIK 194

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score =  150 bits (379), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 152/299 (50%), Gaps = 16/299 (5%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYS 109
           ++K   +P  + +AG  AG  EA   +P +  K R+Q+  +A++ ++ P  L     IY 
Sbjct: 5   ATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVL-----IYK 59

Query: 110 G---EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAG 166
               +G+ + Y G  A +IG   K  IRF  ++  + +L D +TG +S     +AG+GAG
Sbjct: 60  TAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAG 119

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAE-QQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
           + E+V  V P E +K  L         +     R  ++    +V+++G   LYRGV   +
Sbjct: 120 LLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVS 179

Query: 226 ARQATNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
            RQA NQ      Y+K+   +Q+Y  S   + L S  T L+G  SG +  +S  PLDT+K
Sbjct: 180 MRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVK 239

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
           TR+Q   ST+  S      TI     +EEG +  +KG TPR+ R+     + FT+YE V
Sbjct: 240 TRMQSLDSTKYSSTMNCFATI----FKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKV 294

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 85/194 (43%), Gaps = 10/194 (5%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
           ++FLAG  AG  EA  +  P E  K RLQ       A     RN +   Y   K +GIG+
Sbjct: 14  HSFLAGSLAGAAEAC-ITYPFEFAKTRLQLIDKASKAS----RNPLVLIYKTAKTQGIGS 68

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSN- 275
           +Y G            G  F  +  + + L++    + L      + GL +G +   +  
Sbjct: 69  IYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGE-LSGTRGVIAGLGAGLLESVAAV 127

Query: 276 APLDTIKTRLQKDKST---RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
            P + IKT L  DK +   +  +N   +      LV+++GF  LY+G+ P  MR A  QA
Sbjct: 128 TPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQA 187

Query: 333 VTFTVYEFVRRHLE 346
           V    Y  ++  ++
Sbjct: 188 VRLGCYNKIKTLIQ 201

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 91/197 (46%), Gaps = 21/197 (10%)

Query: 61  LVAGGTAGLFEALCC-HPLDTIKVRMQIYRRA------NEGTKPPGFLRTGANIYSGEGL 113
           ++AG  AGL E++    P + IK  +   +++      N G    G +R  +++   +G 
Sbjct: 112 VIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGR---GVVRNYSSLVRDKGF 168

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR----QTGVVSTGNTFLAGVGAGVTE 169
              Y+G+  V +      A+R   Y   +TL+ D     +   +S+G TFL G  +G+  
Sbjct: 169 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIV- 227

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            V    P++ VK R+Q+       +  KY + +     I KEEG+   ++G +    R  
Sbjct: 228 TVYSTMPLDTVKTRMQS------LDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLV 281

Query: 230 TNQGANFTVYSKLMERL 246
            + G  FT+Y K++  L
Sbjct: 282 LSGGIVFTIYEKVLVML 298

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 6/105 (5%)

Query: 42  QPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL 101
           Q Y D+     K  +  +  + G  +G+       PLDT+K RMQ    + + TK    +
Sbjct: 201 QDYTDS--PKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ----SLDSTKYSSTM 254

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
              A I+  EGL  F+KG    +  ++    I F+ YE    +LA
Sbjct: 255 NCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVMLA 299

>Kwal_26.7967
          Length = 297

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 152/299 (50%), Gaps = 14/299 (4%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL--RTGAN 106
           MS KK  +P  + +AG  AG  EA   +P +  K R+Q+  +++  ++ P  L  RT   
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKV 60

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAG 166
               +GL A Y G  A ++G   K  +RF  ++  + +L D  TG +S     +AG+GAG
Sbjct: 61  ----QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAG 116

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAE-QQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
           + E+V+ V P E +K  L       + +     R  ++    +V ++G   LYRGV   +
Sbjct: 117 LLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVS 176

Query: 226 ARQATNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
            RQA NQ      Y+K+   +Q+Y  S   + L S  T ++G  SG +  ++  P+DT+K
Sbjct: 177 MRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVK 236

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
           TR+Q   S++  S      T+ R    EEG +  +KG TPR+ R+     + FT+YE V
Sbjct: 237 TRMQSLDSSKYSSTINCFATVFR----EEGLKTFWKGATPRLGRLILSGGIVFTIYEKV 291

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 21/194 (10%)

Query: 61  LVAGGTAGLFEALCC-HPLDTIKVRMQIYRRA------NEGTKPPGFLRTGANIYSGEGL 113
           +VAG  AGL E++    P + IK  +   +++      N G    G LR  +++   +G 
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGR---GMLRNYSSLVYDKGF 165

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV----VSTGNTFLAGVGAGVTE 169
              Y+G+  V +      A+R   Y   +T++ D         +S+G TF+ G  +G+  
Sbjct: 166 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIV- 224

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            V    P++ VK R+Q+       +  KY + I     + +EEG+   ++G +    R  
Sbjct: 225 TVYTTMPIDTVKTRMQS------LDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLI 278

Query: 230 TNQGANFTVYSKLM 243
            + G  FT+Y K++
Sbjct: 279 LSGGIVFTIYEKVL 292

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 83/194 (42%), Gaps = 10/194 (5%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
           ++FLAG  AG  EA  +  P E  K RLQ       A     RN +   Y   K +G+GA
Sbjct: 11  HSFLAGSLAGAVEAS-ITYPFEFAKTRLQLVDKSSTAS----RNPLTLIYRTAKVQGLGA 65

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI-GPFSN 275
           +Y G            G  F  +  +   L++   +  L      + GL +G +    + 
Sbjct: 66  VYVGCPAFIVGNTAKAGVRFLGFDAIKNILRD-PTTGELSGPRGIVAGLGAGLLESVVAV 124

Query: 276 APLDTIKTRLQKDK---STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
            P + IKT L  DK   S +  +N   +      LV ++GF  LY+G+ P  MR A  QA
Sbjct: 125 TPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQA 184

Query: 333 VTFTVYEFVRRHLE 346
           V    Y  ++  ++
Sbjct: 185 VRLGCYNKIKTMIQ 198

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score =  144 bits (364), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 154/301 (51%), Gaps = 15/301 (4%)

Query: 46  DNHMSSKK-STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL--R 102
           ++ MSS K + +P  + +AG  AG  EA   +P +  K R+Q+  +A++ ++ P  L   
Sbjct: 78  ESTMSSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYN 137

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAG 162
           TG N     G+ + Y G  A ++G   K  IRF  ++  + LL D++TG +S     +AG
Sbjct: 138 TGKNY----GISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAG 193

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGV 221
           +GAG+ E+V+ V P E +K  L         + Q     + + Y  ++ ++G   LYRGV
Sbjct: 194 LGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGV 253

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHG---SQNLPSWETSLIGLVSGAIGPFSNAPL 278
              + RQA NQ      Y+K+   +Q+Y      + L S  T ++G  SG +  ++  P+
Sbjct: 254 LPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPI 313

Query: 279 DTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           DT+KTR+Q    + N   +         + +EEG +  +KG TPR+ R+     + FT+Y
Sbjct: 314 DTVKTRMQ----SLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIY 369

Query: 339 E 339
           E
Sbjct: 370 E 370

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 90/197 (45%), Gaps = 21/197 (10%)

Query: 61  LVAGGTAGLFEALCC-HPLDTIKVRMQIYRRA------NEGTKPPGFLRTGANIYSGEGL 113
           +VAG  AGL E++    P + IK  +   ++A      N G    G +   A + S +G 
Sbjct: 190 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNG---KGMVSNYAKLLSDQGF 246

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR----QTGVVSTGNTFLAGVGAGVTE 169
              Y+G+  V +      A+R   Y   +TL+ D     +   +S+G TF+ G  +G+  
Sbjct: 247 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIV- 305

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            V    P++ VK R+Q+ +        +Y + I     I KEEG+   ++G +    R  
Sbjct: 306 TVYTTMPIDTVKTRMQSLN------AGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLI 359

Query: 230 TNQGANFTVYSKLMERL 246
            + G  FT+Y K++  L
Sbjct: 360 LSGGIVFTIYEKVLTVL 376

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 98/240 (40%), Gaps = 14/240 (5%)

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG----VVSTGNTFLAGVGAG 166
           E L   +K L +  + ++   ++ F S + Y     +         V   ++FLAG  AG
Sbjct: 42  ESLFNCFKRLSSFQLCLVLFYSVLFFSAQIYELTQCESTMSSNKPAVDPFHSFLAGSIAG 101

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
             EA  +  P E  K RLQ       A     RN +   Y   K  GI ++Y G      
Sbjct: 102 AIEAS-ITYPFEFAKTRLQLVDKASKAS----RNPLVLIYNTGKNYGISSIYVGCPAFIV 156

Query: 227 RQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI-GPFSNAPLDTIKTRL 285
                 G  F  +  +   L++   +  L  +   + GL +G +    +  P + IKT L
Sbjct: 157 GNTAKAGIRFLGFDTIKNLLRD-KKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTAL 215

Query: 286 QKDKST---RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
             DK     +  +N   + +   +L+ ++GF  LY+G+ P  MR A  QAV    Y  ++
Sbjct: 216 IDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIK 275

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K  +  +  + G  +G+       P+DT+K RMQ        +    F    A I+  EG
Sbjct: 288 KPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCF----ATIFKEEG 343

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
           L  F+KG    +  +I    I F+ YE   T+LA
Sbjct: 344 LKTFWKGATPRLGRLILSGGIVFTIYEKVLTVLA 377

>Scas_489.4
          Length = 297

 Score =  142 bits (358), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE 111
           KK  +P  + +AG  AG  EA   +P +  K R+Q+  + +  ++ P  L    N    +
Sbjct: 5   KKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLI--YNTAKTQ 62

Query: 112 GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAV 171
           G  A Y G  A ++G   K  IRF  ++  + +L D  TG +S     +AG+GAG+ E+V
Sbjct: 63  GTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAGLLESV 122

Query: 172 LVVNPMEVVKIRL-QAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
           + V P E +K  L   +       Q   R  ++    +V+++GI  LYRGV   + RQA 
Sbjct: 123 VAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 231 NQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
           NQ      Y+K+   +Q+Y  +   + L S  T ++G  SG +  ++  P+DT+KTR+Q 
Sbjct: 183 NQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS 242

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
             +T+    +        ++ +EEG +  +KG TPR+ R+     + FT+YE V
Sbjct: 243 LDATK----YTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENV 292

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 89/194 (45%), Gaps = 21/194 (10%)

Query: 61  LVAGGTAGLFEALCC-HPLDTIKVRMQIYRRA------NEGTKPPGFLRTGANIYSGEGL 113
           +VAG  AGL E++    P + IK  +   ++A      N G    G LR   ++   +G+
Sbjct: 110 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGR---GMLRNYGSLVRDQGI 166

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV----VSTGNTFLAGVGAGVTE 169
           +  Y+G+  V +      A+R   Y   +T++ D         +S+G TF+ G  +GV  
Sbjct: 167 MGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVV- 225

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            V    P++ VK R+Q+       +  KY + +     I KEEG+   ++G +    R  
Sbjct: 226 TVYTTMPIDTVKTRMQS------LDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLI 279

Query: 230 TNQGANFTVYSKLM 243
            + G  FT+Y  ++
Sbjct: 280 LSGGIVFTIYENVL 293

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 81/194 (41%), Gaps = 10/194 (5%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
           ++F+AG  AG  EA  +  P E  K RLQ       A     RN +   Y   K +G GA
Sbjct: 12  HSFIAGALAGAIEAS-ITYPFEFAKTRLQLIDKTSTAS----RNPLVLIYNTAKTQGTGA 66

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI-GPFSN 275
           +Y G            G  F  +  +   L++   +  L      + GL +G +    + 
Sbjct: 67  IYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRD-PVTGELSGPRGVVAGLGAGLLESVVAV 125

Query: 276 APLDTIKTRLQKDKST---RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
            P + IKT L  DK     +  +N   +      LV+++G   LY+G+ P  MR A  QA
Sbjct: 126 TPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQA 185

Query: 333 VTFTVYEFVRRHLE 346
           V    Y  ++  ++
Sbjct: 186 VRLGCYNKIKTMVQ 199

>Scas_640.25
          Length = 306

 Score =  134 bits (337), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 148/304 (48%), Gaps = 26/304 (8%)

Query: 49  MSSKKSTNPAV----NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN----EGTKPPGF 100
           MSS  +T   +      +AG  AG+ E +  +PLD +K RMQ+           T   G 
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60

Query: 101 LRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSY-EFYRTLLADRQTGVVSTGNTF 159
           +   + I   EG +  YKG+ + ++   PK A++F+S  EF +   +   T  ++   + 
Sbjct: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           L+G  AG+TEA+++V P E+VKIRLQ  +        K++  ++    I+K++G+  LY 
Sbjct: 121 LSGASAGITEALVIV-PFELVKIRLQDVN-------SKFKGPVEVLKHIIKQDGLKGLYS 172

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLD 279
           GV  T  R A      F V  ++ E L      Q   +      G V G  G   N P D
Sbjct: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFVGGTFGVMFNTPFD 231

Query: 280 TIKTRLQKD-----KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334
            +K+R+Q D        R   NW   + +  ++  EEGFRALYKG  P+V+R+ PG AV 
Sbjct: 232 VVKSRIQSDGNEIINGVRKY-NWTWPSVM--KIYHEEGFRALYKGFVPKVLRLGPGGAVL 288

Query: 335 FTVY 338
             V+
Sbjct: 289 LVVF 292

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 84/198 (42%), Gaps = 6/198 (3%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K     +++++G +AG+ EAL   P + +K+R+Q     +  +K  G +    +I   +G
Sbjct: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-----DVNSKFKGPVEVLKHIIKQDG 166

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL 172
           L   Y G+ + V       A  F      R LL   ++    T N   AG   G T  V+
Sbjct: 167 LKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVM 225

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232
              P +VVK R+Q+         +KY     +   I  EEG  ALY+G      R     
Sbjct: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285

Query: 233 GANFTVYSKLMERLQEYH 250
                V++ +M   +E+H
Sbjct: 286 AVLLVVFTNVMNVFREFH 303

>Kwal_26.8669
          Length = 296

 Score =  124 bits (312), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 138/286 (48%), Gaps = 21/286 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
              AG  AG+ E L  +PLD +K RMQ+      G +  G +     I + EG    YKG
Sbjct: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLVVNPM 177
           + + V+   PK A +F+  + ++ +   R+ GV  ++   + L+G  AG  EA +VV P 
Sbjct: 72  ISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVV-PF 129

Query: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT 237
           E+VKIRLQ            Y+  I     I+ +EG+ A+Y G+  T  R        F 
Sbjct: 130 ELVKIRLQDV-------SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182

Query: 238 VYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK-----STR 292
           +  ++   L E   S++  +    + G + G IG   + P D +K+R+Q        + +
Sbjct: 183 IIFQVRALLPEAK-SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241

Query: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
              +W  I TI     +EEGFRALYKG  P+V+R+ PG  +   V+
Sbjct: 242 YNWSWPSIFTI----YKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 104/228 (45%), Gaps = 9/228 (3%)

Query: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82
           V + A +R+    C+   Q+ Y       +K T  ++++++G +AG  EA    P + +K
Sbjct: 76  VLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQ-SLSILSGASAGCCEAFVVVPFELVK 133

Query: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142
           +R+Q    + +G  P   +R    I + EG+LA Y GL + +       A  F      R
Sbjct: 134 IRLQDVSSSYKG--PIDVVR---KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188

Query: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202
            LL + ++    T N  +AG   G T   L+  P +VVK R+Q   +  A   +KY  + 
Sbjct: 189 ALLPEAKSKSQQTRNDLIAG-SIGGTIGSLMSTPFDVVKSRIQNTAVV-AGGARKYNWSW 246

Query: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYH 250
            + + I KEEG  ALY+G      R     G    V++  M+  +  H
Sbjct: 247 PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTLH 294

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%)

Query: 255 LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFR 314
           LP +     G V+G        PLD +KTR+Q   S      +  +    +Q+V +EG  
Sbjct: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66

Query: 315 ALYKGITPRVMRVAPGQAVTF 335
            LYKGI+  V+  AP +A  F
Sbjct: 67  RLYKGISSPVLMEAPKRATKF 87

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 136/289 (47%), Gaps = 16/289 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           N   G  AG   A   +P+D IK RMQ  R   +       L     I S EG+   Y G
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCL---LKIISREGIKGLYSG 589

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           LG  +IG+ P+ AI+ +  +F R  L D+  G +S     ++G  AG  + V+  NP+E+
Sbjct: 590 LGPQLIGVAPEKAIKLTVNDFMRNRLTDK-NGKLSLFPEIISGASAGACQ-VIFTNPLEI 647

Query: 180 VKIRLQAQHLH-GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTV 238
           VKIRLQ Q  + G   QQ    A Q    IVK+ G+  LY GV+    R        F  
Sbjct: 648 VKIRLQVQSDYVGENIQQANETATQ----IVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 239 YSKLMERLQEYHGSQN-----LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRN 293
           Y+ L + L ++  +       L +WE    G ++G    F   P D IKTRLQ D   + 
Sbjct: 704 YAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQID-PRKG 762

Query: 294 LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
            + +  I    R +++EE FR+ +KG   RV+R +P    T   YE  +
Sbjct: 763 ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFK 811

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 9/188 (4%)

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
            F  G  AG   A  VV P++ +K R+QAQ         +Y+N+I     I+  EGI  L
Sbjct: 533 NFSLGSIAGCIGAT-VVYPIDFIKTRMQAQR-----SLAQYKNSIDCLLKIISREGIKGL 586

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
           Y G+       A  +    TV   +  RL + +G   L  +   + G  +GA       P
Sbjct: 587 YSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGK--LSLFPEIISGASAGACQVIFTNP 644

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           L+ +K RLQ  +S     N  +      Q+V++ G R LY G+   +MR  P  A+ F  
Sbjct: 645 LEIVKIRLQV-QSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 338 YEFVRRHL 345
           Y  +++ L
Sbjct: 704 YAHLKKDL 711

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  122 bits (307), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 138/295 (46%), Gaps = 19/295 (6%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYS 109
           S  KS        AG  AG+ E L  +PLD +K RMQ+  +   G    G +     I +
Sbjct: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63

Query: 110 GEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGV 167
           GEG+   YKG+ + ++   PK A +F+  + ++ L   +  GV  +S   + LAG  AG 
Sbjct: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLAGASAGC 122

Query: 168 TEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
            EA +VV P E+VKIRLQ            Y+  +     IV  EG+ A+Y G+  T  R
Sbjct: 123 VEAFVVV-PFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSG-AIGPFSNAPLDTIKTRLQ 286
            A   G  F +  +    L   H      +    LI    G +IG   + P D +K+R+Q
Sbjct: 175 HALWNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQ 232

Query: 287 KDKSTRNLS---NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
                  +    NW   + +   + +EEGFRALYKG  P+V+R+ PG  +   V+
Sbjct: 233 NTAVIPGVVRKYNWSLPSLL--TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 98/228 (42%), Gaps = 9/228 (3%)

Query: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82
           + + A +R+    C+   Q+ Y       +K + P ++++AG +AG  EA    P + +K
Sbjct: 78  ILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQP-LSMLAGASAGCVEAFVVVPFELVK 135

Query: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142
           +R+Q    + +G  P   +R    I + EG+LA Y GL + +          F      R
Sbjct: 136 IRLQDASSSYKG--PVDVVR---KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQAR 190

Query: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202
            LL           N  ++    G +   ++  P +VVK R+Q   +      +KY  ++
Sbjct: 191 ALLPAAHNKTQCITNDLISD-SIGCSIGCMLSTPFDVVKSRIQNTAVIPGV-VRKYNWSL 248

Query: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYH 250
            +   I +EEG  ALY+G      R     G    V++ +++  +  H
Sbjct: 249 PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAIH 296

>Scas_602.8
          Length = 885

 Score =  127 bits (320), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/297 (31%), Positives = 137/297 (46%), Gaps = 30/297 (10%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
            N   G  AG   A   +P+D IK RMQ  R     TK    +     I+  EG+   Y 
Sbjct: 500 FNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSL---TKYKNSIDCLVKIFGKEGIRGLYS 556

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
           GLG  +IG+ P+ AI+ +  +F R  L D++ G +  G   L+G  AG  + V   NP+E
Sbjct: 557 GLGPQLIGVAPEKAIKLTVNDFMRKSLVDKK-GNLQLGAEVLSGATAGACQVVF-TNPLE 614

Query: 179 VVKIRLQAQHLHGAAEQQKYRNAI-----QAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           +VKIRLQ         + +Y NA+       A+ I+KE  +  LY+GV     R      
Sbjct: 615 IVKIRLQV--------KSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSA 666

Query: 234 ANFTVYSKLMERLQEYHGSQN-----LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
             F  Y+ L + + ++  +       L +WE    G ++G    F   P D IKTRLQ +
Sbjct: 667 IYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIE 726

Query: 289 K---STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
                TR    +  I    R +++EE FR+ +KG   RVMR +P    T   YE  +
Sbjct: 727 PGVGETR----YTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFK 779

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 86/189 (45%), Gaps = 11/189 (5%)

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
            F  G  AG   A LV  P++ +K R+QAQ         KY+N+I     I  +EGI  L
Sbjct: 501 NFSLGSVAGCIGATLVY-PIDFIKTRMQAQR-----SLTKYKNSIDCLVKIFGKEGIRGL 554

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
           Y G+       A  +    TV   + + L +  G  NL      L G  +GA       P
Sbjct: 555 YSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKG--NLQLGAEVLSGATAGACQVVFTNP 612

Query: 278 LDTIKTRLQ-KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           L+ +K RLQ K + T  +    ++T    Q+++E     LYKG+   ++R  P  A+ F 
Sbjct: 613 LEIVKIRLQVKSEYTNAMIPKSQLTAF--QIIKELKLIGLYKGVGACLLRDVPFSAIYFP 670

Query: 337 VYEFVRRHL 345
            Y  +++++
Sbjct: 671 TYAHLKKNV 679

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 5/110 (4%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L AG  AG+  A    P D IK R+QI     E T+  G L     I   E   +F+KG 
Sbjct: 699 LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGE-TRYTGILHAVRTILKEESFRSFFKGG 757

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLL---ADRQ-TGVVSTGNTFLAGVGAG 166
            A V+   P+     ++YE ++ +     D+Q T    +   +   VG G
Sbjct: 758 AARVMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSVGTG 807

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score =  120 bits (300), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 155/295 (52%), Gaps = 15/295 (5%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG 110
           S++  + A + VAG  AG  E    +P +  K R+Q+ ++ +  ++ P  L        G
Sbjct: 4   SREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQG 63

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEA 170
            G  A Y G  A V+G   K  +RF  ++  R  L D + G +S     LAG+GAG+ E+
Sbjct: 64  AG--ALYVGCPAFVVGNTCKAGVRFLGFDALRRALQD-ERGALSGPRGMLAGLGAGLLES 120

Query: 171 VLVVNPMEVVKIRL-QAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
           VL V P E VK  L   +       Q   R A +   L+++E G+  LY G+   A RQA
Sbjct: 121 VLAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQA 180

Query: 230 TNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
           +NQ   F  Y++L + +Q Y G+   Q L S +T L+G +SG +  ++  P+DT+KTR+Q
Sbjct: 181 SNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ 240

Query: 287 KDKSTRNLSNWVRITTIG--RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
              + R  S      T+G  R +V+EEG RAL++G TPR+ R+     + FT YE
Sbjct: 241 ALDAARYGS------TVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 17/119 (14%)

Query: 132 AIRFSSY-------EFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRL 184
           A+RF  Y       + Y    AD+  G   +G TFL G  +G+   V    P++ VK R+
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLG---SGQTFLVGALSGIV-TVYATMPVDTVKTRM 239

Query: 185 QAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLM 243
           QA       +  +Y + +     +V+EEG+ AL+RG +    R   + G  FT Y KL+
Sbjct: 240 QA------LDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

>Scas_718.5
          Length = 324

 Score =  118 bits (295), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 144/308 (46%), Gaps = 22/308 (7%)

Query: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106
           +H  +K ST    +++AG   G+ + +   P DT KVRMQ         K  G L     
Sbjct: 29  SHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT------SAKSVGALDIIRK 82

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQT----GVVSTGNT 158
           +   EG+ AFYKG    ++G+   ++++F   E    F+R     R T    G +  G  
Sbjct: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQY 142

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           ++ G+  GV  + L  +P+E V+IRLQ Q   G   +++++  +     +VKE+   +L 
Sbjct: 143 YICGLTGGVVNSFLA-SPIEHVRIRLQTQT--GNGNEREFKGPLDCIRKLVKEK---SLM 196

Query: 219 RGVSLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
           RG+     R     G  F  Y  L+   +++      + SW+    G +SG +   +  P
Sbjct: 197 RGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYP 256

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           LD +K+ +Q D + RN      +  +   L +E+G  A +KG  P ++R AP    TF  
Sbjct: 257 LDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315

Query: 338 YEFVRRHL 345
           +E V R L
Sbjct: 316 FELVMRLL 323

>Scas_589.10
          Length = 316

 Score =  116 bits (291), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 145/300 (48%), Gaps = 38/300 (12%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVR--MQIYRRANEGT-----KPP---GFLRTGANIYS 109
             ++G  AG+ E +  +PLD +K R  +QI ++A   +     K P     L   + I  
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 110 GEGLLAFYKGLGAVVIGIIPKMAIRFSSYE-FYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
            EG    YKG+   ++  +PK A++F+S E F + ++   +   V++  T LAG  AG+T
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGIT 135

Query: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
           E+++VV P E+VKIRLQ         Q  YR+ I+    I++ +G+  +Y G   T  R 
Sbjct: 136 ESLIVV-PFELVKIRLQD-------AQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRN 187

Query: 229 ATNQGANFTVY---SKLMERLQ---EYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
                + F +     K + R +   ++ G +N       L+G ++G +  F + P D +K
Sbjct: 188 TIWNASYFGLIFQVKKFIPRAKSTTKFQGIRN-----DFLVGAIAGCMSCFLSVPFDVVK 242

Query: 283 TRLQKDKSTRNLS----NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           TR+Q  K T +       W  +  I R     EG + +YKGI P + R  PG  +   V+
Sbjct: 243 TRMQGSKKTSSGMCYGWAWQSVFLIYR----TEGIKGIYKGILPIICRYGPGGGLLLVVF 298

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 85/204 (41%), Gaps = 16/204 (7%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K     V L+AG  AG+ E+L   P + +K+R+Q    A    + P  +R    I   +G
Sbjct: 118 KEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQ---DAQSDYRSP--IRCTRTIIENQG 172

Query: 113 LLAFYKGLGAVV----IGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
           L   Y G  + +    I       + F   +F     A   T      N FL G  AG  
Sbjct: 173 LFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPR--AKSTTKFQGIRNDFLVGAIAGCM 230

Query: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
              L V P +VVK R+Q       +    Y  A Q+ +LI + EGI  +Y+G+     R 
Sbjct: 231 SCFLSV-PFDVVKTRMQGS--KKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRY 287

Query: 229 ATNQGANFTVYSKLME--RLQEYH 250
               G    V++ + E  R+ +++
Sbjct: 288 GPGGGLLLVVFNGVNELFRMSDHY 311

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 88/197 (44%), Gaps = 18/197 (9%)

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAA--------EQQKYRNAIQAAYLIVK 210
           F++G  AG++E +++  P++VVK R Q Q    A         +Q ++ + +     I+K
Sbjct: 17  FISGAVAGMSETIMMY-PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 211 EEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI 270
           EEG   LY+G+S     +   +   F    +  + + +    + + S  T L G  +G  
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGIT 135

Query: 271 GPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
                 P + +K RLQ  +S  +  + +R T   R +++ +G   +Y G    + R    
Sbjct: 136 ESLIVVPFELVKIRLQDAQS--DYRSPIRCT---RTIIENQGLFGIYAGFESTIWRNTIW 190

Query: 331 QA----VTFTVYEFVRR 343
            A    + F V +F+ R
Sbjct: 191 NASYFGLIFQVKKFIPR 207

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 133/285 (46%), Gaps = 15/285 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           N   G  AG   A+  +P+D +K RMQ  R   + +K    +     I S EG+   Y G
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQR---DFSKYKNSIDCLLKILSKEGVRGLYSG 583

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           LG  +IG+ P+ AI+ +  +  R  LA R  G +S     ++G  AG  + V   NP+E+
Sbjct: 584 LGPQLIGVAPEKAIKLTVNDHMRATLAGRD-GKLSLPCEIISGATAGACQVVF-TNPLEI 641

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           VKIRLQ +  + A   +   NAI     ++K  G+  LYRG      R        F  Y
Sbjct: 642 VKIRLQVKSDYVADAARNSVNAIS----VIKNLGLIGLYRGAGACLLRDIPFSAIYFPTY 697

Query: 240 SKLMERL-----QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           + +   +     ++      L +W+  + G ++G    F   P D IKTRLQ D   +  
Sbjct: 698 AHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPK-KGE 756

Query: 295 SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           S +  I    R +++EEG ++ +KG   RV+R +P    T   YE
Sbjct: 757 SVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYE 801

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 263 IGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322
           +G V+G IG     P+D +KTR+Q   + R+ S +        +++ +EG R LY G+ P
Sbjct: 530 LGSVAGCIGAMVVYPIDMVKTRMQ---AQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 323 RVMRVAPGQAVTFTVYEFVRRHLEG 347
           +++ VAP +A+  TV + +R  L G
Sbjct: 587 QLIGVAPEKAIKLTVNDHMRATLAG 611

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           LV+GG AG+  A    P D IK R+QI  +  E     G       I   EG+ +F+KG 
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYN-GIWDAARTILKEEGIKSFFKGG 782

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLL 145
            A V+   P+     ++YE +  L 
Sbjct: 783 PARVLRSSPQFGFTLAAYEIFHNLF 807

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  115 bits (287), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 141/300 (47%), Gaps = 27/300 (9%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           MS +K        +AG  AG+ E L  +PLD +K  MQ+      G +  G       I 
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLL-ADRQTGVVSTGNTFLAGV 163
           + EG    YKG+ + ++   PK A +F+  +     Y+ L  A++ T  +S     L+G 
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGA 116

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
            AG+ E+ +VV P E+VKIRLQ           K+ + I     IV++EGI A+Y G+  
Sbjct: 117 SAGICESFVVV-PFELVKIRLQDVS-------SKFTSPIAVVKNIVEKEGILAMYNGLES 168

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKT 283
           T  R        F +  ++   L +   +++  +    L G V G +    + P D +K+
Sbjct: 169 TMWRHGIWNAGYFGIIFQVRALLPK-ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227

Query: 284 RLQKDKSTRNLS-----NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           R+Q       +      +W  + TI     +EEGF+ALYKG  P+V+R+ PG  +   V+
Sbjct: 228 RVQNTAVIPGVPRKYNWSWPALATI----YKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 106/228 (46%), Gaps = 9/228 (3%)

Query: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82
           + + A +R+    C+   Q+ Y D    ++K T P +++++G +AG+ E+    P + +K
Sbjct: 76  ILMEAPKRATKFACNDEFQKIYKD-LFGAEKLTQP-LSILSGASAGICESFVVVPFELVK 133

Query: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142
           +R+Q    +++ T P   ++   NI   EG+LA Y GL + +       A  F      R
Sbjct: 134 IRLQ--DVSSKFTSPIAVVK---NIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR 188

Query: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202
            LL    T    T N  LAG   G T + L+  P +VVK R+Q   +     + KY  + 
Sbjct: 189 ALLPKASTKSEQTRNDLLAGTVGG-TLSSLLSTPFDVVKSRVQNTAVIPGVPR-KYNWSW 246

Query: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYH 250
            A   I KEEG  ALY+G      R     G    V++ +M+  +  H
Sbjct: 247 PALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVH 294

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 135/285 (47%), Gaps = 15/285 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           N   G  AG   A   +P+D +K RMQ  R  ++       +   A I+S EG+   Y G
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNS---IDCFAKIFSREGIRGIYSG 577

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           LG  +IG+ P+ AI+ +  ++ R  L D+   +       L+G  AG  + V   NP+EV
Sbjct: 578 LGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEI-LSGACAGACQVVF-TNPLEV 635

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           VKIRLQ +  +     +    A+     ++K+ GI  LY+G++    R        F  Y
Sbjct: 636 VKIRLQVRSEYAGDVLKSQVTALG----VIKQLGIKGLYKGIAACLMRDVPFSAIYFPTY 691

Query: 240 SKLMERLQEYHGSQ-----NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           + L + + +Y          L +WE  + G ++G    +   P D IKTRLQ D   +  
Sbjct: 692 AHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID-PRKGE 750

Query: 295 SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           + +  I    R +++EE F++ +KG + RV+R +P    T   YE
Sbjct: 751 TRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 84/186 (45%), Gaps = 10/186 (5%)

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
            F  G  AG   A  VV P+++VK R+QAQ         +Y+N+I     I   EGI  +
Sbjct: 521 NFTLGSIAGCIGAT-VVYPIDLVKTRMQAQRSFS-----QYKNSIDCFAKIFSREGIRGI 574

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
           Y G+       A  +    TV   +  RL + H   NL  +   L G  +GA       P
Sbjct: 575 YSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHA--NLKWYFEILSGACAGACQVVFTNP 632

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           L+ +K RLQ            ++T +G  ++++ G + LYKGI   +MR  P  A+ F  
Sbjct: 633 LEVVKIRLQVRSEYAGDVLKSQVTALG--VIKQLGIKGLYKGIAACLMRDVPFSAIYFPT 690

Query: 338 YEFVRR 343
           Y  +++
Sbjct: 691 YAHLKK 696

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           LVAGG AG+  A    P D IK R+QI  R  E T+  G       I   E   +F+KG 
Sbjct: 718 LVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE-TRYEGIFHAARTILKEESFKSFFKGG 776

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLL-ADRQTGVVSTGNT 158
            A V+   P+     ++YE ++ +    R+    +  +T
Sbjct: 777 SARVLRSSPQFGFTLAAYEIFQNMFPLKREESTFTKDDT 815

>Kwal_27.12599
          Length = 304

 Score =  114 bits (286), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 137/294 (46%), Gaps = 25/294 (8%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +L+AG   G+ + L   P DT KVR+Q        T P   +     +   EGL  FYKG
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ------TSTTPTTAVEVVKKLVKNEGLRGFYKG 80

Query: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN 175
               ++G+   ++ +F   E    F+R   AD     ++    ++ G   GV  + L  +
Sbjct: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA-S 138

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGAN 235
           P+E V+IRLQ Q   G   +  ++  +     I K    GAL RG+S T  R+A      
Sbjct: 139 PIEHVRIRLQTQTASGTVAE--FKGPLDC---INKLRANGALMRGLSPTILREAQGCATY 193

Query: 236 FTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           F  Y  L+  ++ +     ++P+W+  L G VSG     +  PLD IK+ +Q D    NL
Sbjct: 194 FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD----NL 249

Query: 295 SNWVR---ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            N VR   I  + R +  + G+++ +KG  P ++R AP    TF  +E   R L
Sbjct: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRFL 303

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P DT K RLQ   +       V+      +LV+ EG R  YKG    ++ V    +  F 
Sbjct: 44  PFDTTKVRLQTSTTPTTAVEVVK------KLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97

Query: 337 VYEFVRRHLEG 347
           V E ++R   G
Sbjct: 98  VNEAMKRFFRG 108

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 134/286 (46%), Gaps = 16/286 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP-PGFLRTGANIYSGEGLLAFYK 118
           N   G  AG   A   +P+D +K RMQ  R  ++       FL+    I S EG+   Y 
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLK----ILSREGIRGVYS 601

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
           GLG  +IG+ P+ AI+ +  ++ R  L D+  G +   +  ++G  AG  + V+  NP+E
Sbjct: 602 GLGPQLIGVAPEKAIKLTVNDYMRNKLKDK-NGKLGLLSEIISGASAGACQ-VIFTNPLE 659

Query: 179 VVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTV 238
           +VKIRLQ +   G    +   NA   A  I+K  G+  LY+G +    R        F  
Sbjct: 660 IVKIRLQVK---GEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPT 716

Query: 239 YSKLMERLQEYHGSQN-----LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRN 293
           Y+ L   L  +  +       L +WE    G ++G    +   P D IKTRLQ D   + 
Sbjct: 717 YAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQID-PKKG 775

Query: 294 LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
            + +  I    R +++EE F++ +KG   RV+R +P    T   YE
Sbjct: 776 ETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYE 821

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 263 IGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322
           +G V+G IG     P+D +KTR+Q   + R+LS +        +++  EG R +Y G+ P
Sbjct: 549 LGSVAGCIGATIVYPIDFVKTRMQ---AQRSLSQYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 323 RVMRVAPGQAVTFTVYEFVRRHLEG 347
           +++ VAP +A+  TV +++R  L+ 
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLKD 630

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L AG  AG+  A    P D IK R+QI  +  E T   G +     I   E   +F+KG 
Sbjct: 744 LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGE-TIYKGIIHAARTILREESFKSFFKGG 802

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLL---ADRQTGVVSTGN 157
            A V+   P+     ++YE +  +     D+   V+S  +
Sbjct: 803 AARVLRSSPQFGFTLAAYELFHNIFPLPNDKDKFVISEDD 842

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  113 bits (283), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 88/317 (27%), Positives = 140/317 (44%), Gaps = 51/317 (16%)

Query: 49  MSSKKSTNP---AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP------- 98
           MSS  +  P       ++G  AG+ E    +PLD +K R Q+     E T P        
Sbjct: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQL-----EVTTPTAAAVGKQ 55

Query: 99  -----GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR-QTGV 152
                G +     I   EG    Y+G+ + ++   PK A +F+  + Y+ +  +   T  
Sbjct: 56  VERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE 115

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
            +   +  AG  AG+TEA ++V P E++KIR+Q         +  Y   +      +K E
Sbjct: 116 TTQKISIAAGASAGMTEAAVIV-PFELIKIRMQDV-------KSSYLGPMDCLKKTIKNE 167

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS--------LIG 264
           GI  LY+G+  T  R A   G  F V          Y    ++P  +T         + G
Sbjct: 168 GIMGLYKGIESTMWRNALWNGGYFGVI---------YQVRNSMPVAKTKGQKTRNDLIAG 218

Query: 265 LVSGAIGPFSNAPLDTIKTRLQKDKSTRNLS---NWVRITTIGRQLVQEEGFRALYKGIT 321
            + G +G   N P D +K+R+Q   +  +     NW   + +   + +EEGFRALYKG  
Sbjct: 219 AIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL--VIYREEGFRALYKGFV 276

Query: 322 PRVMRVAPGQAVTFTVY 338
           P+V R+APG ++   V+
Sbjct: 277 PKVCRLAPGGSLMLVVF 293

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 92/200 (46%), Gaps = 27/200 (13%)

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAA-----EQQKYRNAIQAAYLIVKEEG 213
           F++G  AG++E + V+ P++VVK R Q +     A     + ++Y   I     IVK+EG
Sbjct: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74

Query: 214 IGALYRGVS----LTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA 269
              LYRG+S    + A ++AT    N   Y K+ + L   + +       T  I + +GA
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACN-DQYQKIFKNLFNTNET-------TQKISIAAGA 126

Query: 270 IGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVM 325
               + A    P + IK R+Q  KS+     ++      ++ ++ EG   LYKGI   + 
Sbjct: 127 SAGMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMW 181

Query: 326 RVAPGQAVTFTVYEFVRRHL 345
           R A      F V   VR  +
Sbjct: 182 RNALWNGGYFGVIYQVRNSM 201

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 9/222 (4%)

Query: 27  ARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ 86
           A +R+    C+   Q+ +   ++ +   T   +++ AG +AG+ EA    P + IK+RMQ
Sbjct: 90  APKRATKFACNDQYQKIF--KNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQ 147

Query: 87  IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
             + +  G  P   L+        EG++  YKG+ + +          F      R  + 
Sbjct: 148 DVKSSYLG--PMDCLK---KTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMP 202

Query: 147 DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY 206
             +T    T N  +AG   G T   ++  P +VVK R+Q+     +A  +KY   + +  
Sbjct: 203 VAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQSVDAVSSA-VKKYNWCLPSLL 260

Query: 207 LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
           +I +EEG  ALY+G      R A        V++ +M   ++
Sbjct: 261 VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  112 bits (279), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 131/290 (45%), Gaps = 17/290 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +L+AG   G+ + L   P DT KVR+Q  +       P        N+   EG   FYKG
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTSK------VPTSAAEVVKNLLKNEGPKGFYKG 81

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
               ++G+   ++I+F   E  +     R       +S    +L G+  G+T + L  +P
Sbjct: 82  TLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLA-SP 140

Query: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236
           +E V+IRLQ Q   G+  Q +++  I     +  ++G   L RG+  T  R+    G  F
Sbjct: 141 IEHVRIRLQTQT--GSGAQAEFKGPIDCIKKLRSQKG---LMRGLIPTMLREGHGCGTYF 195

Query: 237 TVYSKLMER-LQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLS 295
            VY  L+ + + +      +P W+  L G +SG        P+D +K+ +Q D   +   
Sbjct: 196 LVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKP-Q 254

Query: 296 NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           N   +  + R L   EG +A +KG  P ++R AP    TF  +E   R L
Sbjct: 255 NGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           +L++ L+++ G  N    +  L G   G        P DT K RLQ  K   + +  V  
Sbjct: 9   QLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAEVV-- 66

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
               + L++ EG +  YKG    ++ V    ++ F V E ++R   
Sbjct: 67  ----KNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFH 108

>Kwal_47.17321
          Length = 881

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 137/289 (47%), Gaps = 23/289 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           N + G  AG   A   +P+D +K RMQ  R  ++       +     I+S EG+   Y G
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNS---IDCFVKIFSREGIRGIYSG 559

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           LG  ++G+ P+ AI+ +  ++ R LL D +   ++     ++G  AG  + V+  NP+E+
Sbjct: 560 LGPQLVGVAPEKAIKLTVNDYVRKLLMD-ENNRLTLPLEIISGAAAGACQ-VIFTNPLEI 617

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYL----IVKEEGIGALYRGVSLTAARQATNQGAN 235
           VKIRLQ         + +Y +++  + L    +VK  G+  LY+G+     R        
Sbjct: 618 VKIRLQV--------RSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIY 669

Query: 236 FTVYSKLMERL-----QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
           F  Y+ L   +     Q+ +    L +WE    G ++G    +   P D IKTRLQ D  
Sbjct: 670 FPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID-P 728

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
            +  + +  I    R +++EE F++ +KG   RV+R +P    T   YE
Sbjct: 729 RKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE 777

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 98/221 (44%), Gaps = 13/221 (5%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           + +++G  AG  + +  +PL+ +K+R+Q+  R+      P    T   +    GL   YK
Sbjct: 596 LEIISGAAAGACQVIFTNPLEIVKIRLQV--RSEYADSLPKSQLTALGVVKSLGLRGLYK 653

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLAD------RQTGVVSTGNTFLAGVGAGVTEAVL 172
           GL A ++  +P  AI F +Y   +  + +       +   + T     AG  AG+  A L
Sbjct: 654 GLVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYL 713

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232
              P +V+K RLQ     G   + +Y   + AA  I+KEE   + ++G      R +   
Sbjct: 714 TT-PFDVIKTRLQIDPRKG---ETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQF 769

Query: 233 GANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF 273
           G     Y ++ + +     S+N  S ET+   +V+G    F
Sbjct: 770 GFTLAAY-EIFQNMFPLQHSENNESRETNDTPIVTGMFSNF 809

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 10/188 (5%)

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
            FL G  AG   A  V  P+++VK R+QAQ         +Y+N+I     I   EGI  +
Sbjct: 503 NFLLGSVAGCIGATAVY-PIDLVKTRMQAQR-----NFSQYKNSIDCFVKIFSREGIRGI 556

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
           Y G+       A  +    TV   + + L + +    LP    S  G  +GA       P
Sbjct: 557 YSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIIS--GAAAGACQVIFTNP 614

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           L+ +K RLQ      +     ++T +G  +V+  G R LYKG+   +MR  P  A+ F  
Sbjct: 615 LEIVKIRLQVRSEYADSLPKSQLTALG--VVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 338 YEFVRRHL 345
           Y  ++R +
Sbjct: 673 YAHLKRDI 680

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 130/295 (44%), Gaps = 25/295 (8%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTK---PPGFLRTGANIYSGEGLLAFY 117
           L AG  AG+ E     P+D IK RMQ             P   L   A I + EG LA +
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLL---ADRQTGVVSTGNTFLAGVGAGVTEAVLVV 174
           KG+ +VV+G  P  A+ F++YE  ++ L    DRQT       T L+G  A V    L +
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTH--QPLKTALSGTLATVAADAL-M 137

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
           NP + +K RLQ   LH +    K       A  + + EGI A +     T A        
Sbjct: 138 NPFDTIKQRLQ---LHPSDSMTK------CAVRMYQREGIAAFFYSYPTTIAMNIPFAAL 188

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           NF +Y       + ++ S N   W   L G +SGA       PLD +KT LQ   +    
Sbjct: 189 NFVIYE---SSTKIFNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQ 245

Query: 295 SNWVRITTIGRQ----LVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           S   +     R+    + +  G+   ++G+ PR++   P  A+++T YEF +  L
Sbjct: 246 SQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 16/100 (16%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIK----------VRMQIYRRANEGTKPPGFLRTGA 105
           NP ++ + GG +G   A    PLD +K          V+ Q+++ A+       F +  +
Sbjct: 207 NPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADT------FRKAAS 260

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
            I+   G   F++GL   +I  +P  AI ++SYEF + LL
Sbjct: 261 AIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 75/182 (41%), Gaps = 30/182 (16%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG 110
            +++  P    ++G  A +      +P DTIK R+Q++   +         +    +Y  
Sbjct: 113 DRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDS-------MTKCAVRMYQR 165

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTF------LAGVG 164
           EG+ AF+      +   IP  A+ F  YE          T + +  N +      L G  
Sbjct: 166 EGIAAFFYSYPTTIAMNIPFAALNFVIYE--------SSTKIFNPSNNYNPWIHCLCGGI 217

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGA--AEQQKYRNAI---QAAYLIVKEEGIGALYR 219
           +G T A  +  P++ VK  LQ   + GA   + Q ++ A    +AA  I K  G    +R
Sbjct: 218 SGATCAA-ITTPLDCVKTVLQ---IRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFR 273

Query: 220 GV 221
           G+
Sbjct: 274 GL 275

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 135/292 (46%), Gaps = 26/292 (8%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG---------- 110
             AG  AG+ E L  +PLD +K RMQ+ +   +G       +   + Y+G          
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQL-QVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVK 73

Query: 111 -EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTL---LADRQTGVVSTGNTFLAGVGAG 166
            EG    YKG+ + ++   PK AI+FS  + ++T    +     G ++      +G  AG
Sbjct: 74  KEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAG 133

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
             EA  VV P E+VKIRLQ  +        +++  I+     V + G+ +L+ G+  T  
Sbjct: 134 AVEA-FVVAPFELVKIRLQDVN-------SQFKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 227 RQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
           R        F +  ++ + L     S    +    + G + G +G   N P D +K+R+Q
Sbjct: 186 RHVLWNAGYFGIIFQIRKLLPAAKTSTE-KTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ 244

Query: 287 KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           +        NW   + +   + +EEGF+ALYKG  P+VMR+APG  +   V+
Sbjct: 245 RSSGPLRKYNWSLPSVL--LVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 92/206 (44%), Gaps = 16/206 (7%)

Query: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102
           P P+  M+ K      + + +G +AG  EA    P + +K+R+Q     N   K P  + 
Sbjct: 114 PTPNGEMTQK------IAIYSGASAGAVEAFVVAPFELVKIRLQ---DVNSQFKTP--IE 162

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAG 162
              N     G+L+ + GL A +   +   A  F      R LL   +T    T N  +AG
Sbjct: 163 VVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAG 222

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222
              G T   L+  P +VVK R+Q      +   +KY  ++ +  L+ +EEG  ALY+G +
Sbjct: 223 AIGG-TVGCLLNTPFDVVKSRIQ----RSSGPLRKYNWSLPSVLLVYREEGFKALYKGFA 277

Query: 223 LTAARQATNQGANFTVYSKLMERLQE 248
               R A   G    V++ +M+  +E
Sbjct: 278 PKVMRLAPGGGLLLVVFTNVMDFFRE 303

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  110 bits (274), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 141/294 (47%), Gaps = 32/294 (10%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP--GFLRTGANIYSGEGLLAFYK 118
            V+G  AG+ E L  +PLD +K RMQ+   +  G+     G +     I   EG    YK
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLVVNP 176
           G+ + ++   PK A +F+  + Y+ +  D   GV  ++   + L+G  AGVTEA ++V P
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIV-P 129

Query: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236
            E+VKIRLQ  +        K+   ++  +  ++E GI +LY G+  T  R A   G  F
Sbjct: 130 FELVKIRLQDVN-------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYF 182

Query: 237 TVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF-----SNAPLDTIKTRLQKDKST 291
            V  ++   L +   +      E +   L++G IG +      +  L  +K+R+Q   +T
Sbjct: 183 GVIFQIRALLPKAKTNT-----EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237

Query: 292 RNLS-------NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
                      NW   +    ++  EEGF ALYKG  P+++R+ PG  +   V+
Sbjct: 238 TLADGTVVPKYNWTWPSLF--KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 94/235 (40%), Gaps = 30/235 (12%)

Query: 27  ARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ 86
           A +R+    C+   Q+ + D +   K +    +++++G  AG+ EA    P + +K+R+Q
Sbjct: 81  APKRATKFACNDSYQKMFKDLYGVDKLTQQ--ISILSGSLAGVTEACVIVPFELVKIRLQ 138

Query: 87  IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVV----------IGIIPKMAIRFS 136
                +  +K  G +          G+L+ Y GL + +           G+I ++     
Sbjct: 139 -----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQI----- 188

Query: 137 SYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ 196
                R LL   +T    T N  +AG   G          + VVK R+Q+      A+  
Sbjct: 189 -----RALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243

Query: 197 ---KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
              KY     + + I  EEG  ALY+G      R     G    V++ +M   QE
Sbjct: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 277 PLDTIKTRLQKDKSTRNLSNWVR---ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           PLD +KTR+Q    +   S       I  +G Q+V+ EGF  LYKGI+  ++  AP +A 
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLG-QIVKREGFSRLYKGISSPMLMEAPKRAT 86

Query: 334 TFTVYEFVRRHLEGL 348
            F   +  ++  + L
Sbjct: 87  KFACNDSYQKMFKDL 101

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  109 bits (272), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 136/295 (46%), Gaps = 22/295 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           ++ AG   G+ + L   P DT KVR+Q  +         G +    N+   EG LAFYKG
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI------GVIEVVQNLLRNEGALAFYKG 82

Query: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADR---QTGV-VSTGNTFLAGVGAGVTEAV 171
           +   ++G+   ++++F   E    F+    ADR   Q  V +     +L G+  GV  + 
Sbjct: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSF 142

Query: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATN 231
           L   P+E V+IRLQ Q   G   +++++        + K +   AL RG+  T  R    
Sbjct: 143 LAA-PIEHVRIRLQTQTSQG--NERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHG 196

Query: 232 QGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
            G  F  Y  L+ +  E    +N +P+W+    G +SG I   +  P+D +K+ LQ D S
Sbjct: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD-S 255

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
             N      I    R L ++ G  A +KG  P ++R AP  A TF  +E   R L
Sbjct: 256 IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

>Scas_667.22
          Length = 306

 Score =  108 bits (270), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 141/307 (45%), Gaps = 20/307 (6%)

Query: 46  DNHMSSKKSTNPAV--NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRT 103
           D+  +  K  N  V  +L+AG   G+ + L   P DT KVR+Q        + P   +  
Sbjct: 12  DDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT------SSTPTTAMEV 65

Query: 104 GANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTF 159
              +   EG   FYKG    +IG+   ++++F   E    F+ +   D  + ++S    +
Sbjct: 66  IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYY 125

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           + G+  G+T + L  +P+E V+IRLQ Q   G+    +++  +     I K    G   R
Sbjct: 126 ICGLTGGITNSFLA-SPIEHVRIRLQTQT--GSGPNVEFKGPLDC---IRKLRAQGGFMR 179

Query: 220 GVSLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278
           G++ T  R+    G  F VY  ++   + +      +P+W+  L G +SG        PL
Sbjct: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPL 239

Query: 279 DTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           D IK+ +Q D + ++      I+++ + L  + G  A +KG  P ++R AP    TF  +
Sbjct: 240 DVIKSVMQTD-NLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATF 298

Query: 339 EFVRRHL 345
           E   R L
Sbjct: 299 ELAMRLL 305

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           +L++ L+ +    N    +  L G   G        P DT K RLQ   +       +  
Sbjct: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVI-- 66

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
               R+L++ EG +  YKG    ++ V    ++ F V E ++R   
Sbjct: 67  ----RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  108 bits (269), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 138/312 (44%), Gaps = 32/312 (10%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ---IYRRANEGTKPPGFLRTGANIY 108
           KK+ +P V  ++G  +G   A+   P D  K R+Q   +    ++     GF  T A I+
Sbjct: 33  KKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIF 92

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168
             EG    YKGL   V+G IP + I FS Y+F R    D     +   + FL+   + +T
Sbjct: 93  KDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVD-----IFPHSPFLSNASSAIT 147

Query: 169 E---AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
               + +  NP+ VVK RL  Q   G      Y+  I     I+++EG  ALY G+ + A
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGKYSTH-YKGTIDTFRKIIQQEGAKALYAGL-VPA 205

Query: 226 ARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS-------LIGLVSGAIGPFSNAPL 278
                N    F +Y  L  R   Y  S ++ +  TS       L  ++S  +      P 
Sbjct: 206 LLGMLNVAIQFPLYENLKIRF-GYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPH 264

Query: 279 DTIKTRLQ-----KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           + ++TR+Q      +   R+L   ++IT       ++EGF   Y G    ++R  P   V
Sbjct: 265 EILRTRMQLKSDLPNTVQRHLLPLIKIT------YRQEGFAGFYSGFATNLVRTVPAAVV 318

Query: 334 TFTVYEFVRRHL 345
           T   +E+ +++L
Sbjct: 319 TLVSFEYSKKYL 330

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 132/298 (44%), Gaps = 44/298 (14%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           ++L++G  AG    L   P+DT+K R+Q            GF R G       G    Y+
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQ---------AKGGFFRNG-------GYRGVYR 50

Query: 119 GLGAVVIGIIPKMAIRFSSYE--------FYRTLLADRQTGVVSTGNTFLAGVGAGVTEA 170
           GLG+ V+   P  ++ F +Y+        F+R LL       V T + F + +G     A
Sbjct: 51  GLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT-HMFSSSMGE--IAA 107

Query: 171 VLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA---LYRGVSLTAAR 227
            +V  P EVVK R Q    H + E  +         ++  E G G    LYRG S T  R
Sbjct: 108 CMVRVPAEVVKQRSQTHASHSSWETLRE--------ILKNENGEGVRRNLYRGWSTTIMR 159

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
           +       F +Y  + +   E   S  +  W+ ++ G ++G I   +  PLD +KTRL  
Sbjct: 160 EIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLML 219

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            K +      + + T+   + +EEGF+  + G+ PR M ++ G A+   +YE V   L
Sbjct: 220 CKKS------IPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 20/91 (21%)

Query: 262 LIGLVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALY 317
           LI L+SGA    S      P+DT+KTRLQ                      +  G+R +Y
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG----------------FFRNGGYRGVY 49

Query: 318 KGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           +G+   V+  APG ++ F  Y+  +    G 
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGF 80

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 6/102 (5%)

Query: 48  HMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANI 107
            +       P    V G  AG   A    PLD +K R+ + ++    + P G L +   I
Sbjct: 180 ELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKK----SIPLGTLVS--TI 233

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ 149
           Y  EG   F+ G+G   + I    AI    YE   +LL+  +
Sbjct: 234 YKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLSTNK 275

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  105 bits (262), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 136/293 (46%), Gaps = 21/293 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +L+AG   G+ + L   P DT KVR+Q        + P   +     + + EG   FYKG
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQT------SSTPTTAMEVVRKLLANEGPRGFYKG 81

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT---FLAGVGAGVTEAVLVVNP 176
               +IG+   ++++F   E  +     R   + ST +    +  GV  G+  + L  +P
Sbjct: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SP 140

Query: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236
           +E V+IRLQ Q   G+    +++  ++    I K     AL RG++ T  R+    G  F
Sbjct: 141 IEHVRIRLQTQT--GSGTNAEFKGPLEC---IKKLRHNKALLRGLTPTILREGHGCGTYF 195

Query: 237 TVYSKLM-ERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTR- 292
            VY  L+  ++ +  G   +++P+W+  + G +SG        PLD IK+ +Q D   + 
Sbjct: 196 LVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP 255

Query: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
              N   I+++ + L    G  A +KG  P ++R AP    TF  +E   R L
Sbjct: 256 KFGN--SISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           +L++ L+E+    N    +  L G   G        P DT K RLQ   +       V  
Sbjct: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVV-- 66

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
               R+L+  EG R  YKG    ++ V    ++ F V E ++R   
Sbjct: 67  ----RKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  104 bits (260), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/307 (28%), Positives = 148/307 (48%), Gaps = 23/307 (7%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           D+  S   +T    +L+AG   G+ + L   P DT KVR+Q    +    K         
Sbjct: 12  DDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIK 65

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTFLA 161
           ++   EG + FYKG    ++G+   ++++F   E    F+ T   +  +  +S    ++ 
Sbjct: 66  DLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYIC 124

Query: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
           GV  G T + L  +P+E ++IRLQ Q   GA  +  ++  I     I K    G L RG+
Sbjct: 125 GVAGGFTNSFL-ASPIEHIRIRLQTQTGSGATAE--FKGPIDC---IKKLRVNGQLMRGL 178

Query: 222 SLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDT 280
           + T  R++   G  F  Y  L+  +++     +++P+W+  L G  SG +      PLD 
Sbjct: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238

Query: 281 IKTRLQKD--KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           IK+ +Q D  K+ +N +N   I T+GR ++  +G   L+KG  P ++R AP  A TF  +
Sbjct: 239 IKSVMQTDNLKTPKNGNN---ILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATF 295

Query: 339 EFVRRHL 345
           E   R L
Sbjct: 296 ETAMRLL 302

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 135/299 (45%), Gaps = 21/299 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           N   G  AG   A   +P+D +K RMQ  R +    +    +     I+  +G+   Y G
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNS---VQYKNSIDCVVKIFQTKGIRGLYSG 563

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           LG  +IG+ P+ AI+ +  +F R    ++ +  +      L+G  AG  + V   NP+E+
Sbjct: 564 LGPQLIGVAPEKAIKLTVNDFMRQYFMNK-SRTIKWYQEILSGATAGACQVVFT-NPLEI 621

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           VKIRLQ +  +     +    A+     I+++ G+  LY+G +    R        F  Y
Sbjct: 622 VKIRLQMRSDYVGENARPQLGAVG----IIRQLGLRGLYKGAAACLLRDVPFSAIYFPTY 677

Query: 240 SKLMERLQEY-----HGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           + L + +  +     +    L +WE  L G ++G    +   P D IKTRLQ D   +  
Sbjct: 678 AHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID-PRKGE 736

Query: 295 SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGS 353
           + +  +    R +++EE  ++ +KG   RV+R +P    T   +E  +      GLF S
Sbjct: 737 TTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQ------GLFPS 789

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score =  105 bits (262), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 132/302 (43%), Gaps = 22/302 (7%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQ---IYRRANEGTKPPGFLRTGANIYSGEGLLA 115
           +N ++G  AGL   +   PLD  K R+Q   +  R  E     G + T   I   EG+  
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN 175
            YKGL  +++G  P   I FS YEF +  L    +      ++F + + AG    V V N
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSF-SAITAGAVSTV-VTN 187

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGAN 235
           P+ VVK RL  Q  H  +    Y+    A   I+ +EG+ ALY G+ + +     +   +
Sbjct: 188 PIWVVKTRLMLQ-THIGSNTTHYQGTYDAFKKIINQEGVKALYAGL-VPSLLGLLHVAIH 245

Query: 236 FTVYSKLMERLQEYHGSQNLPSWETSLIGL-----VSGAIGPFSNAPLDTIKTRLQKDKS 290
           F VY +L    + Y   ++    + +L  L     VS  +    + P + ++TRLQ    
Sbjct: 246 FPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSD 305

Query: 291 T----RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
                R L   ++IT I      +EG    Y G    + R  P  A+T   +E+VR  L 
Sbjct: 306 LPSHQRRLIPLIKITYI------QEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLN 359

Query: 347 GL 348
            +
Sbjct: 360 KI 361

>Scas_582.7
          Length = 329

 Score =  104 bits (260), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 133/293 (45%), Gaps = 22/293 (7%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L+AG  AG+ E     P+D +K R+Q              ++  + I + EG LA +KG+
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 121 GAVVIGIIPKMAIRFSSYEFYRT-LLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
            +V++G  P  A+ F++YEF +  L+ D Q          ++G  A V      +NP + 
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASD-FFMNPFDT 158

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           +K R+Q   L    +++K  N  +  Y +   EG+ A Y     T A        NF +Y
Sbjct: 159 IKQRMQISDL----KKEKVYNVAKKIYNL---EGLSAFYYSYPTTIAMNIPFAAFNFMIY 211

Query: 240 ---SKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ-KDKSTRNLS 295
              SK    L  Y+   +       L G +SGAI      PLD IKT +Q +  S  +L 
Sbjct: 212 ESASKFFNPLHHYNPLIH------CLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLE 265

Query: 296 NWVRITTIGR---QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
              +  T  +    ++   G++  ++G+ PR++   P  A+++T YE  +  L
Sbjct: 266 VMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 59/143 (41%), Gaps = 15/143 (10%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104
           PD   S +++  P    V+G TA +      +P DTIK RMQI     E           
Sbjct: 126 PD---SQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKV-----YNVA 177

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVG 164
             IY+ EGL AFY      +   IP  A  F  YE      A +    +   N  +  + 
Sbjct: 178 KKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYE-----SASKFFNPLHHYNPLIHCLC 232

Query: 165 AGVTEAV--LVVNPMEVVKIRLQ 185
            G++ A+   V  P++ +K  +Q
Sbjct: 233 GGISGAIAAAVTTPLDCIKTVIQ 255

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score =  103 bits (258), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 135/305 (44%), Gaps = 30/305 (9%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG---------------FLRTGA 105
           L+AG  AG+ E     P+D +K RMQ                             L+  +
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD-RQTGVVSTGNTFLAGVG 164
            I S EG LA ++G+ ++V+G  P  A+ F++YEF +  L D +         T ++GV 
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSGVA 143

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224
           A V    L +NP + +K RLQ Q    +++   +R     A+ I K EG  A +     T
Sbjct: 144 ATVAADAL-MNPFDTIKQRLQLQ--SKSSDSSMWR----MAFNIYKNEGPMAFFYSYPTT 196

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTR 284
            A        NF +Y       + ++ +     W   L G ++GA       PLD IKT 
Sbjct: 197 LAMNIPFAALNFVIYE---SSTKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIKTV 253

Query: 285 LQ-KDKSTRNLSNWVRITTI---GRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
           LQ +   T ++ ++    T     + + Q  G++  ++G+ PRV+   P  A+++T YEF
Sbjct: 254 LQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEF 313

Query: 341 VRRHL 345
            +  L
Sbjct: 314 AKHLL 318

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI----------YRRANEGTKPPGFLRTGA 105
           NP ++ + GG AG   A    PLD IK  +QI          ++ AN       F +   
Sbjct: 225 NPWIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANT------FKKAAQ 278

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ 149
            I+   G   F++GL   VI  IP  AI ++SYEF + LL  +Q
Sbjct: 279 AIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEFAKHLLFTKQ 322

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 15/170 (8%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           P    V+G  A +      +P DTIK R+Q+  ++++ +      R   NIY  EG +AF
Sbjct: 134 PLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSS----MWRMAFNIYKNEGPMAF 189

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
           +      +   IP  A+ F  YE          T   +     L G  AG T A  V  P
Sbjct: 190 FYSYPTTLAMNIPFAALNFVIYESSTKFF--NPTNAYNPWIHCLCGGIAGATCAA-VTTP 246

Query: 177 MEVVKIRLQAQ-----HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
           ++ +K  LQ +     H+        ++ A QA   I +  G    +RG+
Sbjct: 247 LDCIKTVLQIRGSDTVHVESFKTANTFKKAAQA---IWQSYGWKGFWRGL 293

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  103 bits (258), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 136/303 (44%), Gaps = 30/303 (9%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           ++ AG   G+ + L   P DT KVR+Q              L    N+   EG+ AFYKG
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT------LEVLRNLVKNEGVFAFYKG 90

Query: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGV------VSTGNT------FLAGV 163
               ++G+   ++++F   E    F++   A +   +      +S  NT      ++ G+
Sbjct: 91  ALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGL 150

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
             GV  + L  +P+E ++IRLQ Q  +G   + K          I K +  G L RG+  
Sbjct: 151 TGGVVNSFLA-SPIEQIRIRLQTQTSNGGDREFK-----GPWDCIKKLKAQGGLMRGLFP 204

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPFSNAPLDTIK 282
           T  R     G  F VY  L+ R      ++N +P W+  L G  SG +   +  PLD +K
Sbjct: 205 TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
           + +Q D   R       I+ + + +  +EG RA +KG  P ++R AP    TF  +E V 
Sbjct: 265 SIIQND-DLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVM 323

Query: 343 RHL 345
           R L
Sbjct: 324 RFL 326

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 85/199 (42%), Gaps = 29/199 (14%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE-GLLAFYKGL 120
           V G T G+  +    P++ I++R+Q  + +N G +           + G    +   K  
Sbjct: 147 VCGLTGGVVNSFLASPIEQIRIRLQT-QTSNGGDRE----------FKGPWDCIKKLKAQ 195

Query: 121 GAVVIGIIPKMAIR----FSSYEFYRTLLADRQTGVVSTGNTF------LAGVGAGVTEA 170
           G ++ G+ P M IR      +Y      L  R+ G   T N        L G  +G T  
Sbjct: 196 GGLMRGLFPTM-IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSG-TML 253

Query: 171 VLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQ-AAYLIVKEEGIGALYRGVSLTAARQA 229
            L V P++VVK  +Q   L     + KY+N+I   A  I  +EGI A ++G   T  R A
Sbjct: 254 WLTVYPLDVVKSIIQNDDLR----KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSA 309

Query: 230 TNQGANFTVYSKLMERLQE 248
              GA F  +  +M  L E
Sbjct: 310 PVNGATFLTFELVMRFLGE 328

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 79/206 (38%), Gaps = 27/206 (13%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
            AG   G+ + VLV  P +  K+RLQ          +  RN       +VK EG+ A Y+
Sbjct: 39  FAGTIGGIAQ-VLVGQPFDTTKVRLQTATTR-TTTLEVLRN-------LVKNEGVFAFYK 89

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN---------------LPSWETSLIG 264
           G               F V   +    Q Y+ S+N               LP  +  + G
Sbjct: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCG 149

Query: 265 LVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
           L  G +  F  +P++ I+ RLQ   S      +       ++L  + G   L +G+ P +
Sbjct: 150 LTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTM 206

Query: 325 MRVAPGQAVTFTVYEFVRRHLEGLGL 350
           +R   G    F VYE +     G GL
Sbjct: 207 IRAGHGLGTYFLVYEALVAREIGTGL 232

>Kwal_56.23011
          Length = 303

 Score =  102 bits (255), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 133/303 (43%), Gaps = 19/303 (6%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           D+ + +        ++  G   G+ + L   P D  KVR+Q          P    +   
Sbjct: 12  DDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQT------SPVPTTAAQVIK 65

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV---VSTGNTFLAG 162
           ++   EGLLAFYKG  A + G+   ++ +F   E  +     +       ++    +  G
Sbjct: 66  SLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACG 125

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222
             +G   A L   P+E V+IRLQ Q    +A +  Y  ++  A  ++K+   GAL RG +
Sbjct: 126 FVSGTANAFLA-TPIEHVRIRLQLQTASSSAAE--YHGSLDCARKLLKQ---GALMRGFT 179

Query: 223 LTAARQATNQGANFTVYSKLMERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSNAPLDT 280
            T  R +   G  F  Y  L+   Q +HG   +N+P+W+  + G  SGA       P D 
Sbjct: 180 ATTLRTSHGFGIYFLTYETLIAN-QAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDV 238

Query: 281 IKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
           +K+ +Q DK  +N         + + + +E G RA  KG TP ++R  P    TF  +E 
Sbjct: 239 VKSVMQADK-LKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEI 297

Query: 341 VRR 343
             R
Sbjct: 298 TMR 300

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score =  102 bits (254), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 135/294 (45%), Gaps = 29/294 (9%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L+AG  AG+ E     P+D IK R+Q    ++ G    G ++  + I + EG LA +KG+
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQ---SSSSGAATQGLIKQISKITTAEGSLALWKGV 76

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTG-NTFLAGVGAGVTEAVLVVNPMEV 179
            +V++G  P  A+ F++YEF ++ L D Q         T ++G+ A  T A  ++NP +V
Sbjct: 77  QSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGM-AATTVADALMNPFDV 135

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           +K R+Q           K          I  +EG  A Y     T          NF +Y
Sbjct: 136 IKQRMQLNTRESVWHVTKN---------IYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIY 186

Query: 240 ---SKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSN 296
              +K M    EY+   +  S      G +SGA       PLD IKT LQ  + +  +SN
Sbjct: 187 ESATKFMNPSNEYNPFIHCIS------GGLSGATCAAITTPLDCIKTVLQV-RGSETVSN 239

Query: 297 WV--RITTIGR---QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            +  +  T  R    + +  G++   +G+ PRV+   P  A+++T YE  +  L
Sbjct: 240 EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 49/103 (47%), Gaps = 4/103 (3%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI---YRRANEGTKPPG-FLRTG 104
           M+     NP ++ ++GG +G   A    PLD IK  +Q+      +NE  K    F R  
Sbjct: 193 MNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAA 252

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 147
           + IY   G   F +GL   VI  +P  AI ++SYE  +  L +
Sbjct: 253 SAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFLVN 295

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 66/169 (39%), Gaps = 16/169 (9%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           P    ++G  A        +P D IK RMQ+  R +             NIY  EG  AF
Sbjct: 112 PIKTAISGMAATTVADALMNPFDVIKQRMQLNTRES-------VWHVTKNIYHKEGFAAF 164

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL--VV 174
           Y      ++  IP  A  F+ YE      A +     +  N F+  +  G++ A    + 
Sbjct: 165 YYSYPTTLVMNIPFAAFNFAIYE-----SATKFMNPSNEYNPFIHCISGGLSGATCAAIT 219

Query: 175 NPMEVVKIRLQAQHLHGAA-EQQKYRNAIQ-AAYLIVKEEGIGALYRGV 221
            P++ +K  LQ +     + E  K  N  Q AA  I K  G     RG+
Sbjct: 220 TPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGL 268

>Scas_558.2
          Length = 289

 Score =  102 bits (253), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 135/302 (44%), Gaps = 40/302 (13%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           ++L++G  AG    L   P+DT+K R+Q            GF + G       G    Y+
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQ---------AKGGFFQNG-------GYHGIYR 51

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT----------FLAGVGAGVT 168
           GLG+ V+   P  ++ F +Y+  +  +      V+++  T           +     G  
Sbjct: 52  GLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGEL 111

Query: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI-GALYRGVSLTAAR 227
            A LV  P EV+K R Q    +  +  Q +R  ++       +EGI   LYRG S T  R
Sbjct: 112 AACLVRVPAEVIKQRTQVHSTN--SSWQTFRTILKNE----NQEGIIRNLYRGWSTTIMR 165

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQ-NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
           +       F +Y  + +    Y     +L  W+ ++ G ++G I   +  PLD +KTRL 
Sbjct: 166 EIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLM 225

Query: 287 KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
            +K +      + I ++ R + +EEGF+  + GI PR M ++ G A+   VYE +   L+
Sbjct: 226 LNKDS------IPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETMHFMLQ 279

Query: 347 GL 348
            L
Sbjct: 280 SL 281

>Scas_709.9
          Length = 365

 Score =  103 bits (257), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 144/326 (44%), Gaps = 29/326 (8%)

Query: 39  VCQQPYPDNHMSSK------KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN 92
           + Q   P+ H++S         ++P +  ++G  AG    +   PLD  K R+Q   +  
Sbjct: 40  LLQSHEPEKHIASTVIQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQ--AQGI 97

Query: 93  EGTKPP---GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ 149
           +  + P   G L T + I   EG+   YKGL  +++G  P   I FS YEF + L     
Sbjct: 98  QSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPR-- 155

Query: 150 TGVVSTGNTFLAGVGAGVT---EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY 206
              V   + F++   + +T    + ++ NP+ VVK RL  Q   G +    YR  I A  
Sbjct: 156 ---VLPNSDFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTH-YRGTIDAFK 211

Query: 207 LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY-----HGSQNLPSWETS 261
            I+ +EG+  LY G+ + +     +   +F VY KL  RL        H SQ      T 
Sbjct: 212 KIITQEGVRTLYTGL-VPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTR 270

Query: 262 LI--GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319
           LI     S  +      P + ++TR+Q  KS + L +  ++  + ++  + EG    Y G
Sbjct: 271 LIIASSASKMLASILTYPHEILRTRMQL-KSDKLLISKHKLLDLIKRTYRYEGLLGFYSG 329

Query: 320 ITPRVMRVAPGQAVTFTVYEFVRRHL 345
               ++R  P  A+T   +E+ R  L
Sbjct: 330 FATNLLRTVPASAITLVSFEYFRNAL 355

>Kwal_0.232
          Length = 274

 Score =  101 bits (252), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 128/296 (43%), Gaps = 39/296 (13%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +L+AG  AG    L   P+DT+K R+Q            GF   G       G L  Y+G
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQ---------AAGGFFANG-------GYLGVYRG 52

Query: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLV 173
           LG+ V+   P  ++ F +Y+    + R +  +  T    V+   T +    AG   A +V
Sbjct: 53  LGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMV 112

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA---LYRGVSLTAARQAT 230
             P EV+K R Q      + +  K         L+  E G G    LYRG S T  R+  
Sbjct: 113 RVPAEVIKQRTQTHKSDSSLQTLKK--------LLQNENGEGIRRNLYRGWSTTVMREIP 164

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
                F +Y  L ++     G + +  W+ +  G V+G I   +  PLD +KTRL    +
Sbjct: 165 FTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHT 224

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
           +      V +  + RQ+   EG++  + G+ PR + ++ G A+   VYE V   L 
Sbjct: 225 S------VPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETVHSILS 274

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 6/95 (6%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE 111
           ++   P      G  AG   A    PLD +K R+ +       T  P  L     IY+ E
Sbjct: 186 REQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSH-----TSVP-VLHLARQIYATE 239

Query: 112 GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
           G   F+ G+G   + I    AI    YE   ++L+
Sbjct: 240 GWKVFFSGVGPRTVWISAGGAIFLGVYETVHSILS 274

>Scas_632.9
          Length = 292

 Score =  102 bits (253), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 142/301 (47%), Gaps = 18/301 (5%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP-PGFLRTG 104
           D+ +      N   ++V G  AG F  +  +P DT+KVR+Q      +G+   P      
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQ-----TQGSHIFPTTWSCI 60

Query: 105 ANIYSGEGLL-AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGV 163
              Y  EG+   F++G+G+ + G   + A  F SY     +L ++ T V    N  L+G 
Sbjct: 61  KYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL-EKFTNVSPLSNILLSGA 119

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ-KYRNAIQAAYLIVKEEGIGALYRGVS 222
            AG + A  V+ P+E++K +LQ  +L  A E Q K+   I     +++E+GI  L++G S
Sbjct: 120 FAG-SCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQS 178

Query: 223 LTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
            T  R++    A F  Y  + + L++        +WE  + G  +G     S  P DT+K
Sbjct: 179 STFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVK 238

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
           + +Q +  T  L N V      ++++   G    Y+G+   ++R  P  A  F +YE + 
Sbjct: 239 SMMQTEHIT--LINAV------KKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETLS 290

Query: 343 R 343
           +
Sbjct: 291 K 291

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 74/175 (42%), Gaps = 12/175 (6%)

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG-ALYRGVSLTAARQATNQGA 234
           P + VK+RLQ Q  H         + I+  Y     EG+    ++G+       A     
Sbjct: 37  PFDTVKVRLQTQGSHIFPTTW---SCIKYTY---HNEGVWRGFFQGIGSPLFGAALENAT 90

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
            F  Y++    L+++     L +    L G  +G+   F   P++ IK +LQ       +
Sbjct: 91  LFVSYNQCSNVLEKFTNVSPLSN--ILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAV 148

Query: 295 SNWVRITTIGRQL---VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
              ++ T I   L   ++E+G   L++G +   +R + G    F  YE +++ L+
Sbjct: 149 EGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLK 203

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 139/299 (46%), Gaps = 30/299 (10%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA--NIYSGEGLLAFY 117
           ++ +G   G+ + L   P D IKVR+Q        T P       A  ++   EG + FY
Sbjct: 27  DVFSGTVGGVAQVLVGQPFDIIKVRLQ--------TMPGNATAWEAITDLVKYEGFMGFY 78

Query: 118 KGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGV----VSTGNTFLAGVGAGVTE 169
           KG  A ++G+   ++ +F   E    ++R L  +R  G+    +S G  +  G  +G   
Sbjct: 79  KGTMAPLVGVGACVSCQFGINEAMKRYFRDL--NRSRGIYDNTLSLGQYYTCGFVSGSAN 136

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
           A+L   P+E V+IRLQ Q    A    +Y++ +     ++K+   G+L RG + T  R +
Sbjct: 137 ALLA-TPIEHVRIRLQLQK--EALANAEYKSTLDCTEKLLKQ---GSLMRGFTATLMRTS 190

Query: 230 TNQGANFTVYSKLMERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
              G  F  Y  L+   Q  HG   +++ +W+  + G +SGA       P D +K+ +Q 
Sbjct: 191 HGFGIYFLTYETLIAS-QLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQA 249

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
           DK   N +    +  + + + +E G RA  KG  P ++R  P    TF  +E   + L+
Sbjct: 250 DKLV-NPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 47/108 (43%), Gaps = 8/108 (7%)

Query: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           +++E L + HG +   + +    G V G        P D IK RLQ      N + W  I
Sbjct: 10  QVVEDLTDLHGFRK--TLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPG--NATAWEAI 65

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           T     LV+ EGF   YKG    ++ V    +  F + E ++R+   L
Sbjct: 66  T----DLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDL 109

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 99.8 bits (247), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 132/303 (43%), Gaps = 39/303 (12%)

Query: 54  STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGL 113
           S++  V+L +G  AG    L   P+DT+K R+Q            GF   G       G 
Sbjct: 3   SSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQ---------AKGGFFANG-------GY 46

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGN------TFLAGVGAGV 167
              Y+GLG+ VI   P  ++ F SY+  +       +  V++ N      + +     G 
Sbjct: 47  KGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGE 106

Query: 168 TEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL---YRGVSLT 224
             A LV  P EV+K R Q    +  +  Q +   +Q       E G G L   YRG + T
Sbjct: 107 VSACLVRVPAEVIKQRTQTHKTN--SSWQTFTKILQ------NENGEGVLRNLYRGWNTT 158

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTR 284
             R+       F +Y  L +   + +G  ++  W+ S+ G V+GAI   +  PLD +KTR
Sbjct: 159 IMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTR 218

Query: 285 LQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRH 344
           L     +      + +  + + +  EEGF+  + G+ PR M ++ G A+   VYE V   
Sbjct: 219 LMLSHKS------IPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETVHSI 272

Query: 345 LEG 347
           L G
Sbjct: 273 LSG 275

>Kwal_33.12988
          Length = 303

 Score =  100 bits (249), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 129/290 (44%), Gaps = 17/290 (5%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           ++ AG T G+ + L   P D  KVR+Q        + P   LR   ++   EGL  FYKG
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQT------SSTPTTALRVVQDLVKNEGLRGFYKG 79

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
               +IG+   ++ +F + E  +     R   Q+  +     +  G  +G   A L   P
Sbjct: 80  TTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLA-TP 138

Query: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236
           +E V+I LQ Q    A    +Y+ A+     ++KE   G L RG + T  R +   G  F
Sbjct: 139 IEHVRILLQVQTKSRA--DAEYQGAMDCIKKLLKE---GKLMRGFTPTILRTSHGFGVYF 193

Query: 237 TVYSKLMERLQEYH-GSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLS 295
           T Y  ++   Q      +++P+W+  L G  SG++      P D IK+ +Q DK  R   
Sbjct: 194 TSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDK-LRTPV 252

Query: 296 NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
               +  + + +  E G +A  KG  P ++R  P    TFT +E   R L
Sbjct: 253 YGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRIL 302

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P D  K RLQ   ++   +  +R+    + LV+ EG R  YKG T  ++ V    +  F 
Sbjct: 43  PFDITKVRLQ---TSSTPTTALRVV---QDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFG 96

Query: 337 VYEFVRRHLEGLGLFGS 353
             E ++R+      F S
Sbjct: 97  TNEAMKRYFHKRNNFQS 113

>Kwal_33.14050
          Length = 314

 Score =  100 bits (248), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 132/299 (44%), Gaps = 21/299 (7%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYR----RANEGTK-PPGFLRTGANIYSGEGLLA 115
           L AG  AG+ E     P+D IK RMQ        AN   K P   ++  A I + EG +A
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTG-NTFLAGVGAGVTEAVLVV 174
            +KG+ +V++G  P  A+ F++YE  ++ L D Q         T  +G+ A V  A L++
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA-ADLLM 138

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
           NP + +K R+Q   L   ++ + +  A +    I + EG+ A +     T A        
Sbjct: 139 NPFDTIKQRMQ---LRTFSKDRMWSVASR----IYRNEGLAAFFYSYPTTIAMNIPFAAF 191

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
           NF +Y    +     +    L      L G +SGA       PLD IKT LQ   S   +
Sbjct: 192 NFAIYESATKFFNPENTYNPLIH---CLCGGISGATCAAITTPLDCIKTVLQVRGSESVV 248

Query: 295 SNWVR----ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLG 349
               R     +     + +  G+   ++G+ PR++   P  A+++T YE  +  L   G
Sbjct: 249 DPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAKHTLFNYG 307

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP------GFLRTGA 105
           + + NP ++ + GG +G   A    PLD IK  +Q+  R +E    P       F R  +
Sbjct: 206 ENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQV--RGSESVVDPLFRQADTFSRAAS 263

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE 139
            I    G   F++GL   +I  +P  AI +++YE
Sbjct: 264 AISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 71/173 (41%), Gaps = 17/173 (9%)

Query: 55  TNPAVNLVAGGTAGLFEA-LCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGL 113
           T+  +   A G A    A L  +P DTIK RMQ+   + +           + IY  EGL
Sbjct: 117 THQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKD-----RMWSVASRIYRNEGL 171

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL- 172
            AF+      +   IP  A  F+ YE      A +     +T N  +  +  G++ A   
Sbjct: 172 AAFFYSYPTTIAMNIPFAAFNFAIYE-----SATKFFNPENTYNPLIHCLCGGISGATCA 226

Query: 173 -VVNPMEVVKIRLQAQHLHGAAEQQKYRNA---IQAAYLIVKEEGIGALYRGV 221
            +  P++ +K  LQ +      +   +R A    +AA  I K  G    +RG+
Sbjct: 227 AITTPLDCIKTVLQVRGSESVVDPL-FRQADTFSRAASAISKVYGWSGFWRGL 278

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  100 bits (248), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 129/312 (41%), Gaps = 31/312 (9%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           D+   +  ST    +L+AG   G+ + L   P DT KVR+Q        + P   L    
Sbjct: 12  DDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ------TSSVPTTALDVVK 65

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT------- 158
            +   EG   FYKG    ++G+   ++++F   E  +     R       GN+       
Sbjct: 66  KLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN------GNSGPNETLG 119

Query: 159 ----FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI 214
               +L G   G   + L  +P+E V+IRLQ Q   GAA Q  +   +     I K    
Sbjct: 120 LLQYYLCGFAGGTANSFLA-SPIEHVRIRLQTQTGTGAAAQ--FHGPLDC---IKKLTAN 173

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPF 273
            +L RG++ T  R++   G  F  Y  L+   L +      +P+W+  L G  SG     
Sbjct: 174 NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL 233

Query: 274 SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
              PLD IK+ +Q D S         +  + + +    G  + +KG  P ++R AP    
Sbjct: 234 MIYPLDVIKSVMQTD-SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292

Query: 334 TFTVYEFVRRHL 345
           TF  +E   R L
Sbjct: 293 TFATFELAMRVL 304

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  100 bits (248), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 134/306 (43%), Gaps = 43/306 (14%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           ++++G + G+ + L   P D  KVRMQ        +  P  +    N+   EGLLAFYKG
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQ------TSSGSPTAIEVIKNLVKNEGLLAFYKG 79

Query: 120 LGAVVIGIIPKMAIRFSSYE-----FYR---------TLLADRQTGVVS-TGNTFLAGVG 164
               +IG+   ++ +F   E     F R         +LL     G VS + N FLA   
Sbjct: 80  TLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLA--- 136

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224
                      P+E V+IRLQ Q    A  + +YR ++     ++K++   AL RG + T
Sbjct: 137 ----------TPIEHVRIRLQLQT--KALAKAEYRGSLDCMKKLLKQK---ALMRGFTAT 181

Query: 225 AARQATNQGANFTVYSKLMERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
             R +   G  F  Y  L+   Q  +G   +++P W+  + G  SGA       P D +K
Sbjct: 182 LMRTSHGFGVYFLTYEALIMN-QNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVK 240

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
           + +Q D+    +     +  + + +    G+ A  KG  P ++R  P    TF  +E   
Sbjct: 241 SIMQADRLVSPVHG-KNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTM 299

Query: 343 RHLEGL 348
           R LE L
Sbjct: 300 RLLESL 305

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 136/298 (45%), Gaps = 24/298 (8%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQ-IYRRANEGTKP--PGFLRTGANIYSGEGLL 114
           A  L+AG  AG+ E     PLD +K R+Q ++  +  G +P     LR  ++I + EG +
Sbjct: 19  AHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSM 78

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAV--- 171
             +KG+ +V++G  P  A+ F++YE  ++ L D  T   ++   F     +G T  +   
Sbjct: 79  VLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATS--TSKYHFFKTAFSGATATIAAD 136

Query: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATN 231
            ++NP +V+K R+Q        +  K          I  +EG  A Y     T A     
Sbjct: 137 ALMNPFDVIKQRIQLNTNISVWDTAK---------RIYSKEGFQAFYSSYPTTLAINIPF 187

Query: 232 QGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKST 291
              NF +Y       + ++ S     +   L G +SGA       PLD IKT LQ   S 
Sbjct: 188 AAFNFGIYDT---ATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSE 244

Query: 292 R-NLSNWVRITTIG---RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           + ++  + +  T     R + Q  G+R  + G+ PR++   P  A+++T YEF +  L
Sbjct: 245 KVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 79/198 (39%), Gaps = 10/198 (5%)

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH-LHGAAEQQKYRNAIQAAYLIVKEEGI 214
            +  +AG  AG+ E   V+ P++ +K RLQA H +     Q      ++    I  +EG 
Sbjct: 19  AHQLMAGAFAGIAEHS-VIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGS 77

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERL-QEYHGSQNLPSWETSLIGLVSGAIGPF 273
             L++GV              F  Y  +   L  E   +     ++T+  G  +      
Sbjct: 78  MVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADA 137

Query: 274 SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
              P D IK R+Q +    N+S W       +++  +EGF+A Y      +    P  A 
Sbjct: 138 LMNPFDVIKQRIQLNT---NISVW----DTAKRIYSKEGFQAFYSSYPTTLAINIPFAAF 190

Query: 334 TFTVYEFVRRHLEGLGLF 351
            F +Y+   R+    G++
Sbjct: 191 NFGIYDTATRYFNPSGVY 208

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 16/100 (16%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIK----------VRMQIYRRANEGTKPPGFLRTGA 105
           NP ++ + GG +G   A    PLD IK          V M+++++A+       F +   
Sbjct: 209 NPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADT------FKKATR 262

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
            IY   G   F+ G+   ++  +P  AI +++YEF +  L
Sbjct: 263 AIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 132/294 (44%), Gaps = 28/294 (9%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L+AG  AG+ E     P+D +K R+Q     +   K    L   ++I + EG LA +KG+
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAK--NMLSQISHISTSEGTLALWKGV 94

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGV--GAGVTEAVLVVNPME 178
            +V++G  P  A+ F +YEF +  L D  +    T + F   +      T +  ++NP +
Sbjct: 95  QSVILGAGPAHAVYFGTYEFCKKNLID--SSDTQTHHPFKTAISGACATTASDALMNPFD 152

Query: 179 VVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTV 238
            +K R+Q   L+ +A      +  Q    I + EG+ A Y     T          NF +
Sbjct: 153 TIKQRIQ---LNTSA------SVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVI 203

Query: 239 Y---SKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ-KDKSTRNL 294
           Y   +K +    EY+   +       L G +SG+       PLD IKT LQ +   T +L
Sbjct: 204 YESSTKFLNPSNEYNPLIHC------LCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSL 257

Query: 295 SNWVRITTIGR---QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
               +  T  +    + Q  G++  ++G  PR++   P  A+++T YE  +  L
Sbjct: 258 EIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 22/142 (15%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYS 109
           S  ++ +P    ++G  A        +P DTIK R+Q+   A+         +T   IY 
Sbjct: 123 SDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSAS-------VWQTTKQIYQ 175

Query: 110 GEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTF------LAGV 163
            EGL AFY      ++  IP  A  F  YE          T  ++  N +      L G 
Sbjct: 176 SEGLAAFYYSYPTTLVMNIPFAAFNFVIYE--------SSTKFLNPSNEYNPLIHCLCGS 227

Query: 164 GAGVTEAVLVVNPMEVVKIRLQ 185
            +G T A  +  P++ +K  LQ
Sbjct: 228 ISGSTCAA-ITTPLDCIKTVLQ 248

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIK----------VRMQIYRRANEGTKPPGFLRTGA 105
           NP ++ + G  +G   A    PLD IK          V ++I R+A+       F +  +
Sbjct: 218 NPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADT------FSKAAS 271

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
            IY   G   F++G    ++  +P  AI +++YE  +  L
Sbjct: 272 AIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 132/298 (44%), Gaps = 40/298 (13%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           ++L++G  AG    L   P+DTIK R+Q            GF   G       G    Y+
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQ---------AKGGFFANG-------GYKGIYR 49

Query: 119 GLGAVVIGIIPKMAIRFSSYEF-------YRTLLADRQTGVVSTGNTFLAGVGAGVTEAV 171
           GLG+ V+   P  ++ F SY++       Y + L  + +  +    T +     G   A 
Sbjct: 50  GLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICAC 109

Query: 172 LVVNPMEVVKIRLQAQHLHGAAE--QQKYRNAIQAAYLIVKEEGI-GALYRGVSLTAARQ 228
           LV  P EVVK R Q    + + +  Q   RN          +EG+   LYRG S T  R+
Sbjct: 110 LVRVPAEVVKQRTQVHSTNSSWQTLQSILRND--------NKEGLRKNLYRGWSTTIMRE 161

Query: 229 ATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
                  F +Y  L +   + +G   +  W+ ++ G ++G I   +  PLD +KTRL  +
Sbjct: 162 IPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN 221

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
           K+T +L       ++  ++ +EEG    + G+ PR M ++ G A+   +YE V   L 
Sbjct: 222 KTTASLG------SVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 79/198 (39%), Gaps = 33/198 (16%)

Query: 157 NTF----LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           NTF    L+G  AG T   LV  P++ +K RLQA+    A                    
Sbjct: 2   NTFFLSLLSGAAAG-TSTDLVFFPIDTIKTRLQAKGGFFA------------------NG 42

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY------HGSQNLPSWETSLIGLV 266
           G   +YRG+       A      F  Y  +  + + Y       GS+ L    T ++   
Sbjct: 43  GYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSS 102

Query: 267 SGAI-GPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVM 325
            G I       P + +K R Q   +    S+W  + +I R   +E   + LY+G +  +M
Sbjct: 103 IGEICACLVRVPAEVVKQRTQVHSTN---SSWQTLQSILRNDNKEGLRKNLYRGWSTTIM 159

Query: 326 RVAPGQAVTFTVYEFVRR 343
           R  P   + F +YE++++
Sbjct: 160 REIPFTCIQFPLYEYLKK 177

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 6/91 (6%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLA 115
            P    + G  AG   A    PLD +K R+ +    N+ T   G +     IY  EG   
Sbjct: 189 EPWKGAICGSIAGGIAAATTTPLDFLKTRLML----NKTTASLGSVII--RIYREEGPAV 242

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
           F+ G+G   + I    AI    YE   +LL+
Sbjct: 243 FFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 130/293 (44%), Gaps = 26/293 (8%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L+AG  AG+ E     P+D +K R+Q        +   G +   + I + EG +A +KG+
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAAST--GMISQISKISTMEGSMALWKGV 84

Query: 121 GAVVIGIIPKMAIRFSSYEFYRT-LLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
            +V++G  P  A+ F +YEF +  L++           T L+G  A +    L +NP + 
Sbjct: 85  QSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADAL-MNPFDT 143

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           VK RLQ           +  N  +  Y   + EG  A Y     T A        NF +Y
Sbjct: 144 VKQRLQLD------TNLRVWNVTKQIY---QNEGFAAFYYSYPTTLAMNIPFAAFNFMIY 194

Query: 240 SKLMERLQEYHGSQNLPSWE---TSLIGLVSGAIGPFSNAPLDTIKTRLQ-KDKSTRNLS 295
               E   ++   QN  S+      L G +SGA       PLD IKT LQ +   T ++ 
Sbjct: 195 ----ESASKFFNPQN--SYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIE 248

Query: 296 NWVRITTIG---RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
                 T G   R +++  G++  ++G+ PR++   P  A+++T YE  +  L
Sbjct: 249 IMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIK----------VRMQIYRRANEGTKPPGFL 101
           + S NP ++ + GG +G   A    PLD IK          V ++I + AN       F 
Sbjct: 204 QNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANT------FG 257

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
           R    I    G   F++GL   ++  IP  AI +++YE  +  L
Sbjct: 258 RASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 68/173 (39%), Gaps = 16/173 (9%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYR--RANEGTKPPGFLRTGANIYSG 110
           ++  P    ++G  A +      +P DT+K R+Q+    R    TK          IY  
Sbjct: 116 QTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVTK---------QIYQN 166

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEA 170
           EG  AFY      +   IP  A  F  YE       + Q       +    G+ +G T A
Sbjct: 167 EGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFF-NPQNSYNPLIHCLCGGI-SGATCA 224

Query: 171 VLVVNPMEVVKIRLQAQHLHGAA-EQQKYRNAI-QAAYLIVKEEGIGALYRGV 221
            L   P++ +K  LQ +     + E  K  N   +A+  I++  G    +RG+
Sbjct: 225 ALTT-PLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGL 276

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 139/317 (43%), Gaps = 22/317 (6%)

Query: 43  PYPDNHMSSKKSTNPAVNLVAGGTAG-LFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL 101
           P   + +S       A+  +  GTAG + + L   P D  KVRMQ    A   T     +
Sbjct: 8   PQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQT--SAGSATA----V 61

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEF----YRTLLADRQTGVVSTGN 157
               ++   EG+L FYKG  A ++G+   ++ +F   E     +R +  D  +  +S   
Sbjct: 62  DVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGD-PSKPLSLKQ 120

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
            ++ GV +G   A L   P+E V+IRLQ Q    +    +Y+ ++     ++K+   GAL
Sbjct: 121 YYVCGVASGCANAFLA-TPIEHVRIRLQLQT--KSLANAEYQGSLDCMRKLLKQ---GAL 174

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSN 275
            RG + T  R     G  F+ Y  L+   Q   G   +++  W+  + G  SGA      
Sbjct: 175 MRGFTATLMRTCHGFGIYFSTYEALIAN-QHKKGIPRKDIAPWKVCIFGAFSGACYWAMA 233

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
            P+D +K+ +Q D+    +     +  + + +    G RA  KG  P ++R  P    TF
Sbjct: 234 YPIDVVKSIMQSDRLVSPVHG-TNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATF 292

Query: 336 TVYEFVRRHLEGLGLFG 352
             +E   R LE +   G
Sbjct: 293 ATFEMTMRLLERVDHLG 309

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 97.4 bits (241), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 146/317 (46%), Gaps = 35/317 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT----------KPPG---------FL 101
            +AGG +G+    C  P D IKV + I R     T          K P           +
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFL-IARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLI 261

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD----RQTGVVSTGN 157
           +    +Y   GL AFY G G  V+ + P+ AI+F S+E  + ++A     + T  +S  +
Sbjct: 262 KAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLS 321

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
           T++AG G G   A   V P++ +K R+Q   L+     +K    +Q A  + ++ GI   
Sbjct: 322 TYIAG-GLGGVAAQFSVYPIDTLKYRIQCAPLN--TNLKKSSILLQTAKEMYQQGGIRLF 378

Query: 218 YRGVSLTAARQATNQGANFTVYSKLME-RLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA 276
           YRGV +           +   +S L +  +++      LP  E  +  L+   +G FS  
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGT 438

Query: 277 -------PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
                  P++ ++TRLQ   +  +   +   + + ++ +Q EG++ L+KG+ P + +V P
Sbjct: 439 VGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCP 498

Query: 330 GQAVTFTVYEFVRRHLE 346
             ++++  YE ++R ++
Sbjct: 499 AVSISYLCYENLKRLMK 515

>Scas_578.3*
          Length = 524

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 138/308 (44%), Gaps = 33/308 (10%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT--KPPGFLRT-GANI---------- 107
            +AGG +G+    C  PLD IKV + I R     T   P   LR  G N+          
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFL-IARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 108 ----YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA----DRQTGVVSTGNTF 159
               Y   GL AFY G G  V  I P+ +I+F ++E  + L+A    D+    +S   T+
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTY 330

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           +AG  AGV  A + + P++ +K R+Q   L G  +       I  A  + KE GI   YR
Sbjct: 331 VAGGIAGVM-AQISIYPIDTLKFRIQCAPLEGNLKGNAL--LISTAKEMYKEGGIRVFYR 387

Query: 220 GVSLTAARQATNQGANFTVYSKLME-RLQEYHGSQNLPSWETSL-------IGLVSGAIG 271
           GV L A         +   +S L +  ++      N+P  +  L       +G  SG +G
Sbjct: 388 GVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVG 447

Query: 272 PFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
             +  P++ ++TRLQ   +  +   +     +  Q ++ EG    YKG+ P +++V P  
Sbjct: 448 ATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAV 507

Query: 332 AVTFTVYE 339
           ++ +  YE
Sbjct: 508 SIGYLCYE 515

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 82/174 (47%), Gaps = 10/174 (5%)

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR---QA 229
           ++NP    K+ L+ Q L+ A  +     AI++ Y   ++ G+ A Y G  L+  +   ++
Sbjct: 246 LLNP----KMHLRIQGLNLAKIRSPIIKAIRSLY---RQGGLRAFYVGNGLSVFKICPES 298

Query: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289
           + +   F +  +LM  L       +L   +T + G ++G +   S  P+DT+K R+Q   
Sbjct: 299 SIKFGTFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAP 358

Query: 290 STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
              NL     + +  +++ +E G R  Y+G+    + + P  A+    +  +++
Sbjct: 359 LEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKK 412

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 16/101 (15%)

Query: 264 GLVSGAIGPFSNAPLDTIKTRL--QKDKSTRNLSNWVRITTIG--------------RQL 307
           G +SG I     APLD IK  L  + D S+  L+  + +   G              R L
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSL 274

Query: 308 VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
            ++ G RA Y G    V ++ P  ++ F  +E  +R +  L
Sbjct: 275 YRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANL 315

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 38/86 (44%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L  G  +G   A   +P++ ++ R+Q            GF          EG+  FYKGL
Sbjct: 437 LPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGL 496

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLA 146
              ++ + P ++I +  YE ++  ++
Sbjct: 497 VPTLVKVCPAVSIGYLCYEKFKAAMS 522

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 94.4 bits (233), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 129/290 (44%), Gaps = 16/290 (5%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG 110
           S+ +     +L+ GG AG    L  +P DT+KVR+Q           P      ++ Y  
Sbjct: 2   SEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQ----TQSAALFPTTWSCVSHTYKQ 57

Query: 111 EGLL-AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTE 169
           EGL   FY+G+ + V G   + A+ F S+   + +L +  +        F   +    T 
Sbjct: 58  EGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFAGAIAGACTS 117

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            VL   P+E+VK +LQ  +L G +   +Y   +     IVK+ G+G L++G S T  R++
Sbjct: 118 YVL--TPVELVKCKLQVSNLTGVS-GPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRES 174

Query: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289
                 FT Y  L   L    GS     WE    G  +GA    S  P DT+K+ +Q + 
Sbjct: 175 AGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEH 234

Query: 290 STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                   + +    R ++++ G    Y+G+   ++R  P  AV F VYE
Sbjct: 235 --------LGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 10/176 (5%)

Query: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG-ALYRGVSLTAARQAT 230
           LV  P + VK+RLQ Q    AA      + +   Y   K+EG+    Y+G++        
Sbjct: 24  LVEYPFDTVKVRLQTQS---AALFPTTWSCVSHTY---KQEGLWRGFYQGMASPVFGAFL 77

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
                F  +++    L+  +    L   +    G ++GA   +   P++ +K +LQ    
Sbjct: 78  EHAVLFVSFNRAQAVLENCYSCGPLE--KVVFAGAIAGACTSYVLTPVELVKCKLQVSNL 135

Query: 291 T-RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           T  +   +  +    R +V++ G   L++G +   +R + G AV FT YE ++  L
Sbjct: 136 TGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKGWL 191

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 69/183 (37%), Gaps = 11/183 (6%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN-EGTKPPGFLRTGANIYSGEGLLAFYKG 119
           + AG  AG   +    P++ +K ++Q+       G +    L T   I    GL   ++G
Sbjct: 106 VFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
                I      A+ F++YE  +  LA R+    +T    LA            + P + 
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADT 225

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           VK  +Q +HL              A   ++K+ G    YRGV +T  R        F VY
Sbjct: 226 VKSTMQTEHL----------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

Query: 240 SKL 242
             L
Sbjct: 276 ESL 278

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
           L G V+G++G     P DT+K RLQ   +    + W   + +     QE  +R  Y+G+ 
Sbjct: 13  LYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTW---SCVSHTYKQEGLWRGFYQGMA 69

Query: 322 PRVMRVAPGQAVTFTVYEFVRRHLE 346
             V       AV F  +   +  LE
Sbjct: 70  SPVFGAFLEHAVLFVSFNRAQAVLE 94

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 94.4 bits (233), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 148/324 (45%), Gaps = 31/324 (9%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104
           P+N++ +    +  +  VAGG  G        P++ +K+ +Q+  +++      G +   
Sbjct: 4   PENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQV--QSSTTAYNGGLVHAV 61

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFL---- 160
             +Y  EG+   ++G G   + I P  A++++ YEF +T    R   V  +G+  L    
Sbjct: 62  KQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKT----RVFHVGQSGHEQLRSWE 117

Query: 161 --AGVGAGVTEAVLVVNPMEVVKIRLQAQ-------HLHGAAEQQKYRNAIQAAYLIVKE 211
              G   G   +VLV  P+++V+ RL  Q       H   A + ++    ++    I +E
Sbjct: 118 RLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177

Query: 212 EG-IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI 270
           EG +   YRGV  T+         NF +Y +L   +   + + ++ + + + IG VSG I
Sbjct: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-IGAVSGGI 236

Query: 271 GPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
                 P D ++ R Q       +   R  S    + TIGRQ    EG R  YKG+T  +
Sbjct: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQ----EGLRGYYKGLTANL 292

Query: 325 MRVAPGQAVTFTVYEFVRRHLEGL 348
           ++V P  AV + VYE +  ++ GL
Sbjct: 293 VKVVPAMAVQWFVYELISENMHGL 316

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G V GA+     +P++ +K  LQ   ST   +    +    +Q+ +EEG + L++G    
Sbjct: 23  GGVGGAVSRTVVSPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKGLFRGNGIN 80

Query: 324 VMRVAPGQAVTFTVYEFVRRHLEGLG 349
            +R+ P  AV + VYEF +  +  +G
Sbjct: 81  CLRIFPYSAVQYAVYEFCKTRVFHVG 106

>Scas_379.2
          Length = 301

 Score = 94.0 bits (232), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 123/295 (41%), Gaps = 28/295 (9%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           L+AG  AG+ E     P+D +K R+Q    +         L   A I + EG LA +KG+
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQ----STSAKSTSNMLSQMAKISTAEGSLALWKGV 82

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTG-NTFLAGVGAGVTEAVLVVNPMEV 179
            +V++G  P  A+ F++YE+ +  L D +         T L+G  A +    L +NP + 
Sbjct: 83  QSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADAL-MNPFDT 141

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
           +K R+Q              N  +  Y   K EG  A Y     T A        NF +Y
Sbjct: 142 LKQRMQLN------TNTTVWNVTKQIY---KNEGFSAFYYSYPTTLAMNIPFAAFNFMIY 192

Query: 240 ---SKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ----KDKSTR 292
              +K      +Y+   +       L G +SGA       PLD IKT LQ    +  S +
Sbjct: 193 ESATKFFNPTNDYNPLVH------CLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQ 246

Query: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEG 347
            +          + + Q  G +  ++G+ PRV    P  A+ +T YE  +  L G
Sbjct: 247 VMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFLLG 301

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIK----------VRMQIYRRANEGTKPPGFLRTGA 105
           NP V+ ++GG +G   A    PLD IK          V +Q+ + AN       F +   
Sbjct: 206 NPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANT------FQKATK 259

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
            IY   G   F++GL   V   +P  AI +++YE  +  L
Sbjct: 260 AIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 66/176 (37%), Gaps = 30/176 (17%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           P    ++G  A +      +P DT+K RMQ+    N  T           IY  EG  AF
Sbjct: 118 PLKTALSGTVATIAADALMNPFDTLKQRMQL----NTNTT---VWNVTKQIYKNEGFSAF 170

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTF------LAGVGAGVTEA 170
           Y      +   IP  A  F  YE          T   +  N +      L+G  +G T A
Sbjct: 171 YYSYPTTLAMNIPFAAFNFMIYE--------SATKFFNPTNDYNPLVHCLSGGLSGATCA 222

Query: 171 VLVVNPMEVVKIRLQAQ-----HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
             +  P++ +K  LQ +      L    E   ++ A +A Y +    G    +RG+
Sbjct: 223 A-ITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQV---HGAKGFWRGL 274

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 94.4 bits (233), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/328 (26%), Positives = 143/328 (43%), Gaps = 40/328 (12%)

Query: 39  VCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP 98
           V +QP   N +      +  +  +AGG AG        P + +K+ +Q+  +++  +   
Sbjct: 7   VLEQP---NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQV--QSSTTSYNR 61

Query: 99  GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----ADRQTGVV 153
           G   +   +Y  EG    ++G G   I I P  A++F  YE  +  L      + Q  + 
Sbjct: 62  GIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLT 121

Query: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVK--- 210
           +T   F   +  G +  V+   P++++K RL  Q  + ++  +    +I     I +   
Sbjct: 122 NTQRLFSGALCGGCS--VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179

Query: 211 -----EEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY--HGSQNLPSWETSL- 262
                E G+  LYRGV  T+         NF VY    E+L+E+  + S   PSW+++L 
Sbjct: 180 ETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVY----EQLREFGVNSSDAQPSWKSNLY 235

Query: 263 ---IGLVSGAIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGF 313
              IG +SG +      P D ++ R Q       +   R  S W  + TIGR     EG 
Sbjct: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR----AEGV 291

Query: 314 RALYKGITPRVMRVAPGQAVTFTVYEFV 341
              YKG+   + +V P  AV++ VYE V
Sbjct: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVV 319

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 86/197 (43%), Gaps = 18/197 (9%)

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           FLAG  AG      VV+P E VKI LQ Q    ++     R    +   +  EEG   L+
Sbjct: 26  FLAGGVAGAVSRT-VVSPFERVKILLQVQ----SSTTSYNRGIFSSIRQVYHEEGTKGLF 80

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSN 275
           RG  L   R        F VY    ++L   +G+   + L + +    G + G     + 
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGR-----QLVQEE-----GFRALYKGITPRVM 325
            PLD IKTRL    +  +  N  +  +I +     QL+ E      G R LY+G+ P  +
Sbjct: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 326 RVAPGQAVTFTVYEFVR 342
            V P  A+ F VYE +R
Sbjct: 201 GVVPYVALNFAVYEQLR 217

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 89/203 (43%), Gaps = 16/203 (7%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIY---------RRANEGTKPPGFLRTGANIYSGE 111
           L +G   G    +  +PLD IK R+ I           +A   +KPPG  +  +  Y  E
Sbjct: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLE 185

Query: 112 G-LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVS-TGNTFLAGVGA---G 166
           G L   Y+G+    +G++P +A+ F+ YE  R    +      S   N +   +GA   G
Sbjct: 186 GGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGG 245

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
           V + +    P ++++ R Q   + G     +Y +   A   I + EG+   Y+G++    
Sbjct: 246 VAQTI--TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303

Query: 227 RQATNQGANFTVYSKLMERLQEY 249
           +   +   ++ VY  + + ++ +
Sbjct: 304 KVVPSTAVSWLVYEVVCDSVRNW 326

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
           L G V+GA+     +P + +K  LQ   ST + +  +  ++I RQ+  EEG + L++G  
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGI-FSSI-RQVYHEEGTKGLFRGNG 84

Query: 322 PRVMRVAPGQAVTFTVYEFVRRHL 345
              +R+ P  AV F VYE  ++ L
Sbjct: 85  LNCIRIFPYSAVQFVVYEACKKKL 108

>Kwal_23.3042
          Length = 542

 Score = 95.5 bits (236), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 145/317 (45%), Gaps = 35/317 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT----------KPPG---------FL 101
            +AGG +G+    C  P D IKV + I R     T          K P           +
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFL-IARTDLSSTFLKSKDIILEKNPNADLSKIKSPLV 286

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD----RQTGVVSTGN 157
           +    +Y   G+ AFY G G   + + P+ AI+F S+E  + L+A     + T  +S  +
Sbjct: 287 KAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFS 346

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
           T+LAG G G   A L V P++ +K R+Q   L+   E +  +  I  A  + KE G+   
Sbjct: 347 TYLAG-GLGGVMAQLSVYPIDTLKYRVQCAPLN--TESKGRQLLISTAKDMYKEGGLRIF 403

Query: 218 YRGVSLTAARQATNQGANFTVYSKLME-------RLQEYHGSQ-NLPSWETSLIGLVSGA 269
           YRG+++           +   +S L +       RL      Q  + +    L+G  SG 
Sbjct: 404 YRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
           +G  +  P++ ++TRLQ   +  +   +     +  + VQ EG++ L+KG+ P + +V P
Sbjct: 464 VGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 330 GQAVTFTVYEFVRRHLE 346
             ++++  YE ++R ++
Sbjct: 524 AVSISYLCYENLKRGMK 540

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 129/291 (44%), Gaps = 40/291 (13%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +LV+G  AG    +   P+DT+K R+Q            GF   G       G    Y+G
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ---------AKGGFFHNG-------GYRGIYRG 51

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLL---ADRQTGVVSTGN--TFLAGVGAGVTEAVLVV 174
           LG+ V+   P  ++ F +Y+  +  L     R T         T +     G   A LV 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE---EGI-GALYRGVSLTAARQAT 230
            P EV+K R Q  H +         +++Q   LI+++   EG+   LYRG   T  R+  
Sbjct: 112 VPAEVIKQRTQTHHTN---------SSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIP 162

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
                F +Y  L ++   Y   + + +W+ ++ G ++G I   +  PLD +KTR+   + 
Sbjct: 163 FTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHER 222

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
                  V +  + R L +EEG R  ++GI PR M ++ G A+   VYE V
Sbjct: 223 R------VPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 79/200 (39%), Gaps = 39/200 (19%)

Query: 157 NTFLAGVGAGV---TEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG 213
           +TFLA + +G    T   +V  P++ +K RLQA+   G      YR              
Sbjct: 3   STFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG--GFFHNGGYRG------------- 47

Query: 214 IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS------LIGLVS 267
              +YRG+       A      F  Y  + ++L+   G      W  S      L  ++S
Sbjct: 48  ---IYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGR-----WTASEQLAEVLTHMLS 99

Query: 268 GAIGPFS----NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
            ++G  S      P + IK R Q   +  +L     +  I R    E   R LY+G    
Sbjct: 100 SSLGEMSACLVRVPAEVIKQRTQTHHTNSSLQT---LRLILRDPTGEGVVRGLYRGWWTT 156

Query: 324 VMRVAPGQAVTFTVYEFVRR 343
           +MR  P   + F +YE++++
Sbjct: 157 IMREIPFTCIQFPLYEYLKK 176

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 20/90 (22%)

Query: 260 TSLIGLVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRA 315
           T L  LVSGA    S      P+DT+KTRLQ                         G+R 
Sbjct: 4   TFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG----------------FFHNGGYRG 47

Query: 316 LYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           +Y+G+   V+  APG ++ F  Y+ +++ L
Sbjct: 48  IYRGLGSAVVASAPGASLFFVTYDSMKQQL 77

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 6/69 (8%)

Query: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136
           PLD +K RM ++ R     + P  L     ++  EG   F++G+G   + I    AI   
Sbjct: 209 PLDVLKTRMMLHER-----RVP-MLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLG 262

Query: 137 SYEFYRTLL 145
            YE   +L 
Sbjct: 263 VYEAVHSLF 271

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 130/287 (45%), Gaps = 25/287 (8%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANI----YSGEGL 113
           A +++ G  AG    +  +P DT+KVR+Q        T+P     T  +     Y  EGL
Sbjct: 7   AKDILYGSIAGAVGKVIEYPFDTVKVRLQ--------TQPAHMFPTTWSCIKFTYDNEGL 58

Query: 114 L-AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL 172
              FY+G+G+ + G   + A+ F S+   + LL D ++ +     T  AG  AG   A  
Sbjct: 59  WRGFYQGIGSPLAGAALENAVLFVSFNQAKRLL-DVESLLSPLSKTVWAGAFAGAC-ASF 116

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232
           V+ P+E++K +LQ  +L  +  +  +   +     ++ E G   L++G S T  R++   
Sbjct: 117 VLTPVELIKCKLQVSNL--STTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGG 174

Query: 233 GANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTR 292
            A FT Y  +   L     ++   +WE    G  +G     S  P DTIK+ +Q D    
Sbjct: 175 AAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDH--- 231

Query: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                + +++  R++   +G    Y+G+   ++R  P  A  F  YE
Sbjct: 232 -----IDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 74/181 (40%), Gaps = 12/181 (6%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           AG  AG   +    P++ IK ++Q+   +   T     L T  ++ S  G L  ++G   
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSG 165

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLA-GVGAGVTEAVLVVNPMEVVK 181
             I      A  F++YE  +  LA R+    +T    LA G  AG+     +  P + +K
Sbjct: 166 TFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIF-PADTIK 224

Query: 182 IRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSK 241
             +Q  H+  ++  +K          I   +GI   YRG+ +T  R      A F  Y  
Sbjct: 225 STMQTDHIDLSSATRK----------IYARQGIAGFYRGLGITLIRAVPANAAIFYTYET 274

Query: 242 L 242
           L
Sbjct: 275 L 275

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG-ALYRGVSLTAARQATNQGA 234
           P + VK+RLQ Q  H       +             EG+    Y+G+    A  A     
Sbjct: 26  PFDTVKVRLQTQPAH------MFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAV 79

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
            F  +++  +RL +   S   P  +T   G  +GA   F   P++ IK +LQ    +   
Sbjct: 80  LFVSFNQ-AKRLLDVE-SLLSPLSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTK 137

Query: 295 SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           ++  +I    + ++ E GF  L++G +   +R + G A  FT YE V+ +L
Sbjct: 138 TSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYL 188

>Kwal_55.21335
          Length = 317

 Score = 92.8 bits (229), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 129/285 (45%), Gaps = 25/285 (8%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANI----YSGEGLL- 114
           +++ G  AG    +  +PLDTIKVR+Q        T+P     T  +     Y  EG + 
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQ--------TQPAHVFPTSWSCIKYTYQKEGFVK 99

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVV 174
            FY+G+ + ++G   + A+ F ++   +  L   ++ V     T L+G  AG   +  V+
Sbjct: 100 GFYQGVASPLVGAALENAVLFVTFNRAQNFLQQYES-VSPLSQTVLSGAFAGACTS-YVL 157

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
            P+E++K  LQ  +L GA    ++         IV+ +GIG L++G S T  R+      
Sbjct: 158 TPVELIKCTLQVSNLEGATT--RHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
            FT Y  L   L          +WE    G  +G     S  P DTIK+  Q    T++L
Sbjct: 216 WFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQ----TQHL 271

Query: 295 SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                I    ++++   G   LY+G+   ++R AP  A+ F  YE
Sbjct: 272 G----IVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 96/223 (43%), Gaps = 20/223 (8%)

Query: 127 IIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQA 186
           I+ ++  R   Y  +R  + D +  +       +AG    V E      P++ +K+RLQ 
Sbjct: 21  IVSQLIARSHRYGPFRVGIMDFKDALKDILYGSIAGAAGKVIE-----YPLDTIKVRLQT 75

Query: 187 QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL 246
           Q  H         + I+  Y   KE  +   Y+GV+      A      F  +++    L
Sbjct: 76  QPAHVFPTSW---SCIKYTYQ--KEGFVKGFYQGVASPLVGAALENAVLFVTFNRAQNFL 130

Query: 247 QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ----KDKSTRNLSNWVRITT 302
           Q+Y     L   +T L G  +GA   +   P++ IK  LQ    +  +TR+   W  +  
Sbjct: 131 QQYESVSPLS--QTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTV-- 186

Query: 303 IGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
             + +VQ +G   L++G +   +R   G AV FT YE ++ +L
Sbjct: 187 --KHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYL 227

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 81/199 (40%), Gaps = 13/199 (6%)

Query: 46  DNHMSSKKSTNP-AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104
            N +   +S +P +  +++G  AG   +    P++ IK  +Q+       T+      T 
Sbjct: 127 QNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTV 186

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLA-GV 163
            +I   +G+   ++G  +  I      A+ F++YE  ++ LA R+    +     LA G 
Sbjct: 187 KHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGA 246

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
            AGV     +  P + +K   Q QHL            + A   I+   G   LYRG+ +
Sbjct: 247 SAGVAFNASIF-PADTIKSTAQTQHL----------GIVDATKRILARSGPAGLYRGLGI 295

Query: 224 TAARQATNQGANFTVYSKL 242
           T  R A      F  Y  L
Sbjct: 296 TLIRAAPANAIVFYTYETL 314

>Kwal_14.2210
          Length = 315

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 136/320 (42%), Gaps = 27/320 (8%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           D+       ++  +   AGG AG        P + +K+ +Q+  +++      G  R   
Sbjct: 6   DHSWRCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQV--QSSTHAYNHGLFRAVK 63

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRT-LLADRQTGVVSTGNTFLAGVG 164
            +Y  EG+    +G G   I I P  A++F  YEF +          VV   +  ++G  
Sbjct: 64  QVYLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGAL 123

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQ-----HLHGAAEQQKYR-----NAIQAAYLIVKEEGI 214
            G   +VL   P+++V+ RL  Q      LH A      +       ++  Y   +E GI
Sbjct: 124 CGGC-SVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTY--TQEGGI 180

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFS 274
             LYRGV  T+         NF VY +L E +       +   ++ S IG +SG +    
Sbjct: 181 FGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLS-IGAISGGVAQTI 239

Query: 275 NAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVA 328
             P D ++ R Q       +      S    + TIGR     EGF+  YKG+T  + +V 
Sbjct: 240 TYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGR----TEGFKGYYKGLTANLFKVV 295

Query: 329 PGQAVTFTVYEFVRRHLEGL 348
           P  AV++ VYE VR +++ L
Sbjct: 296 PSTAVSWVVYETVRDYMQLL 315

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 91.7 bits (226), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 132/288 (45%), Gaps = 22/288 (7%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFY 117
           ++++ G  AG    +   P DT+KVR+Q           P         Y  EG+   F+
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQ----TQASNVFPTTWSCIKFTYQNEGIARGFF 70

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPM 177
           +G+ + ++G   + A  F SY      L ++ T V   G   ++G  AG + A LV+ P+
Sbjct: 71  QGIASPLVGACLENATLFVSYNQCSKFL-EKHTNVFPLGQILISGGVAG-SCASLVLTPV 128

Query: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT 237
           E+VK +LQ  +L  A+ + K+   +     I+ E G+  L++G S T  R++    A F 
Sbjct: 129 ELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFA 188

Query: 238 VYSKLMERLQEYHGSQNLPS------WETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKST 291
            Y  + + L++ H S + P       WE  + G  +G     S  P DT+K+ +Q +   
Sbjct: 189 TYEIVKKSLKDRH-SLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEH-- 245

Query: 292 RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                 + +T   +++  + G +  Y+G+   + R  P  A  F ++E
Sbjct: 246 ------ISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 74/181 (40%), Gaps = 25/181 (13%)

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG-ALYRGVSLTAARQATNQGA 234
           P + VK+RLQ Q          +           + EGI    ++G++            
Sbjct: 33  PFDTVKVRLQTQ------ASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENAT 86

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ-------- 286
            F  Y++  + L+++  +   P  +  + G V+G+       P++ +K +LQ        
Sbjct: 87  LFVSYNQCSKFLEKH--TNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVAS 144

Query: 287 -KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            K K T+ L       TI + ++ E G   L++G +   +R + G    F  YE V++ L
Sbjct: 145 AKTKHTKVLP------TI-KAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSL 197

Query: 346 E 346
           +
Sbjct: 198 K 198

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 134/299 (44%), Gaps = 39/299 (13%)

Query: 64  GGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAV 123
           GG AG+F  +  HPLD  KVR+Q    A    KP  F R   +I + EG++  Y GL A 
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQ----AAPMPKPTLF-RMLESILANEGVVGLYSGLSAA 74

Query: 124 VIGIIPKMAIRFSSYEFYRTLLADRQ----TGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           V+       +RF +Y+  +  +  R+       +   + F   +G       L  N  +V
Sbjct: 75  VLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGG------LAGNFADV 128

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE-GIGALY--------RGVSLTAARQAT 230
           V IR+Q      AA+++ Y+NAI   Y I + E G+  L+        RG+ +TA++  T
Sbjct: 129 VNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVT 188

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDK 289
                + V+   +    ++  S+N      SL+ GLV+  +     +P D +KTR+    
Sbjct: 189 -----YDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVC----SPADVMKTRIMNGS 239

Query: 290 STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
                +       I    V++EG   +++G  P   R+ P   + F   E +++H  G+
Sbjct: 240 GDHQPA-----LKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGM 293

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 124/299 (41%), Gaps = 16/299 (5%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP--PGFLRTGANIYSGEGLLAF 116
           +  ++G  AG    +   PLD  K R+Q          P   G + T + I   EG    
Sbjct: 79  ITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGL 138

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTE---AVLV 173
           YKGL  +V+G  P   I FS YEF +        G+    + F+A   A +T    +  +
Sbjct: 139 YKGLVPIVLGYFPTWMIYFSVYEFSKKFFH----GIFPQFD-FVAQSCAAITAGAASTTL 193

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
            NP+ VVK RL  Q   G      Y+    A   +  +EG  ALY G+ + +     +  
Sbjct: 194 TNPIWVVKTRLMLQSNLGE-HPTHYKGTFDAFRKLFYQEGFKALYAGL-VPSLLGLFHVA 251

Query: 234 ANFTVYSKLMERLQEYHGSQNLPSWETSLIGL---VSGAIGPFSNAPLDTIKTRLQKDKS 290
            +F +Y  L  R   Y    N  S     + +   VS  I      P + ++TR+Q  KS
Sbjct: 252 IHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQL-KS 310

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLG 349
               S   R+  + +    +EG +  Y G T  ++R  P  A+T   +E+ R  LE + 
Sbjct: 311 DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENIS 369

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 99/217 (45%), Gaps = 11/217 (5%)

Query: 127 IIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQA 186
           II  + +  S+     T L  +   + ST  T L+G  AG    V V  P++V K RLQA
Sbjct: 49  IIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVC-PLDVAKTRLQA 107

Query: 187 QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL 246
           Q L    E   YR  +     IV++EG   LY+G+              F+VY +  ++ 
Sbjct: 108 QGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVY-EFSKKF 166

Query: 247 QEYHGSQNLPSWE---TSLIGLVSGAIGPFSNAPLDTIKTRLQKDKST-RNLSNWVRITT 302
             +HG    P ++    S   + +GA       P+  +KTRL    +   + +++     
Sbjct: 167 --FHGI--FPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFD 222

Query: 303 IGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
             R+L  +EGF+ALY G+ P ++ +    A+ F +YE
Sbjct: 223 AFRKLFYQEGFKALYAGLVPSLLGLF-HVAIHFPIYE 258

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 48  HMSSKKSTNPAVNL----VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRT 103
           H  S+++   ++NL    +A   + +  +   +P + ++ RMQ+     +  +   F   
Sbjct: 265 HCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLI 324

Query: 104 GANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVV 153
            A  Y+ EGL  FY G    ++  IP  AI   S+E++R  L +  T V+
Sbjct: 325 KAT-YAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI 373

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 129/293 (44%), Gaps = 40/293 (13%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +LV+G  AG    L   P+DT+K R+Q            GF   G       G    Y+G
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQ---------AKGGFFANG-------GYKGVYRG 52

Query: 120 LGAVVIGIIPKMAIRFSSYE----FYRTLLADR-QTGVVSTGNTFLAGVGAGVTE--AVL 172
           LG+ V+   P  ++ F +Y+    + R ++      G   T +T    V +   E  A +
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACM 112

Query: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA---LYRGVSLTAARQA 229
           V  P EV+K R Q    + + +       +QA  L+  E G G    LYRG S T  R+ 
Sbjct: 113 VRVPAEVIKQRTQTHRTNSSLQ------TLQA--LLRNENGEGLRRNLYRGWSTTIMREI 164

Query: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289
                 F +Y  + +R  E  G +    W+ S+ G ++G I   +  PLD +KTR+    
Sbjct: 165 PFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHH 224

Query: 290 STRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 342
            +      V    + + ++QEEG +  + G+ PR M ++ G A+   VYE V 
Sbjct: 225 KS------VSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 78/197 (39%), Gaps = 37/197 (18%)

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
           + ++G  AG T   L   P++ +K RLQA+   G                     G   +
Sbjct: 9   SLVSGAAAG-TSTDLAFFPIDTLKTRLQAK---GG---------------FFANGGYKGV 49

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWET----SLIGLVSGAIGPF 273
           YRG+       A +    F  Y  +    +   G Q LP  E     +L  +VS + G  
Sbjct: 50  YRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIG-QLLPKGEDQTADTLSHMVSSSFGEI 108

Query: 274 S----NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG---FRALYKGITPRVMR 326
           S      P + IK R Q  ++  +L       T+   L  E G    R LY+G +  +MR
Sbjct: 109 SACMVRVPAEVIKQRTQTHRTNSSLQ------TLQALLRNENGEGLRRNLYRGWSTTIMR 162

Query: 327 VAPGQAVTFTVYEFVRR 343
             P   + F +YE++++
Sbjct: 163 EIPFTCIQFPLYEYMKK 179

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 159/357 (44%), Gaps = 53/357 (14%)

Query: 33  ADPCSAVCQQPYP------DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ 86
           +D  S+  +  +P      D+   + K   P V+ VAGG  G+  A+   P D +K R+Q
Sbjct: 22  SDEKSSNLKDAFPPPVQRADSSQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQ 81

Query: 87  --IYRRANE------GTKPPGFLRTG-----------ANIYSGEGLLAFYKGLGAVVIGI 127
             +++ A +      G      +  G           +N+Y  EG  + +KGLG  ++G+
Sbjct: 82  SDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGV 141

Query: 128 IPKMAIRFSSY----EFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIR 183
           IP  +I F +Y    E Y   L + Q  V       +A   AG   +    NP+ +VK R
Sbjct: 142 IPARSINFFTYGTTKEIYSKTLNNGQEAVWIH---LMAAATAGWATST-ATNPIWLVKTR 197

Query: 184 LQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA-NFTVYSKL 242
           LQ   L  A   +KY+N+      +V++EGI  LY+G  L+A+   + +G   + +Y ++
Sbjct: 198 LQ---LDKAGTTKKYKNSWDCLKNVVQKEGILGLYKG--LSASYLGSVEGILQWVLYEQM 252

Query: 243 --------MERL-----QEYHGSQNLPSW-ETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
                   ME+       E   S  +  W + S    ++  +      P + ++TRL++ 
Sbjct: 253 KHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQA 312

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
                   +  +    R +++EEG  ++Y G+TP ++R  P   + F  +E V R L
Sbjct: 313 PLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIRLL 369

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 39/84 (46%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           + G A    ++  +P + ++ R++     N   K  G +++   I   EGL + Y GL  
Sbjct: 287 SAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTP 346

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLA 146
            ++  +P   I F ++E    LL+
Sbjct: 347 HLLRTVPNSIIMFGTWELVIRLLS 370

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 91.7 bits (226), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 140/317 (44%), Gaps = 35/317 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT----------KPPG---------FL 101
            +AGG +G+    C  P D IKV + I R     T          K P           +
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFL-IARTDLSSTLLNSKDKVLMKNPNADISKIKSPLI 257

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD----RQTGVVSTGN 157
           +    +Y   G+ AFY G G  VI + P+ A++F S+E  + L+A       T  +S  +
Sbjct: 258 KAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFS 317

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
           T++AG G G   A   V P++ +K R+Q   L  A +  +    I  A  + ++ G+   
Sbjct: 318 TYIAG-GMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL--LISTARQMYRDGGLKLF 374

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN-LPSWETSL-------IGLVSGA 269
           YRGV++           +   +S L +           +P  + ++       +G  SG 
Sbjct: 375 YRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGT 434

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
           +G     P++ ++TRLQ   +  +   +     +  + VQ EG++ L+KG+ P + +V P
Sbjct: 435 VGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCP 494

Query: 330 GQAVTFTVYEFVRRHLE 346
             ++++  YE  +R ++
Sbjct: 495 AVSISYLCYENFKRLMK 511

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 89.0 bits (219), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 129/291 (44%), Gaps = 25/291 (8%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP----PGFLRTGANIYSGEGLL- 114
           ++  G  AG    +  +P DT+KVR+Q        T+P    P       + Y+ EG+  
Sbjct: 10  DIAYGSVAGAIGKVIEYPFDTVKVRLQ--------TQPAHLYPTTWSCIRSTYTDEGIWK 61

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVV 174
            FY+G+ + + G   + A+ F S+      L D  T +     T  +G  AG   A  ++
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFL-DEFTQLKPLTKTIYSGAFAGAC-ASFIL 119

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQG 233
            P+E+VK +LQ  ++  +  Q     ++      ++KE+G+  L++G   T  R+     
Sbjct: 120 TPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGA 179

Query: 234 ANFTVYSKLMERLQEYH-GSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTR 292
             FT Y  +  +    H   +   +WE  + G  +G +   S  P DT+K+  Q +    
Sbjct: 180 VWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEH--- 236

Query: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
                V I    +++++  G    Y+G+   ++R AP  A  F  YE +++
Sbjct: 237 -----VSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKK 282

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 16/179 (8%)

Query: 176 PMEVVKIRLQAQ--HLHGAAEQQKYRNAIQAAYLIVKEEGIG-ALYRGVSLTAARQATNQ 232
           P + VK+RLQ Q  HL+         + I++ Y    +EGI    Y+G++      A   
Sbjct: 27  PFDTVKVRLQTQPAHLYPTT-----WSCIRSTY---TDEGIWKGFYQGIASPLFGAALEN 78

Query: 233 GANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTR 292
              F  +++    L E+  +Q  P  +T   G  +GA   F   P++ +K +LQ    + 
Sbjct: 79  AVLFVSFNQCTNFLDEF--TQLKPLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISN 136

Query: 293 NLSNWVRITTIG---RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           +LS   R T++    + +++E+G   L++G     +R   G AV FT YE ++     L
Sbjct: 137 SLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASL 195

>Kwal_26.7653
          Length = 325

 Score = 89.0 bits (219), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           VS   +F+AG G     AV V NP+E+VK R+Q Q    A  Q+ Y+N +QA  +I K E
Sbjct: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE 80

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY-------HGSQNLPSWETSLIGL 265
           GI  L +G+S     Q    G+    Y  +   L +        H  QN+     S  G 
Sbjct: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS--GA 138

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL---VQEEGFRALYKGITP 322
            SG IG    +PL  IKTR+Q   +   +      T+I   L    + EGF+ LY+G+  
Sbjct: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198

Query: 323 RVMRVAPGQAVTFTVY----EFVRRH---LEGLGL 350
            ++R   G +V   +Y     F+ +H    EG GL
Sbjct: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL 233

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 21/224 (9%)

Query: 29  RRSVADPCSAVCQQP-YPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI 87
           R    +P  +V  +  YP   M   K  N AVN+V+G T+G+  A+   PL  IK RMQ 
Sbjct: 103 RLGFYEPIRSVLNKTFYPA--MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQS 160

Query: 88  YRRA---NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTL 144
           Y  A    + T         ++IY  EG    Y+G+ A ++      +++   Y   +  
Sbjct: 161 YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHF 220

Query: 145 LADRQTGVVSTGNTFLA----GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRN 200
           L         TG   +A    G G GV     V+NP +V+  R+  Q      +   Y+ 
Sbjct: 221 LLKHDLMKEGTGLHLVASTVSGFGVGV-----VMNPWDVILTRVYNQ------KGNLYKG 269

Query: 201 AIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244
            +      V+ EGIGALY+G      R A +     T   + M+
Sbjct: 270 PLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 118/299 (39%), Gaps = 35/299 (11%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTK-----PPGFLRTGANIYSGEGLL 114
           + +AGG A        +P++ +K RMQ+    +   +     P   L+    I+  EG+ 
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKV---IFKNEGIR 83

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL------ADRQTGVVSTGNTFLAGVGAGVT 168
              KGL    I  I     R   YE  R++L      A     V +     ++G  +G+ 
Sbjct: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGII 143

Query: 169 EAVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
            A++  +P+ ++K R+Q+  +     +Q  Y +       I + EG   LYRGV     R
Sbjct: 144 GAIMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202

Query: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA----PLDTIKT 283
                     +Y+     L ++   +     E + + LV+  +  F       P D I T
Sbjct: 203 TGAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVGVVMNPWDVILT 257

Query: 284 RLQKDKSTRN---LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           R+   K       L  +V+   I       EG  ALYKG   ++ R+AP   +  T  E
Sbjct: 258 RVYNQKGNLYKGPLDCFVKTVRI-------EGIGALYKGFEAQIFRIAPHTILCLTFME 309

>Scas_716.29
          Length = 316

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 133/321 (41%), Gaps = 42/321 (13%)

Query: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106
           +H+   +    + +LVAG  +GL       PLDT+K+R+Q+ R +  G  P G L+    
Sbjct: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLKMMKG 70

Query: 107 IYSGE-GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGA 165
           +   E GL +F+KG     +  +     +FSSY FY  L  +  + +     + + G  A
Sbjct: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE-TSDMNGQLQSLVVGALA 129

Query: 166 GVTEAVLVVNPMEVVKIRLQAQH-------LHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           G+T +  V  P +V++ R  A          HG  E             I   EGI   +
Sbjct: 130 GMTSS-FVSYPTDVLRTRFIANQDVALSSLSHGCKE-------------IWNMEGIPGFF 175

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278
           RG + +      +    F  Y  +     EY    +  ++       +SG        PL
Sbjct: 176 RGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPL 235

Query: 279 DTIKTRLQKDKST---RNLSNWVRITT-------------IGRQLVQEEGFRALYKGITP 322
           DTI+ R+Q   S     N+ N  +I T             +G  ++++EG  +LY+G++ 
Sbjct: 236 DTIRRRIQVRNSVYVQHNVEN--KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293

Query: 323 RVMRVAPGQAVTFTVYEFVRR 343
            + +  P   V+   YE V R
Sbjct: 294 SLCKTVPSTVVSLWAYETVMR 314

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 15/110 (13%)

Query: 44  YPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI----YRRAN------- 92
           Y D +      TN  +   A   +G+   +  +PLDTI+ R+Q+    Y + N       
Sbjct: 202 YCDEYSKESDYTN-YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVT 260

Query: 93  ---EGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE 139
              +  K   F+R G NI   EGLL+ Y+G+   +   +P   +   +YE
Sbjct: 261 EIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 131/294 (44%), Gaps = 25/294 (8%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLA--FYK 118
           +++G TAG    L  HPLD  KVR+Q+   +   T   G+    + I   +  L    Y+
Sbjct: 12  VISGLTAGSVTTLIVHPLDLFKVRLQLLITS---TTKKGYRNLWSEIVGSDLSLTRELYR 68

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLAD-----RQTGVVSTGNTFLAGVGAGVTEAVLV 173
           GL   ++G      + F+SY   +  L +     R    +S+     A   +G+   VL 
Sbjct: 69  GLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLT 128

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
            NP+ V+K R+ ++        +  R+       ++K +G+  L++G  L  A    +QG
Sbjct: 129 -NPLWVIKTRMMSKANSDLTSMKVLRD-------LIKNDGVQGLWKG--LVPALVGVSQG 178

Query: 234 A-NFTVYSKLMERL-QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKST 291
           A +FT Y  L  +L  +   S  + + ET  +  VS  +   +  P   +K+ LQ  +++
Sbjct: 179 ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQAS 238

Query: 292 RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            N     ++  + + +    G    YKG++  ++R  P   +TF +YE  +  L
Sbjct: 239 END---FKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 129/308 (41%), Gaps = 43/308 (13%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY-SGEG----LLA 115
           +++G TAG    +  HPLD IK+R+Q+   A    KP  +      I   G G    L  
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQL---AAIDLKPSSYYNQVQRIIKDGSGTQQLLKE 72

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYE--------------FYRTLLADRQTGVVSTGNTFLA 161
            Y+GLG  +IG      + F  Y                    + DR+     T + +L 
Sbjct: 73  AYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKM----TSSMYLV 128

Query: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
             GA      L+ NPM V+K R+ +         Q Y + + A   I  EEG+   +RG 
Sbjct: 129 SAGASGLATALLTNPMWVIKTRIMS-----TKSSQGYTSILNAITRIYTEEGLKTFWRG- 182

Query: 222 SLTAARQATNQGA-NFTVYSKLMERLQEYHGSQN-----LPSWETSLIGLVSGAIGPFSN 275
            L  +     QGA  F +Y  L  +L+  H   +     L + ET  I  +S  I   S 
Sbjct: 183 -LVPSLFGVTQGALYFAIYDTL--KLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSV 239

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
            PL  +KT LQ  ++  N ++  ++ ++ R +    G    YKG+   ++R  P   +TF
Sbjct: 240 YPLQLLKTNLQTFRTEHNENS--KMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITF 297

Query: 336 TVYEFVRR 343
            VYE  + 
Sbjct: 298 GVYEHFKH 305

>Scas_697.47
          Length = 328

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 132/292 (45%), Gaps = 23/292 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL----A 115
           +LVAGG  G+   L  HP D IKVR Q  + ++        L+    I +   L+     
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKG 98

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLL--ADRQTGVVSTGNTFLAGVGAGVTEAVLV 173
           FYKG+   ++G+ P  A+ F  Y+  + ++  +D  +  ++ G    AG  + +    LV
Sbjct: 99  FYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAI-PTTLV 157

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
             P E +K+ LQ     GA  +  +   I AA  IVK+ G+ +L++G   T AR      
Sbjct: 158 TAPTERIKVVLQTA---GANSKTSF---IGAAKNIVKDGGVKSLFKGSLATLARDGPGSA 211

Query: 234 ANFTVYSKLMERLQEYHGSQNLPSWETSLIGL-VSGAIGPFSN----APLDTIKTRLQKD 288
             F  Y    + L + + +    + E ++  + ++G I   S      P+DTIKT+LQ  
Sbjct: 212 LYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSS 271

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
             ++++    R        V+  G +  + G+ P ++R  P  A TF   E 
Sbjct: 272 SGSQSMVAATR-----EIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 19/192 (9%)

Query: 164 GAGVTEAVLVVNPMEVVKIRLQA----QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           G G   AVL  +P +++K+R Q+      +H      K   AI  + ++V    +   Y+
Sbjct: 44  GVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNS--VKGFYK 101

Query: 220 GV-----SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFS 274
           GV      +T     +  G  + V  K++ R      S  L   + +  G +S       
Sbjct: 102 GVIPPLLGVTPIFAVSFWG--YDVGKKIVTRSDS--SSAQLTMGQMAAAGFISAIPTTLV 157

Query: 275 NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334
            AP + IK  LQ    T   ++        + +V++ G ++L+KG    + R  PG A+ 
Sbjct: 158 TAPTERIKVVLQ----TAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALY 213

Query: 335 FTVYEFVRRHLE 346
           F  YE  ++ L 
Sbjct: 214 FASYEISKKFLN 225

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query: 41  QQPYPDNHMSSKKSTNPAVNL----VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTK 96
            + + ++  ++ +S    VN+    +AGG AG+   L   P+DTIK ++Q    ++ G++
Sbjct: 220 SKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ----SSSGSQ 275

Query: 97  PPGFLRTGANIYSGE-GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
               +     IY    G+  F+ GLG  ++   P  A  F   E   +L 
Sbjct: 276 --SMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSLF 323

>Scas_721.27
          Length = 374

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 163/369 (44%), Gaps = 61/369 (16%)

Query: 24  YIGARRRS----VADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLD 79
           Y+G+  R+     A       ++  P++H + K    P V+ VAGG  G+  A+   P D
Sbjct: 19  YLGSDERASNLRAAQNLEDSTKKIKPESHPNVK----PWVHFVAGGIGGMAGAVVTCPFD 74

Query: 80  TIKVRMQ--IYRR-----------ANEGTKPPGFLRTGA----------NIYSGEGLLAF 116
            +K R+Q  IY+            A+        ++ G           N+Y  EG  + 
Sbjct: 75  LVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGFRSL 134

Query: 117 YKGLGAVVIGIIPKMAIRFSSY----EFYRTLLAD-RQTGVVSTGNTFLAGVGAGVTEAV 171
           +KGLG  ++G+IP  +I F +Y    E Y     + ++T ++   +   AG         
Sbjct: 135 FKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWATST---- 190

Query: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATN 231
              NP+ ++K R+Q   L  A   +KY+N+      ++K EGI  LYRG  L+A+   + 
Sbjct: 191 -ATNPIWMIKTRVQ---LDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRG--LSASYLGSI 244

Query: 232 QGA-NFTVYSKLMERLQE-------YHG------SQNLPSW-ETSLIGLVSGAIGPFSNA 276
           +G   + +Y ++   +++       + G      ++ +  W + S    V+  I      
Sbjct: 245 EGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTY 304

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P + ++TRL++         +  +    R +++EEG  ++Y G+TP +MR  P   + F 
Sbjct: 305 PHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFG 364

Query: 337 VYEFVRRHL 345
            +E V R L
Sbjct: 365 TWELVIRLL 373

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 39/84 (46%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           + G A    ++  +P + ++ R++     N   K  G +++   I   EGL + Y GL  
Sbjct: 291 SAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTP 350

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLA 146
            ++  +P   I F ++E    LL+
Sbjct: 351 HLMRTVPNSIIMFGTWELVIRLLS 374

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 126/306 (41%), Gaps = 28/306 (9%)

Query: 45  PDNHMSSKKST---NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL 101
           P  H+ + KS      A +L AG   G+   L  HP D +KVR Q  + +         L
Sbjct: 32  PSVHVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKIL 91

Query: 102 ---RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVSTGN 157
              R  + + +   +  FYKG+   ++G+ P  A+ F  Y+  + L+  +  +G ++T  
Sbjct: 92  VEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQ 151

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
              AG  + +    LV+ P E VK+ LQ Q  H      K+         I+   G+ +L
Sbjct: 152 LATAGFISAI-PTTLVMAPTERVKVVLQTQSNHSLGSAAKH---------ILATGGVRSL 201

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA---IGPFS 274
           +RG   T AR        F  Y      L    G+  L      L G ++G    +G F 
Sbjct: 202 FRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVF- 260

Query: 275 NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334
             P+DTIKT LQ   + + +    R     R      G +  + GI P ++R  P  A T
Sbjct: 261 --PIDTIKTELQSSNTRQTMMEATRKIYNTRG-----GIKGFFPGIGPALLRSFPANAAT 313

Query: 335 FTVYEF 340
           F   E 
Sbjct: 314 FLGVEL 319

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 79/200 (39%), Gaps = 9/200 (4%)

Query: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQ-QKYRNAIQAAY 206
           +   +     +  AG   GV  AVL  +P +++K+R Q+    G  +  +K     +A  
Sbjct: 40  KSNALYENAKSLAAGAVGGVC-AVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQS 98

Query: 207 LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLV 266
            +     +   Y+GV             +F  Y    + +     S  L + + +  G +
Sbjct: 99  GLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFI 158

Query: 267 SGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
           S        AP + +K  LQ  +S  +L       +  + ++   G R+L++G    + R
Sbjct: 159 SAIPTTLVMAPTERVKVVLQT-QSNHSLG------SAAKHILATGGVRSLFRGSLATLAR 211

Query: 327 VAPGQAVTFTVYEFVRRHLE 346
             PG A+ F  YE  + +L 
Sbjct: 212 DGPGSALYFASYEATKAYLN 231

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 89.0 bits (219), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 142/316 (44%), Gaps = 33/316 (10%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKV----RMQIYRRANEGTKP---------PGFLRTG--- 104
            +AGG +G+    C  P D +KV    R  +       T+          P  LR+    
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 105 --ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD----RQTGVVSTGNT 158
              ++Y   G+ +FY G G   + + P+ +I+F S+E  + L+      + T  +S  +T
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           F+AG  AGV  A   V P++ +K R+Q   L+  AE +  +  IQ A  +  E G+   Y
Sbjct: 324 FIAGGLAGVC-AQFSVYPIDTLKFRMQCAPLN--AELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 219 RGVSLTAARQATNQGANFTVYSKLME--------RLQEYHGSQNLPSWETSLIGLVSGAI 270
           RGV++           +   +S L +        +L +      L +     +G  SG  
Sbjct: 381 RGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTF 440

Query: 271 GPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
           G     P++ ++TRLQ   +  +   +     +  + +Q EG+  L+KG+ P + +V P 
Sbjct: 441 GATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPA 500

Query: 331 QAVTFTVYEFVRRHLE 346
            ++++  YE +++ ++
Sbjct: 501 VSISYLCYENLKKLMK 516

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 87/203 (42%), Gaps = 10/203 (4%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K  +     +AGG AG+      +P+DT+K RMQ      E       ++T   +Y+  G
Sbjct: 316 KDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGG 375

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-------DRQTGVVSTGNTFLAGVGA 165
           L  FY+G+   V+GI P  A+   ++   +           +++   V   N  +  +GA
Sbjct: 376 LKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGA 435

Query: 166 -GVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224
              T    VV P+ +++ RLQAQ     A   +Y          ++ EG   L++G+  T
Sbjct: 436 FSGTFGATVVYPINLLRTRLQAQGTF--AHPYRYDGFRDVLLKTIQREGYPGLFKGLVPT 493

Query: 225 AARQATNQGANFTVYSKLMERLQ 247
            A+       ++  Y  L + ++
Sbjct: 494 LAKVCPAVSISYLCYENLKKLMK 516

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 98/232 (42%), Gaps = 26/232 (11%)

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN 175
           F KG G  + G I  +  R  +  F R         V     T L+      TE VL  N
Sbjct: 197 FIKGFGFFIAGGISGVISRTCTAPFDRL-------KVFLIARTDLSSTLLNSTEDVLAKN 249

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAAR---QATN 231
           P                A+  K R+ +  A + + ++ GI + Y G  L A +   +++ 
Sbjct: 250 P---------------HAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSI 294

Query: 232 QGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKST 291
           +  +F +  KLM +++    +++L    T + G ++G    FS  P+DT+K R+Q     
Sbjct: 295 KFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLN 354

Query: 292 RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
             L     +    +++  E G +  Y+G+T  V+ + P  A+    +  +++
Sbjct: 355 AELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKK 406

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 87.4 bits (215), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 141/331 (42%), Gaps = 56/331 (16%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           M+  K  +    + AG  +GLF A   +P + +K  +Q++R      KP   L       
Sbjct: 1   MTQNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNV-VAAKPFEVL------- 52

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL---ADRQTGVVSTGNTFLAGVGA 165
            G  +  ++ G  AV IG++ K ++RF +++     L   A  +   +S     +AG   
Sbjct: 53  -GYQVRTYFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALT 111

Query: 166 GVTEAVLVVNPMEVVKIRLQAQHL---------------HGAAEQQKY------------ 198
           G  E++ ++ P E VK+ +    L                 A E +K             
Sbjct: 112 GTMESLCII-PFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYE 170

Query: 199 --------RNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL-QEY 249
                    N +  A  + ++ G+ A ++G   T  RQ  N    FT ++ L +   +EY
Sbjct: 171 ALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEY 230

Query: 250 HGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQ 309
             ++    +  +L+GL+S      +  PLD IKTR+Q   S     N +       ++  
Sbjct: 231 QNNE----YFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINC---AYRIFV 283

Query: 310 EEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
           EEGF  L+KG  PR+M+V    +V+F +Y++
Sbjct: 284 EEGFAMLWKGWLPRLMKVGLSGSVSFGIYQY 314

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 300 ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           + T   +L ++ G RA +KG  P +MR      V FT +  +++
Sbjct: 181 VLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ 224

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 88.6 bits (218), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 143/315 (45%), Gaps = 33/315 (10%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKV---------RMQIYRRANEGTKPPG---------FLR 102
            +AGG +G+    C  P D +KV          + +  + +   K P            +
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD----RQTGVVSTGNT 158
              ++Y   G+ AFY G G  VI + P+ +I+F S+E  + ++      R T  +S  +T
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           ++AG  AG+  A   V P++ +K R+Q   L    +        Q A  + +E G+   Y
Sbjct: 351 YIAGGLAGMA-AQFSVYPIDTLKFRVQCAPLDTKLKGNNL--LFQTAKDMFREGGLRLFY 407

Query: 219 RGVSLTAARQATNQGANFTVYSKLME-RLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA- 276
           RGV++           +   +S L +  + +   + NLP  + +L  LV   +G FS   
Sbjct: 408 RGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTV 467

Query: 277 ------PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
                 P++ ++TRLQ   +  +   +     +  + ++ EG++ L+KG+ P + +V P 
Sbjct: 468 GASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPA 527

Query: 331 QAVTFTVYEFVRRHL 345
            ++++  YE +++ +
Sbjct: 528 VSISYLCYENLKKFM 542

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 153/341 (44%), Gaps = 51/341 (14%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI------YRRA---NEGT 95
           P     S+ +  P V+ VAGG  G+  A+   P D +K R+Q       Y+ A   N G+
Sbjct: 38  PTIKDDSQPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGS 97

Query: 96  KPPGFLRTG-----------ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSY----EF 140
               F+               N+Y  EG  + +KGLG  ++G+IP  +I F +Y    + 
Sbjct: 98  STLHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDI 157

Query: 141 Y-RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYR 199
           Y RTL   ++   +      LA   AG   +  V NP+ +VK RLQ       A  + Y+
Sbjct: 158 YSRTLNNGQEAPWIH----LLAAATAGWATST-VTNPIWLVKTRLQLD----KAGTKTYK 208

Query: 200 NAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA-NFTVYSKL--------MERLQEYH 250
           N++     +VK EG+  LY+G  L+A+   + +G   + +Y ++        +E+    H
Sbjct: 209 NSLDCIKSVVKNEGVLGLYKG--LSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIH 266

Query: 251 -----GSQNLPSW-ETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG 304
                 S  +  W + S    ++  +      P + ++TRL++  +      +  +    
Sbjct: 267 EDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSF 326

Query: 305 RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           R +++EEG  ++Y G+TP ++R  P   + F  +E V + L
Sbjct: 327 RVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           + G A    ++  +P + ++ R++     N   K  G +++   I   EGL++ Y GL  
Sbjct: 285 SAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTP 344

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLA 146
            ++  +P   I F ++E    LL+
Sbjct: 345 HLLRTVPNSIIMFGTWELVIKLLS 368

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 86.3 bits (212), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 132/299 (44%), Gaps = 29/299 (9%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYK 118
           +++ G  AG    +  +P DT+KVR+Q   R       P         Y  EG++  F++
Sbjct: 16  DILYGSIAGALGKVIEYPFDTVKVRLQTQGRH----VFPDTWSCITYTYKNEGIIKGFFQ 71

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
           G+ + + G   + A  F SY      L    T V    N  ++G  AG + A  V+ P+E
Sbjct: 72  GIASPLAGAAIENAALFLSYNQCSKFL-QHYTNVSDLTNILISGAFAG-SCASFVLTPVE 129

Query: 179 VVKIRLQAQHLH--------GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
           ++K +LQ  +L         G    +++   I     ++K  G   L++G S T  R++ 
Sbjct: 130 LIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESF 189

Query: 231 NQGANFTVYSKLMERLQEYHGSQN--LP----SWETSLIGLVSGAIGPFSNAPLDTIKTR 284
              A F  Y  + + L+  H  ++  LP    +WE    G  +G     S  P DT+K+ 
Sbjct: 190 GGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSM 249

Query: 285 LQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           +Q +         + + T  +++  E+G R  Y+G+   ++R  P  A  F VYE + +
Sbjct: 250 MQTEH--------LGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 27/186 (14%)

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI-GALYRGVSLTAARQATNQGA 234
           P + VK+RLQ Q  H   +     + I   Y   K EGI    ++G++   A  A    A
Sbjct: 33  PFDTVKVRLQTQGRHVFPDTW---SCITYTY---KNEGIIKGFFQGIASPLAGAAIENAA 86

Query: 235 NFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL 294
            F  Y++  + LQ Y    +L +   S  G  +G+   F   P++ IK +LQ      NL
Sbjct: 87  LFLSYNQCSKFLQHYTNVSDLTNILIS--GAFAGSCASFVLTPVELIKCKLQ----VSNL 140

Query: 295 SNW--------------VRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
            +                RI    + +++  GF  L++G +   +R + G    F  YE 
Sbjct: 141 QSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYEL 200

Query: 341 VRRHLE 346
           ++++L+
Sbjct: 201 MKKYLK 206

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 85.9 bits (211), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 134/316 (42%), Gaps = 31/316 (9%)

Query: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106
           +H+   +  +   +LVAG  +GLF   C  PLDT+K+++Q+        K    L    N
Sbjct: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVL---IN 57

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-ADRQTGVVSTGNTFLAGVGA 165
           I   EG+  F+KG     I  I     +F SY +  + L       +     + L G  A
Sbjct: 58  ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLA 117

Query: 166 GVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
           G+T + L   P +V++ R  A   +   +  K R+ I A   I   EG+   + G   + 
Sbjct: 118 GMTSS-LASYPFDVLRTRFAA---NSQGQLIKLRDEIMA---IWSHEGLMGFFSGCGSSM 170

Query: 226 ARQATNQGANFTVYSKL---MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIK 282
                N    F VY  +    E   +    ++  +    L G +SG     +  PLDT++
Sbjct: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230

Query: 283 TRLQ------KDKSTRNLSNWV-------RITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
            R+Q      +++  R  +  +       R   +G  +VQ+EG  +LY+G+T  +++  P
Sbjct: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290

Query: 330 GQAVTFTVYEFVRRHL 345
             A++   YE     L
Sbjct: 291 STAISLWSYELFMNKL 306

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 9/106 (8%)

Query: 243 MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITT 302
           M +       + + +  + + G +SG       APLDT+K +LQ     +N +  + I  
Sbjct: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINI-- 58

Query: 303 IGRQLVQEEGFRALYKGITP-RVMRVAPGQAVTFTVYEFVRRHLEG 347
                ++ EG R  +KG  P  +M +  G A  F  Y ++   L G
Sbjct: 59  -----LKREGIRGFWKGNVPGSIMYIIYGGA-QFGSYTYIGSFLRG 98

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 133/301 (44%), Gaps = 43/301 (14%)

Query: 64  GGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP---PGFLRTGANIYSGEGLLAFYKGL 120
           GG  G+   +  HPLD  KVR+Q        T P   P  +R  + I   EG+   Y GL
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQ--------TAPAPKPTLVRMASQILRNEGVPGLYSGL 66

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQ---TGVVSTGNTFLAGVGAGVTEAVLVVNPM 177
            A ++        RF  Y+F +     ++   + +     +  +G   G     L+ NP 
Sbjct: 67  TAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG-----LIGNPA 121

Query: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY--------RGVSLTAARQA 229
           +VV IR+Q      A  ++ Y+NA    Y I   EG+  L+        RG+ +T+++  
Sbjct: 122 DVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVV 181

Query: 230 T-NQGANFTVYSKLMERL-QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
           T +   N+ V +  +++  +  H + +L      L GLV+  +     +P D IKTR+  
Sbjct: 182 TYDIAKNYLVQNVGLDKDNKSTHFASSL------LAGLVATTVC----SPADVIKTRVMN 231

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEG 347
                + S  VRI       V++EG   +++G  P  +R+ P   + F   E +R+H  G
Sbjct: 232 AHKHSHDSA-VRILL---DAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRKHRVG 287

Query: 348 L 348
           +
Sbjct: 288 M 288

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 129/314 (41%), Gaps = 47/314 (14%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQ-------------IYRRANEGTKPPGFLRTGAN 106
           + VAGG  G+      HP D IKVR Q             I + A   T+  G L T + 
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAK--TQVKGTLFTNS- 94

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA--DRQTGV--VSTGNTFLAG 162
                 +  FYKG+   ++G+ P  A+ F  Y+  + L+   ++Q G   ++ G    AG
Sbjct: 95  ------VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAG 148

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222
             + +    LV  P E VK+ LQ              + IQAA  IVKE GI +L++G  
Sbjct: 149 FISAI-PTTLVTAPTERVKVVLQTSS---------KGSFIQAAKTIVKEGGIASLFKGSL 198

Query: 223 LTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWE------TSLIGLVSGAIGPFSNA 276
            T AR        F  Y      L      Q+    E        L G ++G     +  
Sbjct: 199 ATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVF 258

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P+DTIKT+LQ   + +N+     ++      +Q  G +  + G+ P ++R  P  A TF 
Sbjct: 259 PIDTIKTKLQASSTRQNM-----LSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFL 313

Query: 337 VYEFVRRHLEGLGL 350
             E      +  G+
Sbjct: 314 GVEMTHSLFKKYGI 327

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 125/326 (38%), Gaps = 43/326 (13%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEG--TKPPGFLRT--GANIYSG- 110
           +  +  ++G  AG    +   PLD  K R+Q       G  T+P G + T  G   YSG 
Sbjct: 102 DTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGI 161

Query: 111 ----------EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFL 160
                     E +   YKG+  +V+G  P   I FS YE  + L   R        +  +
Sbjct: 162 WGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCK-LSYPRYFNNSEFLSHSM 220

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG 220
           + + AG     L  NP+ VVK RL  Q          Y+N + A   I K EGI + Y G
Sbjct: 221 SALTAGAISTTLT-NPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 221 VSLTAARQATNQGANFTVYSKLMERLQEY--------------------HGSQNLPSWET 260
           + + +     +   +F VY KL + L  Y                     GS N      
Sbjct: 280 L-IPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 261 SLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
            +    S  I      P + ++TRLQ     +       I +I R    +EG R  Y G 
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKSDMKP-----SIKSIIRTTYAKEGIRGFYSGF 393

Query: 321 TPRVMRVAPGQAVTFTVYEFVRRHLE 346
              + R  P  A+T   +E+ R+H +
Sbjct: 394 LTNMFRTVPASAITLVSFEYFRKHFK 419

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 136/295 (46%), Gaps = 40/295 (13%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVR-MQIYRRANEGTKPPG-FLRTGANIYSGEGLLAFYK 118
           L+   +AG+ E    HP+DTI  R M  + +   G +      R  A    G+ +   + 
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFP 73

Query: 119 GLG-AVVIGIIPKM--------AIRFSSYEF---YRTLLADRQTGVVSTGNTFLAGVGAG 166
           GLG A V  I+ ++        A  F +  F   + +   D+    + +     AG   G
Sbjct: 74  GLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSAT---AGSLIG 130

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
           + E VL+  P++V+KI+ Q        E  K R  ++    I+K+EGI  LYRG   TAA
Sbjct: 131 IGEIVLL--PLDVLKIKRQTN-----PEAFKGRGFLK----ILKDEGIFNLYRGWGWTAA 179

Query: 227 RQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGPF-SNAPLDTIK 282
           R A    A F    ++K  +  LQ+Y  SQ   +W  + I  + GA      +APLD IK
Sbjct: 180 RNAPGSFALFGGNAFAKEYILGLQDY--SQ--ATWSQNFISSIVGASASLIVSAPLDVIK 235

Query: 283 TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           TR+Q     RN  N      I +  ++ EGF A +KG+TP+++   P    +F +
Sbjct: 236 TRIQ----NRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFAL 286

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 12/88 (13%)

Query: 261 SLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
           SLIG     IG     PLD +K + Q +        +++I       +++EG   LY+G 
Sbjct: 127 SLIG-----IGEIVLLPLDVLKIKRQTNPEAFKGRGFLKI-------LKDEGIFNLYRGW 174

Query: 321 TPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
                R APG    F    F + ++ GL
Sbjct: 175 GWTAARNAPGSFALFGGNAFAKEYILGL 202

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 139/309 (44%), Gaps = 31/309 (10%)

Query: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106
           +H+   ++ +   +++AG  +G+F  +   P+DT+K+R Q+  +  +  K  G   T   
Sbjct: 8   DHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQL--QPVQEDKYKGIASTVRT 65

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAG 166
           I   EGL A +KG        +   A++F SY ++  + + +       G T   G  AG
Sbjct: 66  IMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAG 125

Query: 167 VTEAVLVVNPMEVVKIRLQAQ---HLHGAAEQ--QKYRNAIQAAYLIVKEEGIGALYRGV 221
           +T +V V  P+++++ RL A    H    AE+  Q + N           EG+   + G+
Sbjct: 126 MTSSV-VSYPLDLLRTRLIANRTSHRTSVAEECRQMWLN-----------EGVRGFFTGI 173

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
           S        +    F  Y + +  + E H  +      ++  G+++G +      P+DT+
Sbjct: 174 STAMTTVTLSTAIMFLTY-ETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTL 232

Query: 282 KTRLQKDKSTRNLS-----------NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
           + R+Q   S R +             +   T I  +++++EG  ALY+G+T  + +  P 
Sbjct: 233 RRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPT 292

Query: 331 QAVTFTVYE 339
            A++  VYE
Sbjct: 293 TAISLFVYE 301

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 87/198 (43%), Gaps = 18/198 (9%)

Query: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL 207
           R+   VS  N+ +AG  +GV  A +   PM+ VKIR Q Q      ++ KY+        
Sbjct: 11  RKGETVSWYNSVIAGSVSGVF-ARMATAPMDTVKIRYQLQ----PVQEDKYKGIASTVRT 65

Query: 208 IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSW----ETSLI 263
           I+KEEG+ AL++G     A         F  YS           S   P +    +T  +
Sbjct: 66  IMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVW-----SAKFPRFSQQGQTLTV 120

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G ++G      + PLD ++TRL  ++++   S    +    RQ+   EG R  + GI+  
Sbjct: 121 GALAGMTSSVVSYPLDLLRTRLIANRTSHRTS----VAEECRQMWLNEGVRGFFTGISTA 176

Query: 324 VMRVAPGQAVTFTVYEFV 341
           +  V    A+ F  YE V
Sbjct: 177 MTTVTLSTAIMFLTYETV 194

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 90/203 (44%), Gaps = 16/203 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
            L  G  AG+  ++  +PLD ++ R+     AN  +           ++  EG+  F+ G
Sbjct: 117 TLTVGALAGMTSSVVSYPLDLLRTRLI----ANRTSHRTSVAEECRQMWLNEGVRGFFTG 172

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
           +   +  +    AI F +YE    +  + +    S   +  +G+ AG     +V  P++ 
Sbjct: 173 ISTAMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVF-PIDT 231

Query: 180 VKIRLQAQH----LH-----GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
           ++ R+Q  +    +H         + +Y+++    Y I+++EG+ ALYRG+++   +   
Sbjct: 232 LRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVP 291

Query: 231 NQGANFTVYSKLMERLQEYHGSQ 253
               +  VY + M+     HG +
Sbjct: 292 TTAISLFVYERTMDLFD--HGQR 312

>Kwal_23.3529
          Length = 395

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 120/288 (41%), Gaps = 25/288 (8%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYKGLGAVVIGIIPKMAIR 134
           H LDT+K R Q    A    K    +     I+  EG+    Y G  A ++G  P  AI 
Sbjct: 104 HSLDTVKTRQQ---GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIF 160

Query: 135 FSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ------H 188
           F +YE  +  L D   GV  T +   AG+   +  +V+ V P EV+K RLQ Q      H
Sbjct: 161 FGTYELTKRKLID-DWGVNETLSHLTAGLSGDLVSSVVYV-PSEVLKTRLQLQGCYNNPH 218

Query: 189 LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
            H     +  R+AI A   IV+ EG   L+ G   T  R        F  Y K  +    
Sbjct: 219 FHSGYNYRNLRDAITA---IVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFT 275

Query: 249 YHG---SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGR 305
             G   SQ+L      L G  +G +      P+D IKTR+Q    +   S+  R+  I  
Sbjct: 276 LEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIEN 335

Query: 306 QLVQ-------EEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
            L++        EG    + G+ PR +  +   ++   +Y+   + L+
Sbjct: 336 SLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSLD 383

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 84.3 bits (207), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 136/322 (42%), Gaps = 37/322 (11%)

Query: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102
           P P +++ S    +  V  +AGG AG        P + +K+ +Q+        +  G + 
Sbjct: 9   PQP-SYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ--GIVG 65

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADRQTGVVSTGN 157
               +Y  EG    ++G G   I I P  A++F  YE     F+    +  +  + +   
Sbjct: 66  AVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQR 125

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ----------HLHGAAEQQKYRNAIQAAYL 207
            F   +  G +  VL   P+++V+ RL  Q            H  ++     + +   Y 
Sbjct: 126 LFSGALCGGCS--VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY- 182

Query: 208 IVKEEG-IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGL 265
             KEEG I  LYRGV  T+         NF VY +  E + E  G+ N L ++    IG 
Sbjct: 183 --KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGA 238

Query: 266 VSGAIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319
           +SG +      P D ++ R Q       +   R  S    + TIG+     EGFR  YKG
Sbjct: 239 LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGK----TEGFRGYYKG 294

Query: 320 ITPRVMRVAPGQAVTFTVYEFV 341
           +T  + +V P  AV++ VYE V
Sbjct: 295 LTANLFKVIPSTAVSWLVYEVV 316

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
           L G ++GA+     +P + +K  LQ   ST   +    I    RQ+ +EEG   L++G  
Sbjct: 27  LAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNG 84

Query: 322 PRVMRVAPGQAVTFTVYEFVRRHL 345
              +R+ P  AV F VYE  ++H 
Sbjct: 85  LNCIRIFPYSAVQFVVYEACKKHF 108

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 84.7 bits (208), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 132/302 (43%), Gaps = 33/302 (10%)

Query: 74  CCHPLDTIKVRM---------------QIYR---RANEGTKPPGFLRTGANIYSGEGLLA 115
           C  P D IKV +               Q+     RA+        ++   ++Y   GL A
Sbjct: 192 CTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRA 251

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ----TGVVSTGNTFLAGVGAGVTEAV 171
           FY G G  VI + P+ A++F S+E  + +LA  +    TG +S  +T++AG G G   A 
Sbjct: 252 FYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAG-GLGGIMAQ 310

Query: 172 LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATN 231
             V P++ +K R+Q   L            I+ A  + +E G+   YRG+ +        
Sbjct: 311 FSVYPIDTLKFRIQCAPLDTRCRGLPL--LIKTAKDMYREGGLRLFYRGLGVGILGVFPY 368

Query: 232 QGANFTVYSKL-----MERLQEYHGSQN---LPSWETSLIGLVSGAIGPFSNAPLDTIKT 283
              +   +S L       R      S+N   + +     +G  SG +G     P++ ++T
Sbjct: 369 AALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRT 428

Query: 284 RLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           RLQ   +  +   +     + R+ VQ EG   LYKG+ P + +V P  A+++  YE ++R
Sbjct: 429 RLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKR 488

Query: 344 HL 345
            +
Sbjct: 489 AM 490

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 83/189 (43%), Gaps = 10/189 (5%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLG 121
           VAGG  G+      +P+DT+K R+Q           P  ++T  ++Y   GL  FY+GLG
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 122 AVVIGIIPKMAIRFSSYEFYRTLLADRQTGV-------VSTGNTFLAGVGA-GVTEAVLV 173
             ++G+ P  A+   ++   +     R+          V   N  +  +GA   T    V
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATV 419

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           V P+ +++ RLQAQ  +  A   +Y          V+ EG+  LY+G+  T A+      
Sbjct: 420 VYPINLLRTRLQAQGTY--AHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVA 477

Query: 234 ANFTVYSKL 242
            ++  Y  L
Sbjct: 478 ISYLCYENL 486

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           V L  G  +G   A   +P++ ++ R+Q         +  GF          EGL   YK
Sbjct: 404 VVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYK 463

Query: 119 GLGAVVIGIIPKMAIRFSSYE 139
           GL   +  + P +AI +  YE
Sbjct: 464 GLVPTLAKVCPAVAISYLCYE 484

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 307 LVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           L ++ G RA Y G    V++V P  A+ F  +E  +R L GL
Sbjct: 243 LYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGL 284

>Kwal_23.2913
          Length = 320

 Score = 83.2 bits (204), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 137/338 (40%), Gaps = 57/338 (16%)

Query: 37  SAVCQQPYPDNHMSSKKSTNPAV------NLVAGGTAGLFEALCCHPLDTIKVRMQ---- 86
           SA  +Q   D +   ++++N         +L AGG  G+   L  HP D +KVR Q    
Sbjct: 2   SATVEQDAADLNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQA 61

Query: 87  ------IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEF 140
                 I R  +E     G L           +  FY+G+   ++G+ P  A+ F  Y+ 
Sbjct: 62  SGTLDAISRVLHEAKSKSGPLPLNQ-------IKGFYRGVIPPLLGVTPIFAVSFWGYDV 114

Query: 141 YRTLL------------ADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH 188
            + L+            +  +   ++T    LAG  + +    L+  P E VK+ LQ   
Sbjct: 115 GKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFSAI-PTTLITAPTERVKVVLQT-- 171

Query: 189 LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
               +E   +   + AA  +++E G+ +L++G   T AR        F  Y      L  
Sbjct: 172 ----SESGSF---LGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSR 224

Query: 249 YHGSQNLPSWETSLIGLVSGA---IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGR 305
              +  L      + G V+G    IG F   P+DTIKT+LQ    ++++          R
Sbjct: 225 NQDTDALSVVSICVAGGVAGMSMWIGVF---PIDTIKTKLQSSSRSQSM------VQAAR 275

Query: 306 QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           ++    G R  + G+ P +MR  P  A TF   EF  +
Sbjct: 276 EIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQ 313

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLG 121
           VAGG AG+   +   P+DTIK ++Q   R+         ++    IY+  GL  F+ GLG
Sbjct: 238 VAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQS------MVQAAREIYTRAGLRGFFPGLG 291

Query: 122 AVVIGIIPKMAIRFSSYEFYRTLL 145
             ++   P  A  F   EF   L 
Sbjct: 292 PALMRSFPANAATFLGVEFTHQLF 315

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQ-QKYRNAIQAAYLIVKEEGIGALY 218
           LA  G G   AVL  +P +++K+R Q+    G  +   +  +  ++    +    I   Y
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIKGFY 91

Query: 219 RGV-----SLTAARQATNQGANFTVYSKLM----ERLQEYHGSQN----LPSWETSLIGL 265
           RGV      +T     +  G  + V  +L+      + +  GS +    L + + +L G 
Sbjct: 92  RGVIPPLLGVTPIFAVSFWG--YDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGF 149

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVM 325
            S        AP + +K  LQ  +S   L          R L++E G R+L++G    + 
Sbjct: 150 FSAIPTTLITAPTERVKVVLQTSESGSFLGA-------ARTLIREGGVRSLFQGTLATLA 202

Query: 326 RVAPGQAVTFTVYEFVRRHLE 346
           R  PG A+ F  YE  +R L 
Sbjct: 203 RDGPGSALYFASYEVSKRFLS 223

>Scas_702.10
          Length = 302

 Score = 82.8 bits (203), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 126/298 (42%), Gaps = 36/298 (12%)

Query: 64  GGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAV 123
           GG AG+F  +  HPLD  KVR+Q           P   R    I   E ++  Y GL A 
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQ-----AAPLPKPTLGRMLTTILRNENVMGLYSGLSAA 70

Query: 124 VIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVV 180
           V+       +RF +Y+  +  L  +      V     +  +G   G     LV N  +VV
Sbjct: 71  VLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGG-----LVGNFADVV 125

Query: 181 KIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE-GIGALY--------RGVSLTAARQATN 231
            IR+Q         ++ YRNAI   Y I   E GI  L         RGV +TA++  T 
Sbjct: 126 NIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVT- 184

Query: 232 QGANFTVYSKLMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKS 290
               + V+   +     +   +N      SL+ GLV+  I     +P D IKTR+     
Sbjct: 185 ----YDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTIC----SPADVIKTRIMNAHK 236

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           T + S  ++I T     +++EG   +++G  P   R+ P   + F   E +++H  G+
Sbjct: 237 TESESA-IKILT---SAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKKHRVGM 290

>Kwal_55.20868
          Length = 380

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 125/310 (40%), Gaps = 30/310 (9%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIY-RRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           +  ++G  AG    +   PLD  K R+Q     +N      G L T   I   EG    Y
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTE---AVLVV 174
           KGL  +++G  P   I FS YE  + L        +     F++   + +T    + ++ 
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLYPR-----IFPSFDFISHSASALTAGTVSTILT 191

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
           NP+ VVK RL  Q  H       Y +   A + +   EG+   Y G+ L +     +   
Sbjct: 192 NPVWVVKTRLMLQ-THVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGL-LPSLLGLFHVAI 249

Query: 235 NFTVYSKL---------MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRL 285
           +F +Y KL         M R +++    NL      +    S  +      P + ++TR+
Sbjct: 250 HFPIYEKLKVWLHCTPSMSRTEDH----NLNLARLIIASSASKMVASTLTYPHEILRTRM 305

Query: 286 Q-KDKSTRNLSNWVRITTIG-----RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           Q K   T  L+   + +  G     +   + EG R  Y G T  + R  P  A+T   +E
Sbjct: 306 QLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

Query: 340 FVRRHLEGLG 349
           + R++L  L 
Sbjct: 366 YFRKYLTKLN 375

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRR------ANEGTKPP 98
           P    +   + N A  ++A   + +  +   +P + ++ RMQ+         A + T   
Sbjct: 265 PSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRH 324

Query: 99  GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
           G +R   + Y  EGL  FY G  A +   +P  AI   S+E++R  L
Sbjct: 325 GLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKYL 371

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 135/320 (42%), Gaps = 56/320 (17%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF---- 116
           +++G TAG    +  HPLD +KVR+Q+        KP G+      I       +F    
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQL---LATNKKPQGYYDVVKRIVKDSKQHSFFRET 68

Query: 117 YKGLGAVVIGIIPKMAIRFSSYE----------------FYRTLLADRQTGVVSTGNTFL 160
           Y+GLG  ++G      + F  Y                 F  T+  D++   +++    L
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKE---MTSLMYLL 125

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG 220
           A   +GV  +VL  NP+ V+K R+ +       + + YR+ +     + + EG+   +RG
Sbjct: 126 AAAMSGVATSVLT-NPIWVIKTRIMSTSF---VDSRSYRSTVDGIKKLYRIEGLAGFWRG 181

Query: 221 VSLTAARQATNQGA-NFTVYSKLMERLQEYH--------GSQNLPSWETSLIGLVSGAIG 271
             L  +    +QGA  FTVY  L     +YH          + L + E   I  +S  + 
Sbjct: 182 --LVPSLFGVSQGAIYFTVYDTL-----KYHYFAAKHVDKKKKLSNLEYITITSLSKMVS 234

Query: 272 PFSNAPLDTIKTRLQKDKSTRNLS------NWVRITTIGRQLVQEEGFRALYKGITPRVM 325
             +  PL  +K+ LQ  + +  ++       W  ITTI       +G   LYKG+   ++
Sbjct: 235 VTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTI----YVRDGVTGLYKGLLANLI 290

Query: 326 RVAPGQAVTFTVYEFVRRHL 345
           R  P   +TF VYE  R  L
Sbjct: 291 RAVPSTCITFCVYENFRHWL 310

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 150/344 (43%), Gaps = 46/344 (13%)

Query: 41  QQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ--IYRRANEG---- 94
           +Q   +NH + K    P V+ VAGG  G+  A+   P D +K R+Q  I+ +A +     
Sbjct: 40  KQSEIENHPTVK----PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVN 95

Query: 95  -----TKPPGF---LRTGA----------NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136
                T+P      ++ G           N+Y  EG  + +KGLG  ++G+IP  +I F 
Sbjct: 96  ISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFF 155

Query: 137 SYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ 196
           +Y   + + A        T    L              NP+ ++K R+Q     G    +
Sbjct: 156 TYGTTKDMYAKAFNNGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKA-GKTSVR 214

Query: 197 KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA-NFTVYSKLMERLQE------- 248
           +Y+N+      +++ EG   LY+G  L+A+   + +G   + +Y ++   ++E       
Sbjct: 215 QYKNSWDCLKSVIRNEGFTGLYKG--LSASYLGSVEGILQWLLYEQMKRLIKERSIEKFG 272

Query: 249 YHG------SQNLPSW-ETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRIT 301
           Y        S+ +  W + S    ++  +   +  P + ++TRL++         +  + 
Sbjct: 273 YQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLV 332

Query: 302 TIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
              + +++EEG  ++Y G+TP +MR  P   + F  +E V R L
Sbjct: 333 QSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           + G A    ++  +P + ++ R++   + N   K  G +++   I   EGL + Y GL  
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTP 353

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLA 146
            ++  +P   I F ++E    LL+
Sbjct: 354 HLMRTVPNSIIMFGTWEIVIRLLS 377

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 110/255 (43%), Gaps = 25/255 (9%)

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEA 170
           EGL   ++GL   ++  IP   + FS YE +R     R +    + N    G  A +  A
Sbjct: 111 EGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDS--YPSLNPLFCGATARMVAA 168

Query: 171 VLVVNPMEVVKIRLQA--QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
              V P+E++K RLQ+  +       Q  +++ ++     ++  G   L++G+ +T  R 
Sbjct: 169 T-TVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRD 227

Query: 229 ATNQGANFTVYSKLMERLQEYHGSQNL-----PSWE---TSLIG-LVSGAIGPFSNAPLD 279
                  +  Y    +        Q L     P+W+    S IG  VSG+       P D
Sbjct: 228 VPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFD 287

Query: 280 TIKTRLQKDKSTRN------LSNWVRITTIGR-----QLVQEEGFRALYKGITPRVMRVA 328
             KTR+Q      N      +S   R++  G       + Q EG+ ALY G+ PRVM++A
Sbjct: 288 VGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIA 347

Query: 329 PGQAVTFTVYEFVRR 343
           P  A+  + YE  +R
Sbjct: 348 PSCAIMISTYELSKR 362

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 84/197 (42%), Gaps = 27/197 (13%)

Query: 50  SSKKSTNPAVN-LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR-----T 103
           S  + + P++N L  G TA +  A    PL+ IK R+Q   R+ + T      +     T
Sbjct: 145 SPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKET 204

Query: 104 GANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFY-RTLLADRQTGVVSTG------ 156
              I SG G    +KGL   +   +P  AI + SYEFY +    D     +         
Sbjct: 205 RNEIRSG-GYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWD 263

Query: 157 ---NTFLAGVGAGVTEAVLVVNPMEVVKIRLQA---------QHLHGAAEQQKYRNAIQA 204
              N+F+ G  +G + A L+ +P +V K R+Q            L    ++   R   + 
Sbjct: 264 FFINSFIGGSVSG-SSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 205 AYLIVKEEGIGALYRGV 221
            Y I + EG GALY G+
Sbjct: 323 LYNIKQTEGYGALYTGL 339

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 99/250 (39%), Gaps = 59/250 (23%)

Query: 147 DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL-----HGAAEQQK---- 197
           DR +  +       A  G+ +T   L   PM+VV+IRLQ Q +      GAA + K    
Sbjct: 4   DRSSTAIMKERMLSACAGSFLTSFFL--TPMDVVRIRLQQQVMLPDCSCGAASELKGSVG 61

Query: 198 -----------------------------------YRNAIQAAYLIVKEEGIGALYRGVS 222
                                              + +  +A   I + EG+  L+RG+S
Sbjct: 62  TEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLS 121

Query: 223 LTAARQATNQGANFTVYSKLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPFSNAPLDTI 281
           +T           F+ Y    E  +++   ++  PS      G  +  +   + APL+ I
Sbjct: 122 ITLLMAIPANVVYFSGY----EMFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELI 177

Query: 282 KTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
           KTRLQ      KD +T+ +     +    R  ++  G++ L+KG+   + R  P  A+ +
Sbjct: 178 KTRLQSIPRSRKDTTTQMMFK--DLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYW 235

Query: 336 TVYEFVRRHL 345
             YEF +++ 
Sbjct: 236 GSYEFYKKNF 245

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 11/98 (11%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY-----RRANEGTKPP------GFLRTGANIY 108
           + + G  +G   AL  HP D  K RMQI      ++ N    P       G  +   NI 
Sbjct: 268 SFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIK 327

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
             EG  A Y GL   V+ I P  AI  S+YE  + L A
Sbjct: 328 QTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 130/318 (40%), Gaps = 46/318 (14%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGL-LAFYKG 119
           +V+GG  G       H LDT+K R Q    A    K    +     I+  EG+    Y G
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQ---GAPNVKKYRNMISAYRTIWLEEGVRRGLYGG 113

Query: 120 LGAVVIGIIPKMAIRFSSYEFY-RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
             A ++G  P  AI F +YE+  RT++ D Q   ++   T L+    G   +  V  P E
Sbjct: 114 YMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQ---INDTITHLSAGFLGDFISSFVYVPSE 170

Query: 179 VVKIRLQAQ------HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232
           V+K RLQ Q                 RNAI+    ++KEEG  +L+ G   T AR     
Sbjct: 171 VLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKT---VIKEEGFRSLFFGYKATLARDLPFS 227

Query: 233 GANFTVYSKL------MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
              F  Y K       +E+     G  ++P+    L G  +G +      P+D +KTR+Q
Sbjct: 228 ALQFAFYEKFRQLAFKIEQKDGRDGELSIPN--EILTGACAGGLAGIITTPMDVVKTRVQ 285

Query: 287 KDK--STRN-----------------LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRV 327
             +  S  N                 LSN + ++   R + Q EG    + G+ PR +  
Sbjct: 286 TQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSL--RTVYQSEGVLGFFSGVGPRFVWT 343

Query: 328 APGQAVTFTVYEFVRRHL 345
           +   ++   +Y+   R L
Sbjct: 344 SVQSSIMLLLYQMTLRGL 361

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 256 PSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGF-R 314
           P W   + G + G IG  +   LDT+KTR Q      N+  +  + +  R +  EEG  R
Sbjct: 52  PIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ---GAPNVKKYRNMISAYRTIWLEEGVRR 108

Query: 315 ALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            LY G    ++   P  A+ F  YE+ +R +
Sbjct: 109 GLYGGYMAAMLGSFPSAAIFFGTYEYTKRTM 139

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 162/366 (44%), Gaps = 56/366 (15%)

Query: 19  SVPVVYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPL 78
           S+P +    +  ++ D  S + +    +NH        P V+ VAGG  G+  A+   P 
Sbjct: 16  SIPYLASDEKGSNLKDATSLILENK-KENH----PHVAPWVHFVAGGIGGMAGAIITCPF 70

Query: 79  DTIKVRMQ------------------IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           D +K R+Q                  +Y+      +  G ++   N+Y+ EG  + +KGL
Sbjct: 71  DVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQ---NVYTQEGFRSLFKGL 127

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT-----FLAGVGAGVTEAVLVVN 175
           G  ++G+IP  +I F +Y     +  D  + +++ G       FLAG  AG   +    N
Sbjct: 128 GPNLVGVIPARSINFFTY----GVTKDTASRLLNDGQEAPWIHFLAGATAGWATST-ATN 182

Query: 176 PMEVVKIRLQAQHLHGAAE--QQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           P+ +VK RLQ   L  AA+   ++Y+N+      +++ EGI  LY+G+S  +   +    
Sbjct: 183 PIWLVKTRLQ---LDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLS-ASYLGSVESI 238

Query: 234 ANFTVYSKLME-----------RLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA---PLD 279
             + +Y ++              + E + +  +   E       +GA   F++    P +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 280 TIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
            ++TRL++         +  +      +++EEGF ++Y G+TP +MR  P   + F  +E
Sbjct: 299 VVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWE 358

Query: 340 FVRRHL 345
            V + L
Sbjct: 359 LVIKLL 364

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%)

Query: 63  AGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           + G A LF ++  +P + ++ R++   + N   K  G  ++ + I   EG  + Y GL  
Sbjct: 282 SAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTP 341

Query: 123 VVIGIIPKMAIRFSSYEFYRTLLA 146
            ++  +P   I F ++E    LLA
Sbjct: 342 HLMRTVPNSIIMFGTWELVIKLLA 365

>Scas_662.12
          Length = 308

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 141/312 (45%), Gaps = 41/312 (13%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGF------LRTGANIYSGEG-- 112
           +++G +AG    L  HPLD IKVR+Q+           G+      L   +     +G  
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 113 ---LLAFYKGLGAVVIGIIPKMAIRFS------SYEFYRTLLADRQTGVVSTGNTFLAGV 163
              +   Y+GL   ++G     ++ F+       Y F    L +  T +  T     +G+
Sbjct: 71  YNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLT-----SGL 125

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
            +G++   L+ NP+ V+K R+ +   H     +  R+  ++   ++ +EG  A++ G  L
Sbjct: 126 ISGIS-TTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKS---LLTKEGPKAIWMG--L 179

Query: 224 TAARQATNQGA-NFTVYSKL-------MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSN 275
             +    +QGA  F +Y  L       + + ++ + + NL   +  LI  +S  +   S 
Sbjct: 180 LPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANL---KIVLISSLSKMLSVMSV 236

Query: 276 APLDTIKTRLQKDKS-TRNL-SNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
            P   +K+ LQ  +S T N+  N     T+ R++ ++ G + LYKG++  ++R  P   +
Sbjct: 237 YPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCI 296

Query: 334 TFTVYEFVRRHL 345
           TF +YE  +  L
Sbjct: 297 TFCIYENFKSKL 308

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 5/103 (4%)

Query: 48  HMSSKKSTNPAVNL---VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT--KPPGFLR 102
           +++  K  N   NL   +    + +   +  +P   +K  +Q +R            F+ 
Sbjct: 206 NLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFIT 265

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
               IY   G+   YKGL A ++  IP   I F  YE +++ L
Sbjct: 266 LIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFKSKL 308

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 85/200 (42%), Gaps = 12/200 (6%)

Query: 54  STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG-ANIYSGEG 112
           + N  + L +G  +G+   L  +PL  IK R+    R ++ +     +R G  ++ + EG
Sbjct: 114 NNNTTIFLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKS--IRHGFKSLLTKEG 171

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADRQTGVVSTGNTFLAGVGAGV 167
             A + GL   ++G+  + AI F  Y+     F   L   ++    +     L    + +
Sbjct: 172 PKAIWMGLLPSLLGV-SQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKM 230

Query: 168 TEAVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
             +V+ V P +++K  LQ  + +     Q  Y   I     I ++ GI  LY+G+S    
Sbjct: 231 L-SVMSVYPFQLLKSNLQTFRSVTNNIPQNDYH-FITLIRKIYRDNGIKGLYKGLSANLL 288

Query: 227 RQATNQGANFTVYSKLMERL 246
           R   +    F +Y     +L
Sbjct: 289 RAIPSTCITFCIYENFKSKL 308

>Scas_714.18
          Length = 305

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 127/306 (41%), Gaps = 35/306 (11%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYK 118
            ++AG  AG       +P DT+KVR+Q      E    P         Y  EG+L  FY+
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQ----TQEAYMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
           G+ + +IG   + AI F +Y    + L        S     L   G   + A  V+ P+E
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLNAFTE--FSAFLIILISAGFAGSCASFVLTPVE 128

Query: 179 VVKIRLQAQHLHGAAEQQ-------------------KYRNAIQAAYLIVKEEGIGALYR 219
           ++K +LQ  +LH +                       ++   I     I+KE+G+  L++
Sbjct: 129 LIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQ 188

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLD 279
           G S T  R++      F  Y  + + L++     N  +W+  + G  +G     S  P D
Sbjct: 189 GQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVN-TTWQLLISGATAGLAFNGSVFPAD 247

Query: 280 TIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           T+K+ +Q +         + +    R +++ +G    Y+G+   ++R  P  A  F  YE
Sbjct: 248 TVKSIMQTEH--------LALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

Query: 340 FVRRHL 345
            + + L
Sbjct: 300 KLSKIL 305

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 128/284 (45%), Gaps = 42/284 (14%)

Query: 60  NLVAGGTAGLFEALCC-HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           N++ G    L E      PL+ +K  M  +R  N       FL+   +++S  G+  FY+
Sbjct: 14  NILLGAGLNLSEVTTLGQPLEVVKTTMAAHREFN-------FLQATKHVWSRGGIFGFYQ 66

Query: 119 GL-----------GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGV 167
           GL           GAV++ +  +   RF            +  G+ + G   + G+  GV
Sbjct: 67  GLIPWAWIEASTKGAVLLFVSAEAEYRF------------KVLGLNNFGAGIMGGITGGV 114

Query: 168 TEAVLVV---NPMEVVKI-RLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
           T+A L +     M+ V+I R +A ++ G   Q  +    Q    I K+EGI  + +GV+ 
Sbjct: 115 TQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSW----QVFKSIYKKEGIRGINKGVNA 170

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIG---PFSNAPLDT 280
            A RQ TN G+ F +   + + +++  G        T+L  +++ AIG      N P++ 
Sbjct: 171 VAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAWNQPIEV 230

Query: 281 IKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
           I+  +Q  K   N    + +    + + Q  G + LY+G+TPRV
Sbjct: 231 IRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV 274

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 75/185 (40%), Gaps = 31/185 (16%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           VS  N  L G G  ++E   +  P+EVVK  + A          +  N +QA   +    
Sbjct: 10  VSFSNILL-GAGLNLSEVTTLGQPLEVVKTTMAA---------HREFNFLQATKHVWSRG 59

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGP 272
           GI   Y+G+   A  +A+ +GA     S   E   +  G  N  +      G++ G  G 
Sbjct: 60  GIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGA------GIMGGITGG 113

Query: 273 FSNAPL--------DTIKTRLQKDKSTRNL---SNWVRITTIGRQLVQEEGFRALYKGIT 321
            + A L         T++   QK  +   +   S+W     + + + ++EG R + KG+ 
Sbjct: 114 VTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSW----QVFKSIYKKEGIRGINKGVN 169

Query: 322 PRVMR 326
              +R
Sbjct: 170 AVAIR 174

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 133/324 (41%), Gaps = 33/324 (10%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           +N + +    +  V  +AGG AG        P + +K+ +Q+        K  G      
Sbjct: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK--GLFDAIG 69

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG----VVSTGNTFLA 161
            +Y  E +   ++G G   I + P  A++F  +E  +  +    T      ++      +
Sbjct: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129

Query: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNA-----------IQAAYLIVK 210
           G   G   +V+   P+++V+ RL  Q  +  ++  K R +           +  AY   +
Sbjct: 130 GALCGGC-SVVATYPLDLVRTRLSVQTAN-LSKLSKSRASDIAKPPGVWKLLSKAY--AE 185

Query: 211 EEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL--QEYHGSQNLPSWETSLIGLVSG 268
           E GI  LYRGV  T+         NF VY +L E +   E   S    S     +G +SG
Sbjct: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245

Query: 269 AIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322
            +      P D ++ R Q       +      S W  + TIG+     EGF+  YKG+T 
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT----EGFKGYYKGLTA 301

Query: 323 RVMRVAPGQAVTFTVYEFVRRHLE 346
            + +V P  AV++ VYE    +++
Sbjct: 302 NLFKVVPSTAVSWLVYELTWDYMK 325

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 96/219 (43%), Gaps = 19/219 (8%)

Query: 48  HMSSK---KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIY---------RRANEGT 95
           H+ +K   +  N    L +G   G    +  +PLD ++ R+ +           RA++  
Sbjct: 111 HVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIA 170

Query: 96  KPPGFLRTGANIYSGEG-LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVS 154
           KPPG  +  +  Y+ EG ++  Y+G+    +GI+P +A+ F+ YE  +  +   + G  S
Sbjct: 171 KPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSS 230

Query: 155 TGNTF----LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVK 210
             ++     +  +  GV + +    P ++++ R Q   + G      Y +   A   I K
Sbjct: 231 MRDSLYKLSMGAISGGVAQTI--TYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGK 288

Query: 211 EEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY 249
            EG    Y+G++    +   +   ++ VY    + ++ +
Sbjct: 289 TEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW 327

>Kwal_27.12081
          Length = 369

 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 150/321 (46%), Gaps = 38/321 (11%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQ--IYRR--AN-EGTKPPGFLRTG------- 104
           P V+ VAGG  G+  A+   P D +K R+Q  +++   AN    K    + +G       
Sbjct: 52  PWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRET 111

Query: 105 ----ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR-QTGVVSTGNTF 159
               +N+Y  EG  + +KGLG  ++G+IP  +I F +Y   + + +     G  +     
Sbjct: 112 FGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL 171

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           ++   AG   +    NP+ ++K RLQ   L  A   ++Y+N+      I+++EG   LY+
Sbjct: 172 ISAATAGWATST-ATNPIWLIKTRLQ---LDKAGHTRQYKNSWDCLKHIIQKEGFFGLYK 227

Query: 220 GVSLTAARQATNQGA-NFTVYSKLMERLQ-------------EYHGSQNLPSW-ETSLIG 264
           G  L+A+   + +G   + +Y ++ + ++             E + S+ +  W + S   
Sbjct: 228 G--LSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSA 285

Query: 265 LVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
            ++  +      P + ++TRL++     +   +  +    R +++EEG  ++Y G+TP +
Sbjct: 286 GLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHL 345

Query: 325 MRVAPGQAVTFTVYEFVRRHL 345
           +R  P   + F  +E V + L
Sbjct: 346 LRTVPNSIIMFGTWELVIKLL 366

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 93/206 (45%), Gaps = 18/206 (8%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           P ++L++  TAG   +   +P+  IK R+Q+  +A    +         +I   EG    
Sbjct: 167 PWIHLISAATAGWATSTATNPIWLIKTRLQL-DKAGHTRQYKNSWDCLKHIIQKEGFFGL 225

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLA-----------G 162
           YKGL A  +G +  + +++  YE  + ++  R   + G +S G    +            
Sbjct: 226 YKGLSASYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGS 284

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222
            G     A +V  P EVV+ RL+   L    ++ KY   IQ+  +I+KEEG+ ++Y G++
Sbjct: 285 AGLAKFLASIVTYPHEVVRTRLRQAPLEN--DKLKYTGLIQSFRVIIKEEGLASMYGGLT 342

Query: 223 LTAARQATNQGANFTVYSKLMERLQE 248
               R   N    F  +  +++ L +
Sbjct: 343 PHLLRTVPNSIIMFGTWELVIKLLSD 368

>Scas_721.129
          Length = 323

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 94/209 (44%), Gaps = 25/209 (11%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           VS   +F+AG G     AV   NP+E+VKIR+Q Q    A  Q+ YRN IQ   +I + E
Sbjct: 19  VSKFGSFIAG-GMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNE 77

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI--------- 263
           GI  L +G+      Q    G+    Y  +   L     S   P+ E+  I         
Sbjct: 78  GIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALN----STFYPNEESHKIQKVSINVAA 133

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQK-------DKSTRNLSNWVRITTIGRQLVQEEGFRAL 316
           G  SG IG    +PL  +KTR+Q         + T   + W  ++TI R     EGF+ L
Sbjct: 134 GASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIAR----TEGFKGL 189

Query: 317 YKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           ++GI   ++R   G +V   +Y   +  L
Sbjct: 190 FRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 114/298 (38%), Gaps = 33/298 (11%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQ-----------IYRRANEGTKPPGFLRTGANIY 108
           + +AGG A        +P++ +K+RMQ           +YR   +G            I+
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGM---------GVIF 74

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA------DRQTGVVSTGNTFLAG 162
             EG+    KGL A  I  I     R   YE  R  L       +    +        AG
Sbjct: 75  RNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAG 134

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
             +G+  AV + +P+ +VK R+Q+        EQ  YRN       I + EG   L+RG+
Sbjct: 135 ASSGIIGAV-IGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGI 193

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
                R          +Y+     L +    ++ P    +   +    +    N P D I
Sbjct: 194 DAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMN-PWDVI 252

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
            TR+   K   NL        +  + V+ EG  ALYKG   +++R+AP   +  T  E
Sbjct: 253 LTRIYNQKG--NLYKGPVDCFV--KTVRTEGISALYKGFQAQILRIAPHTIICLTFME 306

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 8/85 (9%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP--GFLRTGANIYSGEGLL 114
           P ++L A   +GL  A+  +P D I  R  IY +     K P   F++T       EG+ 
Sbjct: 228 PGLHLTASTISGLGVAVVMNPWDVILTR--IYNQKGNLYKGPVDCFVKT----VRTEGIS 281

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYE 139
           A YKG  A ++ I P   I  +  E
Sbjct: 282 ALYKGFQAQILRIAPHTIICLTFME 306

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 80.9 bits (198), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 144/314 (45%), Gaps = 39/314 (12%)

Query: 50  SSKKSTNPAV--NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG--FLRTGA 105
           S +K  N A    L+AG  +GL       P+DTIK+R+Q+      G KP G   +    
Sbjct: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVAR 64

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGA 165
           ++   EG+ +F+KG     +  +   + +FSSY  +   L     G+ +  ++ + G  A
Sbjct: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--FGLEARLHSLVVGAFA 122

Query: 166 GVTEAVLVVNPMEVVKIRLQAQH-LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG---- 220
           G+T ++ V  P +V++ RL A + +H  +  ++ R+       I K EG+   ++G    
Sbjct: 123 GITSSI-VSYPFDVLRTRLVANNQMHSMSITREVRD-------IWKLEGLPGFFKGSIAS 174

Query: 221 ---VSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277
              ++LTA+           +Y    E+    H    L +   S  G + G I      P
Sbjct: 175 MTTITLTASIMFGTY-ETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFP 232

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITT------------IGRQLVQEEGFRALYKGITPRVM 325
           L+TI+ R+Q   S ++L  + R ++            IG Q++++EG  +LY+GI   + 
Sbjct: 233 LETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291

Query: 326 RVAPGQAVTFTVYE 339
           +  P   V+F  YE
Sbjct: 292 KTIPTTFVSFWGYE 305

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 96/211 (45%), Gaps = 32/211 (15%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +LV G  AG+  ++  +P D ++ R+     AN         R   +I+  EGL  F+KG
Sbjct: 115 SLVVGAFAGITSSIVSYPFDVLRTRLV----ANNQMHSMSITREVRDIWKLEGLPGFFKG 170

Query: 120 LGAVVIGIIPKMAIRFSSYEFYR--------TLLADRQTGVVSTGNTFLAGVGAGVTEAV 171
             A +  I    +I F +YE  R        T  A ++  + +  ++  AG   GV  A 
Sbjct: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS--AGTIGGVI-AK 227

Query: 172 LVVNPMEVVKIRLQ---AQHLHGAAEQQKYRNAIQAAYL----------IVKEEGIGALY 218
           ++  P+E ++ R+Q   ++HL    E+    +++  +Y           I+K+EG+ +LY
Sbjct: 228 IITFPLETIRRRMQFMNSKHL----EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLY 283

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEY 249
           RG+ +  ++       +F  Y   +  L+ Y
Sbjct: 284 RGILVALSKTIPTTFVSFWGYETAIHYLRMY 314

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%)

Query: 253 QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG 312
           QN+ +W+T L G VSG +     AP+DTIK RLQ   +        ++  + R +++ EG
Sbjct: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71

Query: 313 FRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGL 350
            R+ +KG  P  +      +  F+ Y    R+L   GL
Sbjct: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 80.9 bits (198), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 142/357 (39%), Gaps = 81/357 (22%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRM--------------------QIYRR 90
           ++K  +    +V+     L  +L   PLD ++VR+                    +++ +
Sbjct: 5   TRKEGSAKERMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQ 64

Query: 91  ----ANEGTKPP-----GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFY 141
               AN G + P     G L     I   EGL   ++GLG  ++  +P   + FS YE  
Sbjct: 65  DECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEAL 124

Query: 142 R--TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYR 199
           R  + LA R    +   N  + G  A +  A   + P+E+++ RLQ+          + R
Sbjct: 125 RDNSPLASR----LPVANPLVCGAFARILAAT-TIAPLELLRTRLQS--------VPRAR 171

Query: 200 NAIQAAYLI----------VKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY 249
           +  +  YLI          V   G  AL++G+ +T  R        +  Y     +    
Sbjct: 172 DTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWAR 231

Query: 250 H-GSQNLPSWETSL----IGLVSGAIGPFSNAPLDTIKTRLQ----------------KD 288
           H  + N  +W+  +     G + GA+      P D  KTR+Q                K 
Sbjct: 232 HAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKT 291

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
             +R + +++        + + EG RALY G+ PRVM++AP  A+  + YE  ++  
Sbjct: 292 DDSRGMFSFL------NAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>Kwal_23.4731
          Length = 314

 Score = 80.5 bits (197), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 129/309 (41%), Gaps = 35/309 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRT-------GANIYSGEGL 113
           ++AG  AG    +  HPLD +K+R+Q+             ++T        +N++     
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA-- 74

Query: 114 LAFYKGLGAVVIGIIPKMAIRFSSYEF-----YRTLLADRQTGVVSTG--------NTFL 160
              Y+GLG  +IG      + F  Y F     YR  +A  +T   S+         + +L
Sbjct: 75  ---YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYL 131

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG 220
           A          ++ NP+ V+K R+ +     +   ++Y+        +   EG    +RG
Sbjct: 132 ASAALSGLGTAILTNPIWVIKTRIMST---SSQASERYKTTWDGIRKVYAHEGFSGFWRG 188

Query: 221 VSLTAARQATNQGA-NFTVYSKLMERLQEYHG---SQNLPSWETSLIGLVSGAIGPFSNA 276
             L  +     QGA  FT+Y  L  +     G    + + + E   I  VS  +   +  
Sbjct: 189 --LVPSLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVY 246

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P   +K+ LQ   +     ++ R   + + + Q+EG + LYKG++  ++R  P   +TF 
Sbjct: 247 PFQLLKSNLQSFAAVEKRDSY-RFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFC 305

Query: 337 VYEFVRRHL 345
           +YE +R  L
Sbjct: 306 IYENLRHWL 314

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 80.1 bits (196), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 91/203 (44%), Gaps = 13/203 (6%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           VS   +F+AG G     AV V NP E+VK R+Q Q    A  Q+ YRN  QA  +I K E
Sbjct: 21  VSKVGSFIAG-GLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNE 79

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY-------HGSQNLPSWETSLIGL 265
           G+  L RG+      Q    G+    Y  +   L +        H  QN+    T+  G 
Sbjct: 80  GVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTA--GA 137

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLV---QEEGFRALYKGITP 322
            SG IG    +PL  +KTR+Q   +   +      T++   L    ++EG   L++G+  
Sbjct: 138 TSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDA 197

Query: 323 RVMRVAPGQAVTFTVYEFVRRHL 345
            ++R   G +V   +Y   +  L
Sbjct: 198 AILRTGAGSSVQLPIYNTTKNFL 220

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 90/208 (43%), Gaps = 29/208 (13%)

Query: 25  IGARRRSVADPCSAVCQQ---PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTI 81
           +   R    +P   V  +   P  D H    K  N AVN+ AG T+G+  A+   PL  +
Sbjct: 98  LNGSRLGFYEPIRTVLNKTFFPESDPH----KLQNVAVNVTAGATSGIIGAIVGSPLFLV 153

Query: 82  KVRMQIYRRA---NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSY 138
           K RMQ Y  A    E T         A I+  EG+L  ++G+ A ++      +++   Y
Sbjct: 154 KTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIY 213

Query: 139 EFYRTLLADRQTGVVSTGNTF------LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGA 192
              +  L   Q  ++  G         + G+G G+     V+NP +VV  R+  Q     
Sbjct: 214 NTTKNFLL--QNDIMKEGTALHLLSSTVTGLGVGI-----VMNPWDVVLTRVYNQ----- 261

Query: 193 AEQQKYRNAIQAAYLIVKEEGIGALYRG 220
            +   Y+  I   +  +K EGIGALY+G
Sbjct: 262 -KGNTYKGPIDCMFKTIKIEGIGALYKG 288

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 128/312 (41%), Gaps = 33/312 (10%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI---YRRANEGTKPPGFLR 102
           ++  S+ +  +   + +AGG A        +P + +K RMQ+       N+      F  
Sbjct: 12  EHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQA 71

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-------ADRQTGVVST 155
            G  I+  EG+    +GL +  +  I     R   YE  RT+L       +D    + + 
Sbjct: 72  LGV-IFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHK-LQNV 129

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGI 214
                AG  +G+  A+ V +P+ +VK R+Q+  +     EQ  Y +       I K+EG+
Sbjct: 130 AVNVTAGATSGIIGAI-VGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGV 188

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI---- 270
             L+RGV     R          +Y+     L      QN    E + + L+S  +    
Sbjct: 189 LGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLL-----QNDIMKEGTALHLLSSTVTGLG 243

Query: 271 -GPFSNAPLDTIKTRL--QKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRV 327
            G   N P D + TR+  QK  + +   + +  T      ++ EG  ALYKG   ++ R+
Sbjct: 244 VGIVMN-PWDVVLTRVYNQKGNTYKGPIDCMFKT------IKIEGIGALYKGFGAQLFRI 296

Query: 328 APGQAVTFTVYE 339
           AP   +  T  E
Sbjct: 297 APHTILCLTFME 308

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 129/292 (44%), Gaps = 35/292 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQI--YRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           ++   +AG+ E    HP+DTI  R+     + A+         R  A+   G  LL+ + 
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFP 73

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVS------TGNTF---LAGVGAGVTE 169
           GLG      I +   ++    F    L     G         TG       AG   G+ E
Sbjct: 74  GLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGE 133

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
            VL+  P++V+KI+ Q        E  K R  ++    I+K+EG G LYRG   TAAR A
Sbjct: 134 IVLL--PLDVLKIKRQTN-----PESFKGRGFLK----IIKDEGFG-LYRGWGWTAARNA 181

Query: 230 TNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGPF-SNAPLDTIKTRL 285
               A F    ++K  +  L++Y  +    +W  + +  + GA      +APLD IKTR+
Sbjct: 182 PGSFALFGGNAFAKEYILGLKDYGQA----TWSQNFVSSIVGASASLIVSAPLDVIKTRI 237

Query: 286 QKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
           Q     RN  N      I +  ++ EGF A +KG+TP+++   P    +F +
Sbjct: 238 Q----NRNFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFAL 285

 Score = 36.2 bits (82), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 84/211 (39%), Gaps = 34/211 (16%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG---- 215
           L    AG+ E + V +P++ +  RL + H   A+  Q   N++   +     E +G    
Sbjct: 15  LGSASAGILE-IGVFHPVDTISKRLMSNHTKIASTSQ--LNSV--IFRDFASEPLGRRLL 69

Query: 216 ALYRGVSLTAARQA------------TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI 263
           +L+ G+   AA +              N+  N        +   E  G     +   SLI
Sbjct: 70  SLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLI 129

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G     IG     PLD +K + Q +  +     +++I       +++EGF  LY+G    
Sbjct: 130 G-----IGEIVLLPLDVLKIKRQTNPESFKGRGFLKI-------IKDEGF-GLYRGWGWT 176

Query: 324 VMRVAPGQAVTFTVYEFVRRHLEGLGLFGSA 354
             R APG    F    F + ++ GL  +G A
Sbjct: 177 AARNAPGSFALFGGNAFAKEYILGLKDYGQA 207

>Kwal_34.15907
          Length = 312

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 133/299 (44%), Gaps = 43/299 (14%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCC-HPLDTIKVRMQIYRRANEGTKPPGFLRT 103
           P      KK      N++ G    L EA     PL+ IK  M   R  N       F ++
Sbjct: 5   PTQPAELKKKPVSFSNILLGAGLNLCEATTLGQPLEVIKTTMAANRNLN-------FGQS 57

Query: 104 GANIYSGEGLLAFYKGL-----------GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV 152
             +++S  G+  FY+GL           GAV++ +  +     + Y+F R  L +   G+
Sbjct: 58  VKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAE-----AEYQFKRLGLGNFGAGI 112

Query: 153 VSTGNTFLAGVGAGVTEAVLVV---NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIV 209
                  + GV  GV +A L +     M+ V+I      + GA  Q  +     A   I 
Sbjct: 113 -------MGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSW----SAFKEIY 161

Query: 210 KEEGIGALYRGVSLTAARQATNQGANFTVYSKLMER-LQEYHGSQNLPSWETSLIGLVSG 268
            +EGI  + +GV+  A RQ TN G+ F + S+L+E+ ++++ G  N     T+L  + + 
Sbjct: 162 SKEGIKGINKGVNAVAIRQMTNWGSRFGL-SRLVEQGIRDFTGKTNPDDKLTALEKIFAS 220

Query: 269 AIG---PFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
           A+G      N P++ I+  +Q  K   N    + + +  + + Q  G + LY+G+ PR+
Sbjct: 221 ALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLYRGVAPRI 279

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 93/203 (45%), Gaps = 13/203 (6%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           +S   +F+AG G     AV V NP+E++KIR+Q Q    A+  + Y+N IQ   +I K E
Sbjct: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERL-------QEYHGSQNLPSWETSLIGL 265
           GI  L +G++     Q    G+    Y  +   L       QE H  Q++     S  G 
Sbjct: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFS--GA 136

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLV---QEEGFRALYKGITP 322
            SG IG    +PL  +KTRLQ       +      T +   LV   + EG + L++GI  
Sbjct: 137 ASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196

Query: 323 RVMRVAPGQAVTFTVYEFVRRHL 345
            ++R   G +V   +Y   +  L
Sbjct: 197 AILRTGAGSSVQLPIYNTAKNIL 219

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 119/297 (40%), Gaps = 31/297 (10%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY----RRANEGTKPPGFLRTGANIYSGEGLLA 115
           + VAGG A        +P++ IK+RMQ+       A +  K P  ++  A I+  EG+  
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP--IQGMAVIFKNEGIKG 82

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----ADRQ-TGVVSTGNTFLAGVGAGVTE 169
             KGL A  I  I     R   YE  R+ L      D++   V S G    +G  +G+  
Sbjct: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIG 142

Query: 170 AVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
           AV + +P+ +VK RLQ+        EQ  Y         I K EG+  L+RG+     R 
Sbjct: 143 AV-IGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201

Query: 229 ATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288
                    +Y+     L +    ++ P+   +   +    +    N P D I TR+   
Sbjct: 202 GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMN-PWDVILTRIYNQ 260

Query: 289 KST------RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           K          L   VRI          EG  ALYKG   +V R+AP   +  T  E
Sbjct: 261 KGDLYKGPIDCLVKTVRI----------EGVTALYKGFAAQVFRIAPHTIMCLTFME 307

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (41%), Gaps = 12/211 (5%)

Query: 37  SAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYR---RANE 93
           S++ Q  +PD      K  +  VN+ +G  +G+  A+   PL  +K R+Q Y    +  E
Sbjct: 110 SSLNQLFFPDQE--PHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGE 167

Query: 94  GTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVV 153
            T   G       I+  EG+   ++G+ A ++      +++   Y   + +L        
Sbjct: 168 QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKD 227

Query: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG 213
                  A   +G+  AV V+NP +V+  R+  Q      +   Y+  I      V+ EG
Sbjct: 228 GPALHLTASTISGLGVAV-VMNPWDVILTRIYNQ------KGDLYKGPIDCLVKTVRIEG 280

Query: 214 IGALYRGVSLTAARQATNQGANFTVYSKLME 244
           + ALY+G +    R A +     T   + M+
Sbjct: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 129/310 (41%), Gaps = 28/310 (9%)

Query: 41  QQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGF 100
           QQP P    S        +  V+G  +G+ +    HP DTIKVR+Q    + + T+  G 
Sbjct: 50  QQPPPSEAYSR------IMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDSTRFKGP 100

Query: 101 LRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGN 157
           L      ++ +G+  FY G    ++G I   ++       YR LL          +    
Sbjct: 101 LDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSG 160

Query: 158 TFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
             ++GV AG + +  +  P+E+ K +LQ Q+    A+  KY   +     +    G+  L
Sbjct: 161 CIISGVMAGWSVS-FIAAPVELAKAKLQVQY---DAKTTKYTGPVDVIKKVYSSNGVRGL 216

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN--LPSWETSLIGLVSGAIGPFSN 275
           Y+G++ T   + TN    +  Y  L    +E+    +  +  W     G  S + G ++ 
Sbjct: 217 YKGLTSTLIFR-TNFVFWWGSYELLTRWFKEHTNMSDTAINFWS----GGFSASFGFWTT 271

Query: 276 A-PLDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           A P D IK   L  DK      +W       + + +  G+R  +KG  P  +R  P  A 
Sbjct: 272 AYPSDVIKQVVLCNDKYDGTFRSW---KLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAA 328

Query: 334 TFTVYEFVRR 343
               +EFV R
Sbjct: 329 ALAAFEFVLR 338

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 127/313 (40%), Gaps = 39/313 (12%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYKG 119
            +AGG  G+      H LDT+K R Q    A    K    L+    ++  EG     Y G
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQ---GAPNVHKYKHMLQAYRTMFIEEGFRRGLYGG 113

Query: 120 LGAVVIGIIPKMAIRFSSYEFY-RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
             A ++G  P  AI FS+YEF  RT++ D       T +   AG       + + V P E
Sbjct: 114 YCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLN--DTFSHLTAGFLGDFFSSFVYV-PSE 170

Query: 179 VVKIRLQAQ------HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232
           V+K RLQ Q      H +     +  RNAI   Y   + EG+ AL+ G   T AR     
Sbjct: 171 VLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIY---RTEGVAALFFGYKATLARDLPFS 227

Query: 233 GANFTVYSK------LMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
              F  Y K      L+E    Y    +L      + G  +G +      PLD +KTR+Q
Sbjct: 228 ALQFAFYEKFRQWAFLLEGKDIY--KHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQ 285

Query: 287 ----------KDKSTRNLSNWVRITT----IGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
                      D   +N+S  V +T       R +   EGF   + G+ PR +  +   +
Sbjct: 286 TQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVGPRFVWTSVQSS 345

Query: 333 VTFTVYEFVRRHL 345
           +   +Y+   R L
Sbjct: 346 IMLLLYQMALRVL 358

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 253 QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG 312
           ++ P W   L G V G IG  +   LDT+KTR Q      N+  +  +    R +  EEG
Sbjct: 49  EHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ---GAPNVHKYKHMLQAYRTMFIEEG 105

Query: 313 F-RALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           F R LY G    ++   P  A+ F+ YEF +R
Sbjct: 106 FRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKR 137

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 16/152 (10%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGF----L 101
           D H++   S     +L AG     F +    P + +K R+Q+    N      G+    L
Sbjct: 142 DYHLNDTFS-----HLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSL 196

Query: 102 RTG-ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRT---LL--ADRQTGVVST 155
           R   A IY  EG+ A + G  A +   +P  A++F+ YE +R    LL   D     +S 
Sbjct: 197 RNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSI 256

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ 187
            N  + G  AG    +L   P++VVK R+Q Q
Sbjct: 257 SNEIVTGACAGGLAGILTT-PLDVVKTRVQTQ 287

>Kwal_47.19228
          Length = 281

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 112/276 (40%), Gaps = 46/276 (16%)

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT--GVVSTGNTFLAGVGAGVTEA 170
           L  ++ G  A+ +G + K A RF++++    LL D +   G +S      AGV  G  E+
Sbjct: 5   LKVYFAGCSALNVGTLLKTATRFTTFDRACQLLHDPENPNGTISGPRLLAAGVITGFMES 64

Query: 171 VLVVNPMEVVKIRL-------------------------------QAQHLHGAAEQQKY- 198
           +LV+ P E +K  +                               Q + LH   +   Y 
Sbjct: 65  LLVI-PFENIKTTMIENALLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWALYY 123

Query: 199 -----RNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQ 253
                R  +     I +  GI    +G   T  RQ +N    FT Y+ L + +     ++
Sbjct: 124 DEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISP---NK 180

Query: 254 NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGF 313
            L  +    +G +S         P+D IKTR+Q   S    SN+        ++  EEGF
Sbjct: 181 PLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQ---SKYTWSNYKNSLNCAYRIFVEEGF 237

Query: 314 RALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLG 349
              +KG  PR+M+V     V+F VY++V   ++ + 
Sbjct: 238 TKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVN 273

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 72/156 (46%), Gaps = 8/156 (5%)

Query: 100 FLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTF 159
           FL T   IY   G+  F +G    +I      A+RF++Y   + +++  +   ++    F
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKP--LNEYYAF 188

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
             G  +     V V  P++V+K R+Q+++         Y+N++  AY I  EEG    ++
Sbjct: 189 ALGFISSCA-VVAVTQPIDVIKTRMQSKYTWS-----NYKNSLNCAYRIFVEEGFTKFWK 242

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNL 255
           G +    +   + G +F VY  +   ++  +G Q +
Sbjct: 243 GWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQEM 278

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 139/323 (43%), Gaps = 44/323 (13%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +AGG +G        PLD IK+  Q      +       G      +I+  +G+  F++G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
               ++ I P  A++F +YE  R++L   +    S      +G  AG+  +V +  P+++
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQIRSILIPSRE-YESHWRRLASGSLAGLC-SVFITYPLDL 140

Query: 180 VKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA-------------LYRGVSLTAA 226
            ++RL     H   ++ K R+ ++  Y     EG+ +              YRG   T  
Sbjct: 141 TRVRLAYVTEH---KRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVL 197

Query: 227 RQATNQGANFTVY--------SKLM-----------ERLQEYHGSQNLP--SWETSLIGL 265
                 G +F  +        S LM           E L+     Q  P  +W   + G 
Sbjct: 198 GMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGG 257

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDK-STRNLSN--WVRITTIGRQLVQEEGFRALYKGITP 322
           +SG +   +  PL+ I+ RLQ    S R + +  +  I++I R + QE+G+R  + G++ 
Sbjct: 258 LSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSI 317

Query: 323 RVMRVAPGQAVTFTVYEFVRRHL 345
             ++V P  A +F VYE ++ HL
Sbjct: 318 GYIKVTPMVACSFFVYERMKWHL 340

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 88/222 (39%), Gaps = 38/222 (17%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLA----- 115
           L +G  AGL      +PLD  +VR+  Y   ++  K    ++T  +  + EGL +     
Sbjct: 121 LASGSLAGLCSVFITYPLDLTRVRLA-YVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVP 179

Query: 116 --------FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD-------------------- 147
                   FY+G    V+G+IP   + F +++    ++                      
Sbjct: 180 KWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERK 239

Query: 148 --RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLH-GAAEQQKYRNAIQA 204
             RQ   + T    +AG  +G+        P+E+++ RLQ   L        K+++    
Sbjct: 240 KLRQKTPLRTWAELVAGGLSGILSQT-AAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSI 298

Query: 205 AYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL 246
           A +I +E+G    + G+S+   +       +F VY ++   L
Sbjct: 299 ARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 260 TSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS--TRNLSNWVRITTIGRQLVQEEGFRALY 317
           + L G VSG+      APLD IK   Q      ++   + V +    + +   +G R  +
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 318 KGITPRVMRVAPGQAVTFTVYEFVR 342
           +G +  ++R+ P  AV F  YE +R
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIR 105

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 122/305 (40%), Gaps = 29/305 (9%)

Query: 47  NHMSSKKS--TNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL--- 101
           N +S  KS  T    +L AGG  G+   L  HP D +KVR Q  +  +        L   
Sbjct: 16  NDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAA 75

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD------RQTGVVST 155
           R  A   S   +  FYKG+   ++G+ P  A+ F  Y+  + L+             V  
Sbjct: 76  RQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEP 135

Query: 156 GNTFLAGVGAGVTEAV---LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
             T      AG   A+   LV  P E VK+ LQ          Q   + + AA  IV+ +
Sbjct: 136 ELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQT--------TQGKASFLDAAKQIVRTQ 187

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY--HGSQNLPSWETSLIGLVSGAI 270
           G  +L++G   T +R        F  Y    E L +   H S  L      + G ++G  
Sbjct: 188 GFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVS 247

Query: 271 GPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
                 P+DT+KT+LQ     +++    R+    R      G +  + G+ P ++R  P 
Sbjct: 248 MWVVVFPIDTVKTQLQSSSKRQSMLEVTRMIYNTRG-----GIKGFFPGVGPAILRSFPA 302

Query: 331 QAVTF 335
            A TF
Sbjct: 303 NAATF 307

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 24/200 (12%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL-- 217
           LA  G G   AVL  +P ++VK+R Q+     A +     + +QAA        + A+  
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMD--AVSHILQAARQAAGPTSLNAVRG 89

Query: 218 -YRGV-----SLTAARQATNQGANFTVYSKLMERLQEYHGSQ------NLPSWETSLIGL 265
            Y+GV      +T     +  G  + V  KL+  +     S        L   + +  G 
Sbjct: 90  FYKGVVPPLLGVTPIFAVSFWG--YDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVM 325
           +S        AP + +K  LQ  +   +  +        +Q+V+ +GF++L+KG    + 
Sbjct: 148 ISAIPTTLVTAPTERVKVVLQTTQGKASFLD------AAKQIVRTQGFQSLFKGSLATLS 201

Query: 326 RVAPGQAVTFTVYEFVRRHL 345
           R  PG A+ F  YE  + +L
Sbjct: 202 RDGPGSALYFASYEICKEYL 221

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 141/352 (40%), Gaps = 91/352 (25%)

Query: 54  STNPAV--NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE 111
            TNP++  NL+AG  A +F+    HP + +K   Q++R                N++   
Sbjct: 3   DTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAE--------AFNMF--H 52

Query: 112 GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT--GVVSTGNTFLAGVGAGVTE 169
            + +++ G  A+ IGI+ K A RF++++    LL D +     VS      AG   G  E
Sbjct: 53  HVKSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFME 112

Query: 170 AVLVVNPMEVVKIRL-----------------------QAQHLHGAAEQQKYR------- 199
           ++L++ P E +K R+                       +++ ++    +++ R       
Sbjct: 113 SMLII-PFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQV 171

Query: 200 --------------------NAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 239
                               N       +V+  G    ++G   T  RQ  N    FT Y
Sbjct: 172 KKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTY 231

Query: 240 SKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA-------PLDTIKTRLQKDKS-- 290
           + L + +     S N P  E    G     IG FS+        P+D +KTR+Q   +  
Sbjct: 232 TTLKQMI-----SPNKPLSEYYAFG-----IGVFSSCAVVALTQPIDVVKTRMQSKYTWS 281

Query: 291 -TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
             RN  N V  T I      EEG  +L+KG  PR+ +V     V+F VY++V
Sbjct: 282 LYRNSLNCVYRTFI------EEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 135/306 (44%), Gaps = 39/306 (12%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVR-MQIYRRANEGTKPPG-FLRTGAN 106
           MS+ K  +    ++   +AG+ E    HP+DTI  R M  + +    ++      R  A 
Sbjct: 1   MSNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAA 60

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTF------- 159
               + +   + GLG      I +   ++    F    L   +       NTF       
Sbjct: 61  EPLSKRVFTLFPGLGYAATYKILQRVYKYGGQPFANEFL--NRNFKADFDNTFGEKTGKA 118

Query: 160 ----LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG 215
                AG   G+ E VL+  P++V+KI+ Q        E  K R  ++    I+K+EG+G
Sbjct: 119 LRSATAGSMIGIGEIVLL--PLDVLKIKRQTN-----PEAFKGRGFVK----ILKDEGLG 167

Query: 216 ALYRGVSLTAARQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGP 272
            LYRG   TAAR A    A F    ++K  +  L++Y  +    +W  + +  + GA   
Sbjct: 168 -LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQA----TWSQNFVSSIVGASAS 222

Query: 273 FS-NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
              +APLD IKTR+Q     +N  N     TI +  ++ EGF A +KG+TP+++   P  
Sbjct: 223 LIISAPLDVIKTRIQ----NKNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKL 278

Query: 332 AVTFTV 337
             +F +
Sbjct: 279 VFSFAL 284

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 80/209 (38%), Gaps = 42/209 (20%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           L    AG+ E + V +P++ +  RL + H        K  ++ Q   +I +E     L +
Sbjct: 14  LGSASAGILE-IGVFHPVDTISKRLMSNH-------TKIGSSSQLNSVIFREHAAEPLSK 65

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHG--------SQNLPSWETSLIGLVSG--- 268
            V           G  +    K+++R+ +Y G        ++N  +   +  G  +G   
Sbjct: 66  RVFTLFP------GLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKAL 119

Query: 269 ---------AIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319
                     IG     PLD +K + Q +        +V+I       +++EG   LY+G
Sbjct: 120 RSATAGSMIGIGEIVLLPLDVLKIKRQTNPEAFKGRGFVKI-------LKDEGL-GLYRG 171

Query: 320 ITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
                 R APG    F    F + ++ GL
Sbjct: 172 WGWTAARNAPGSFALFGGNAFAKEYILGL 200

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 133/312 (42%), Gaps = 27/312 (8%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           ++H+   ++ +    +VAG  +GL       P+DT+K+R Q+ + A+E  K  G L T  
Sbjct: 13  EDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQL-QLASEH-KYHGILHTFR 70

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGA 165
            +   EG+ A +KG        +   +++F +Y +  T  A    G+    ++   G  A
Sbjct: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNT--AAASAGLPPQAHSLAVGALA 128

Query: 166 GVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
           G+  ++L   P+++++ RL A           + +  + A +I   EG    +RG +   
Sbjct: 129 GLVSSLLTY-PLDLLRTRLVAN------RSAHFFSLRRQARVIWDTEGPAGFFRGGAWAI 181

Query: 226 ARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRL 285
           A      G  F +Y         Y     LP W  +     +G +   +  PLDT++ RL
Sbjct: 182 AATTLTTGLIFGIYETCTIAADTY----GLP-WLAAAASPTAGLVSKAAVFPLDTVRRRL 236

Query: 286 Q-----------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334
           Q           +D    +     R   +   +V+ EG  +LYKG+T  + +  P   +T
Sbjct: 237 QIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVIT 296

Query: 335 FTVYEFVRRHLE 346
             VY+   R LE
Sbjct: 297 LWVYQRCLRLLE 308

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 91/212 (42%), Gaps = 25/212 (11%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           A +L  G  AGL  +L  +PLD ++ R+   R A+  +      R    I+  EG   F+
Sbjct: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS----LRRQARVIWDTEGPAGFF 174

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVG---AGVTEAVLVV 174
           +G    +        + F  YE   T+ AD      + G  +LA      AG+      V
Sbjct: 175 RGGAWAIAATTLTTGLIFGIYETC-TIAAD------TYGLPWLAAAASPTAGLVSKA-AV 226

Query: 175 NPMEVVKIRLQ---AQHLH------GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
            P++ V+ RLQ   A+H+       GA    +    +  A  +V+ EGI +LY+G+++  
Sbjct: 227 FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286

Query: 226 ARQATNQGANFTVYSKLMERLQEYHGSQNLPS 257
            +          VY + + RL E   +  LP+
Sbjct: 287 CKSTPTTVITLWVYQRCL-RLLEPTRAPQLPA 317

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 121/282 (42%), Gaps = 33/282 (11%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I +GEG  A   G G  ++G   + A
Sbjct: 37  PIDVVKTRIQLEPTVYNK--------GMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGA 88

Query: 133 IRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189
            +F  YE ++    D     T      + ++         A + + P+E  +IRL     
Sbjct: 89  FKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL----- 143

Query: 190 HGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
                Q ++ N +   +  I+KEEGIG+ Y G +    +Q     A F V+ +  E    
Sbjct: 144 ---VSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYG 200

Query: 249 YHG-SQNLPSWETSLIGLVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITTI 303
           + G  + L S  T+L+ L+SG     + A    P DT+ +++ K K     S    +  +
Sbjct: 201 FAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQL 260

Query: 304 GRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            +QL    GF   + G+  R++ V    ++ F +Y  ++  L
Sbjct: 261 AKQL----GFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTL 298

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 77/188 (40%), Gaps = 25/188 (13%)

Query: 160 LAG-VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGAL 217
           LAG +G G T + +V  P++VVK R+Q        E   Y   +  ++  I+  EG GAL
Sbjct: 22  LAGAIGCGSTHSSMV--PIDVVKTRIQL-------EPTVYNKGMVGSFKQIIAGEGAGAL 72

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF---- 273
             G   T    +      F  Y    +   +  G      ++ S+  + S A+  F    
Sbjct: 73  LTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVY-MGSAAMAEFLADI 131

Query: 274 SNAPLDTIKTRLQKDKSTRN--LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
           +  PL+  + RL       N  +  + RI       ++EEG  + Y G TP + +  P  
Sbjct: 132 ALCPLEATRIRLVSQPQFANGLVGGFSRI-------LKEEGIGSFYSGFTPILFKQIPYN 184

Query: 332 AVTFTVYE 339
              F V+E
Sbjct: 185 IAKFLVFE 192

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 266 VSGAIGPFSN----APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
           ++GAIG  S      P+D +KTR+Q + +  N           +Q++  EG  AL  G  
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF----KQIIAGEGAGALLTGFG 77

Query: 322 PRVMRVAPGQAVTFTVYE-FVRRHLEGLG 349
           P ++  +   A  F  YE F +  ++ LG
Sbjct: 78  PTLLGYSIQGAFKFGGYEVFKKFFIDNLG 106

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG 99
           P   +SS  +T   +NL++G TAGL  A+   P DT      +  + N+  K PG
Sbjct: 204 PKEKLSSTSTT--LLNLLSGLTAGLAAAIVSQPADT------LLSKVNKTKKAPG 250

>Scas_687.15*
          Length = 328

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 138/329 (41%), Gaps = 56/329 (17%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K T+  + ++AG  A +FE    +P + +K   Q++RR   G KP   LR          
Sbjct: 4   KQTDVPIQILAGSAAAVFETTLTYPFEFLKTGFQLHRR-TVGAKPFEALRP--------- 53

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTE 169
           +  ++ G  A+ +  I K ++RF++++    +L D    +  ++      LAG+  G  E
Sbjct: 54  IKVYFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVE 113

Query: 170 AVLVVNPMEVVKIRLQAQHL----------------------HGA-----AEQQKYRNAI 202
           ++ ++ P E VK+ +    L                      H A     + Q+++R   
Sbjct: 114 SLCII-PFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVY 172

Query: 203 QA-----AYLIVKE----EGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQ 253
                   + +VKE     G+    +G   T  RQ +N    FT Y+ L + +     +Q
Sbjct: 173 SKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISP---TQ 229

Query: 254 NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGF 313
            L       IGL S         P+D +KTR+Q   +     N +       ++  EEG 
Sbjct: 230 PLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSL---NCAYRVFVEEGM 286

Query: 314 RALYKGITPRVMRVAPGQAVTFTVYEFVR 342
            +L+KG  PR+ +V     ++F VY++V 
Sbjct: 287 VSLWKGWLPRLFKVGLSGGISFGVYQYVE 315

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 148/346 (42%), Gaps = 48/346 (13%)

Query: 42  QPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ------IYRRANEG- 94
           QP  + H    K+  P V+ +AGG  G+  A+   P D +K R+Q      +Y+   E  
Sbjct: 45  QPKLEVH----KTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEAL 100

Query: 95  ----TKP----------PGFLRTGA---NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSS 137
               T+P            F  T +   N+Y  EG  + +KGLG  ++G+IP  +I F +
Sbjct: 101 MMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFT 160

Query: 138 YEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQK 197
           Y   + + +             L              NP+ +VK R+Q   L  A + + 
Sbjct: 161 YGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQ---LDKAGKTRT 217

Query: 198 YRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA-NFTVYSKLMERLQ----EYHGS 252
           Y+N+      I++ EGI  LYRG  L+A+   + +G   + +Y +L   ++    E  G+
Sbjct: 218 YKNSYDCLKSILRNEGIYGLYRG--LSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGA 275

Query: 253 QN---------LPSWETSLIGL-VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITT 302
            +         +  W     G  ++  +      P + ++TRL++         +  +  
Sbjct: 276 HDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQ 335

Query: 303 IGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
             R +++EEG  ++Y G+TP +MR  P   + F  +E V + L  +
Sbjct: 336 SFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI 381

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 122/294 (41%), Gaps = 35/294 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQ-------------IYRRANEGTKPPGFLRTGANI 107
           LVAGG  G+   L  HP D IKVR Q             I + A   +   G L T  ++
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTT--SL 82

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT--GVVSTGNTFLAGVGA 165
           +    +  FYKG+   +IG+ P  A+ F  Y+  + L+  +Q     ++T     AG  +
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFIS 142

Query: 166 GVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNA-IQAAYLIVKEEGIGALYRGVSLT 224
            +    LV  P E +K+ LQ           +++ + I+AA  IV   G+ +L+ G   T
Sbjct: 143 AI-PTTLVTAPTERIKVVLQT--------NSEFKGSFIKAAKHIVSTGGVKSLFNGSLAT 193

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGP---FSNAPLDTI 281
            AR        F  Y      L +    ++      + + L  G  G        P+DTI
Sbjct: 194 LARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTI 253

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
           KTRLQ   +  ++     +       +Q  G +  + G+ P ++R  P  A TF
Sbjct: 254 KTRLQVATTPISM-----VQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATF 302

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG 110
            K   N A   +AGG AG+   L   P+DTIK R+Q+       T P   ++   +IY  
Sbjct: 223 DKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQV------ATTPISMVQATKDIYIQ 276

Query: 111 E-GLLAFYKGLGAVVIGIIPKMAIRFSSYEF 140
             G+  F+ GLG  ++   P  A  F   E 
Sbjct: 277 RGGIKGFFPGLGPALLRSFPANAATFLGVEL 307

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 76/203 (37%), Gaps = 35/203 (17%)

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE------------ 211
           G G   AVL  +P +++K+R Q+          + ++ + A  +I+KE            
Sbjct: 29  GVGGVCAVLTGHPFDLIKVRCQSN---------QAKSTMDAVSIILKEARSLSTVNGSLT 79

Query: 212 ------EGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLP--SWETSLI 263
                   +   Y+GV             +F  Y  + +RL  +  + + P  + + +  
Sbjct: 80  TSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYD-IGKRLVTWKQASDAPLTTAQMATA 138

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G +S        AP + IK  LQ +   +            + +V   G ++L+ G    
Sbjct: 139 GFISAIPTTLVTAPTERIKVVLQTNSEFKG-----SFIKAAKHIVSTGGVKSLFNGSLAT 193

Query: 324 VMRVAPGQAVTFTVYEFVRRHLE 346
           + R  PG A+ F  YE  +  L 
Sbjct: 194 LARDGPGSALYFASYELSKAFLN 216

>Kwal_23.3965
          Length = 307

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 143/326 (43%), Gaps = 46/326 (14%)

Query: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105
           ++H+   +      +LVAG  +G+   +   PLDT+K+R+Q+ + ANE  +  G L T  
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL-QLANEA-QYGGILVTFK 60

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT-GVVSTGNTFLAGVG 164
            +   EG+ A +KG    +   I   + +F+SY     LL+  Q    + TG   + G  
Sbjct: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGAL 117

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224
           +G   A+    P +V++ R  A H       ++    +  A  I + EG    ++GVS +
Sbjct: 118 SGTCSAI-ASYPCDVLRTRFIANH------SRELSTMLSTAQEIWRHEGFRGFFKGVSSS 170

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGL-------VSGAIGPFSNAP 277
               A    +    Y    E ++ +   +  P  ++S+I L       ++G +      P
Sbjct: 171 IVSIAVATSSILATY----ESVKIF--CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224

Query: 278 LDTIKTRLQ-----------------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
           +DT++ R Q                 K   +   +N++R+  +   +V++EG  ALY G 
Sbjct: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM---IVEKEGLLALYHGY 281

Query: 321 TPRVMRVAPGQAVTFTVYEFVRRHLE 346
           T  + +  P   V+  VYE+  R +E
Sbjct: 282 TLGIAKSVPSTVVSLGVYEWCLRRME 307

>Kwal_33.15446
          Length = 305

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 128/311 (41%), Gaps = 31/311 (9%)

Query: 49  MSSKKSTNPAV---------NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG 99
           MSS+  +N  V           V+G  +G+ +    HP DTIKVR+Q  +       P  
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGP-- 58

Query: 100 FLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD---RQTGVVSTG 156
            L         +G+  FY G    ++G I   ++       YR LL     +    +   
Sbjct: 59  -LDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLS 117

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
              L+GV AG + +  +  P+E+ K +LQ Q+    A+  +YR  +     +   +GI  
Sbjct: 118 GCILSGVLAGWSVS-FIAAPVELAKAKLQVQY---DAQTTRYRGPLDVIKKVYAADGIRG 173

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERL-QEYHGSQNLPSWETSLI-GLVSGAIGPFS 274
           +Y+G+  T   +      +F  +    E L + +  + NL     +   G  S + G ++
Sbjct: 174 MYKGLVSTLIFRT-----HFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWT 228

Query: 275 NA-PLDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
            A P D IK   L  DK   +L +W    +    + +  G R  +KG  P  +R  P  A
Sbjct: 229 TAYPSDVIKQVILCNDKYDGSLRSWRNAAS---DIWRTRGIRGFFKGFVPSFLRSFPANA 285

Query: 333 VTFTVYEFVRR 343
                +EFV R
Sbjct: 286 AALASFEFVLR 296

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 90/203 (44%), Gaps = 13/203 (6%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212
           VS   +F AG G     AV V NP+EVVKIR+Q Q    AA Q+ Y N  QA  ++ + E
Sbjct: 16  VSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNE 74

Query: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERL-------QEYHGSQNLPSWETSLIGL 265
           GI  L +G+      Q    G+    Y  +   +       QE H  Q++        G 
Sbjct: 75  GIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGI--NVFAGA 132

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG---RQLVQEEGFRALYKGITP 322
            SG IG    +PL  +KTRLQ   +   +      T +    + +   EG + L++GI  
Sbjct: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192

Query: 323 RVMRVAPGQAVTFTVYEFVRRHL 345
            ++R   G +V   +Y   +  L
Sbjct: 193 AILRTGAGSSVQLPIYNTAKNFL 215

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 114/293 (38%), Gaps = 23/293 (7%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQI---YRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           +  AGG A        +P++ +K+RMQ+      AN+      F   G  ++  EG+   
Sbjct: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV-VFRNEGIRGL 79

Query: 117 YKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADRQT-GVVSTGNTFLAGVGAGVTEA 170
            KGL A  I  I     R   YE       +T   D+++  V S G    AG  +G+  A
Sbjct: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139

Query: 171 VLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
           V+  +P+ +VK RLQ+  +     EQ  Y         I   EG+  L+RG+     R  
Sbjct: 140 VMG-SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTG 198

Query: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289
                   +Y+     L      ++ PS   +   +    +    N P D I TR+   K
Sbjct: 199 AGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMN-PWDVILTRIYNQK 257

Query: 290 STRN---LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                  +   V+   I       EG  ALYKG   +V R+ P   +  T  E
Sbjct: 258 GDLYKGPIDCLVKTVKI-------EGITALYKGFEAQVFRIGPHTILCLTFLE 303

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116
           P+++L A   +GL  A+  +P D I  R  IY +  +  K P  +         EG+ A 
Sbjct: 225 PSLHLTASTISGLGVAVVMNPWDVILTR--IYNQKGDLYKGP--IDCLVKTVKIEGITAL 280

Query: 117 YKGLGAVVIGIIPKMAIRFSSYE 139
           YKG  A V  I P   +  +  E
Sbjct: 281 YKGFEAQVFRIGPHTILCLTFLE 303

>Scas_562.12
          Length = 300

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 131/305 (42%), Gaps = 38/305 (12%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI--YRRANEGTKPPGFLRTGANI 107
           S+ +  +    L+   +AG+ E    HP+DTI  R+     +  N         R   + 
Sbjct: 3   SNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSE 62

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR-----------QTGVVSTG 156
             G+ L   + GLG      + +   ++    F    L              +TG     
Sbjct: 63  PLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRS 122

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
            T  AG   G+ E VL+  P++V+KI+ Q        E  K R  ++    I+K+EGI  
Sbjct: 123 AT--AGSLIGIGEIVLL--PLDVLKIKRQTN-----PEAFKGRGFVK----ILKDEGIFN 169

Query: 217 LYRGVSLTAARQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGA-IGP 272
           LYRG   TAAR A    A F    ++K  +  L++Y  SQ   SW  + I  + GA    
Sbjct: 170 LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDY--SQ--ASWSQNFISSIVGASCSL 225

Query: 273 FSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
             +APLD IKTR+Q     R+  N     TI +   + EG  A +KG+TP+++   P   
Sbjct: 226 IVSAPLDVIKTRIQ----NRSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLV 281

Query: 333 VTFTV 337
            +F +
Sbjct: 282 FSFAL 286

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 78/213 (36%), Gaps = 29/213 (13%)

Query: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL 207
           +Q+GV       L    AG+ E + V +P++ +  RL + H       +  R   +  + 
Sbjct: 7   KQSGVAR----LLGSASAGILE-IGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFS 61

Query: 208 IVKEEGIGALYRGVSLTAARQA------------TNQGANFTVYSKLMERLQEYHGSQNL 255
               + +  L+ G+   A+ +              N+  N            E  G    
Sbjct: 62  EPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMR 121

Query: 256 PSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRA 315
            +   SLIG     IG     PLD +K + Q +        +V+I       +++EG   
Sbjct: 122 SATAGSLIG-----IGEIVLLPLDVLKIKRQTNPEAFKGRGFVKI-------LKDEGIFN 169

Query: 316 LYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           LY+G      R APG    F    F + ++ GL
Sbjct: 170 LYRGWGWTAARNAPGSFALFGGNAFAKEYILGL 202

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 123/267 (46%), Gaps = 42/267 (15%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL-----------GAVV 124
            PL+ IK  M   R  +       F     +++S  G+  FY+GL           GAV+
Sbjct: 37  QPLEVIKTTMAANRSFS-------FFNAIKHVWSRGGVFGFYQGLIPWAWIEASTKGAVL 89

Query: 125 IGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVV---NPMEVVK 181
           + +  +     S Y+F R  L++  +G+       + GV  GV +A L +     M+ V+
Sbjct: 90  LFVSAE-----SEYQFKRMGLSNFGSGI-------MGGVTGGVAQAYLTMGFCTCMKTVE 137

Query: 182 IRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSK 241
           I  +     GA  Q  +  A +  Y   K++GI  + +GV+  A RQ TN G+ F  +S+
Sbjct: 138 ITKKKSAGAGAIPQSSW-GAFKEIY---KKDGIKGINKGVNAVAIRQMTNWGSRFG-FSR 192

Query: 242 LMER-LQEYHGSQNLPSWETSLIGLVSGAIG---PFSNAPLDTIKTRLQKDKSTRNLSNW 297
           L+E  ++   G  N     T+L  + + AIG      N P++ I+  +Q  K   N    
Sbjct: 193 LVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKN 252

Query: 298 VRITTIGRQLVQEEGFRALYKGITPRV 324
           + +++  + + Q  G + LY+G+ PR+
Sbjct: 253 LTVSSAFKYIYQSSGIKGLYRGVAPRI 279

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 128/305 (41%), Gaps = 27/305 (8%)

Query: 59  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           V  V+G  AG    +   PLD  K R+Q     +      G + T + I   EG+   YK
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYK 145

Query: 119 GLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL---VVN 175
           GL  +V+G  P   + FS YE  +     R    +  G  F++   + +T   +   + N
Sbjct: 146 GLAPIVLGYFPTWMLYFSVYEKCK----QRYPSYLPGG--FVSHAASALTAGAISTALTN 199

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGAN 235
           P+ VVK RL  Q    + +   YR+ + A   + + EG+   Y G+ + +     +   +
Sbjct: 200 PIWVVKTRLMIQS-DVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGL-VPSLFGLFHVAIH 257

Query: 236 FTVYSKL---MERLQEYHGSQNLPSWETSLIGLV-----SGAIGPFSNAPLDTIKTRLQK 287
           F VY KL   + R       Q L   +  L  L+     S  +      P + ++TR+Q 
Sbjct: 258 FPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQV 317

Query: 288 DKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL-- 345
             S    S    +  +GR +   EG+   Y G    ++R  P   +T   +E+ R++L  
Sbjct: 318 RHSGVPPS---LLNLLGR-IRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYLRM 373

Query: 346 --EGL 348
             EGL
Sbjct: 374 WNEGL 378

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 132/298 (44%), Gaps = 46/298 (15%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQ---------------IYRRANEGTKPPGFLRTGA 105
           L+   +AG+ E    HP+DTI  R+                I+R  +  ++P G  +   
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFR--DHFSEPLG--KRLF 69

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTL--LADRQTGVVSTGNTFLAGV 163
            ++ G G  A YK L  V        A  F +  + +    L   +TG         AG 
Sbjct: 70  TLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAA--AGS 127

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
             G+ E VL+  P++V+KI+ Q        E  K R  I+    I+++EG+  LYRG   
Sbjct: 128 LIGIGEIVLL--PLDVLKIKRQTN-----PESFKGRGFIK----ILRDEGLFNLYRGWGW 176

Query: 224 TAARQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGPF-SNAPLD 279
           TAAR A    A F    ++K  +  L++Y  +    +W  + I  + GA      +APLD
Sbjct: 177 TAARNAPGSFALFGGNAFAKEYILGLKDYSQA----TWSQNFISSIVGACSSLIVSAPLD 232

Query: 280 TIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
            IKTR+Q     RN  N      I +  ++ EG  A +KG+TP+++   P    +F +
Sbjct: 233 VIKTRIQ----NRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFAL 286

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 81/203 (39%), Gaps = 17/203 (8%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           L    AG+ E + V +P++ +  RL + H    + Q+  R   +  +     + +  L+ 
Sbjct: 15  LGSASAGIME-IAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFP 73

Query: 220 GVSLTAARQATNQ--------GANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIG 271
           G+   A+ +   +         AN  +     +      G +   +  ++  G + G IG
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIG-IG 132

Query: 272 PFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
                PLD +K + Q +  +     +++I       +++EG   LY+G      R APG 
Sbjct: 133 EIVLLPLDVLKIKRQTNPESFKGRGFIKI-------LRDEGLFNLYRGWGWTAARNAPGS 185

Query: 332 AVTFTVYEFVRRHLEGLGLFGSA 354
              F    F + ++ GL  +  A
Sbjct: 186 FALFGGNAFAKEYILGLKDYSQA 208

>Kwal_27.11626
          Length = 299

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 135/306 (44%), Gaps = 39/306 (12%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVR-MQIYRRANEGTKPPG-FLRTGAN 106
           MS+ K  +    ++   +AG+ E    HP+DT+  R M  + + +   +      R  A 
Sbjct: 1   MSNDKKQSGIARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAG 60

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----AD------RQTGVVST 155
              G+ L   + GLG      I +   ++    F    L     AD       +TG    
Sbjct: 61  EALGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALR 120

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG 215
             T  AG   G+ E VL+  P++V+KI+ Q        E  K R  I+    I+K+EG G
Sbjct: 121 SAT--AGSLIGIGEIVLL--PLDVLKIKRQTN-----PESFKGRGFIK----ILKDEGFG 167

Query: 216 ALYRGVSLTAARQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGP 272
            LYRG   TAAR A    A F    ++K  +  L++Y  +    +W  + +  + GA   
Sbjct: 168 -LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSSA----TWSQNFVSSIVGASAS 222

Query: 273 F-SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
              +APLD IKTR+Q     R+  N      I +  ++ EG  A +KG+TP+++   P  
Sbjct: 223 LIVSAPLDVIKTRIQ----NRHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKL 278

Query: 332 AVTFTV 337
             +F +
Sbjct: 279 VFSFAL 284

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 91/227 (40%), Gaps = 46/227 (20%)

Query: 148 RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL 207
           +Q+G+       L    AG+ E + V +P++ V  RL + H        K  ++ Q   +
Sbjct: 6   KQSGIARV----LGSASAGILE-IGVFHPVDTVSKRLMSNH-------TKISSSAQLNSV 53

Query: 208 IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG--------SQNLPSWE 259
           I +E      + G +L         G  +    K+++R+ +Y G        ++N  +  
Sbjct: 54  IFRE------HAGEALGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADF 107

Query: 260 TSLIGLVSG------------AIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL 307
            +  G  +G             IG     PLD +K + Q +  +     +++I       
Sbjct: 108 DNAFGEKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKI------- 160

Query: 308 VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGSA 354
           +++EGF  LY+G      R APG    F    F + ++ GL  + SA
Sbjct: 161 LKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSSA 206

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 137/306 (44%), Gaps = 39/306 (12%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI--YRRANEGTKPPGFLRTGAN 106
           MS+ +  +    +V   +AG+ E    HP+DTI  R+     +  N         R  A+
Sbjct: 1   MSNDQKQSGLARVVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHAS 60

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----AD------RQTGVVST 155
              G+ L   + GLG      I +   ++    F    L     AD       +TG    
Sbjct: 61  KPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALR 120

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG 215
             T  AG   G+ E VL+  P++V+KI+ Q        E  + R  ++    I+++EG+G
Sbjct: 121 SAT--AGSLIGIGEIVLL--PLDVLKIKRQTN-----PESFRGRGFLR----ILRDEGMG 167

Query: 216 ALYRGVSLTAARQATNQGANF--TVYSK-LMERLQEYHGSQNLPSWETSLIGLVSGAIGP 272
            LYRG   TAAR A    A F    ++K  +  L++Y  +    +W  + +  + GA   
Sbjct: 168 -LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQA----TWGQNFVSSIFGASAS 222

Query: 273 F-SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
              +APLD IKTR+Q    +RN  +     TI +  ++ EG  A +KG+TP+++   P  
Sbjct: 223 LIVSAPLDVIKTRIQ----SRNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKL 278

Query: 332 AVTFTV 337
             +F +
Sbjct: 279 VFSFAI 284

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 13/88 (14%)

Query: 261 SLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
           SLIG     IG     PLD +K + Q +  +     ++RI       +++EG   LY+G 
Sbjct: 126 SLIG-----IGEIVLLPLDVLKIKRQTNPESFRGRGFLRI-------LRDEGM-GLYRGW 172

Query: 321 TPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
                R APG    F    F + ++ GL
Sbjct: 173 GWTAARNAPGSFALFGGNAFAKEYILGL 200

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 92/203 (45%), Gaps = 13/203 (6%)

Query: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ-HLHGAAEQQKYRNAIQAAYLIVKE 211
           VS   +F+AG G     AV V NP + VK R+Q Q  LH  A  + Y N IQA  +I K 
Sbjct: 18  VSKFGSFVAG-GLAACIAVTVTNPFDCVKTRMQLQGELHANAA-KVYTNPIQAFGVIFKN 75

Query: 212 EGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGL------ 265
           EGI  L +G++     Q    G+    Y  +   L       N+ S +   IG+      
Sbjct: 76  EGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVF-YPNVESHKVQHIGINVAAGA 134

Query: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL---VQEEGFRALYKGITP 322
            SG +G F  +PL  +KTR+Q   +  ++      T+    L    + EG + L++G+  
Sbjct: 135 TSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDA 194

Query: 323 RVMRVAPGQAVTFTVYEFVRRHL 345
            ++R   G AV   +Y   +  L
Sbjct: 195 AMLRTGIGSAVQLPIYNICKNFL 217

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 128/314 (40%), Gaps = 27/314 (8%)

Query: 42  QPYPDNH--MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKP 97
           QP  + H   ++    +   + VAGG A        +P D +K RMQ+     AN     
Sbjct: 3   QPQEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVY 62

Query: 98  PGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD------RQTG 151
              ++    I+  EG+    KGL +  +  I     R   YE  R +L +          
Sbjct: 63  TNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHK 122

Query: 152 VVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQA--QHLHGAAEQQKYRNAIQAAYLIV 209
           V   G    AG  +GV  A  + +P+ +VK R+Q+    +H   +Q  Y +A      I 
Sbjct: 123 VQHIGINVAAGATSGVVGA-FIGSPLFLVKTRMQSYSNAIH-IGQQTHYTSAFNGLATIF 180

Query: 210 KEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA 269
           + EGI  L+RGV     R          +Y+     L ++    +L +  T L  L+S  
Sbjct: 181 RSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKH----DLMNDGTGL-HLLSST 235

Query: 270 IGPF----SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVM 325
           I  F    +  P D + TR+   K   NL +      I  + V+ EG  ALYKG   +++
Sbjct: 236 IAGFGVGVAMNPWDVVLTRVYNQKG--NLYSGPIDCFI--KTVRNEGLSALYKGFGAQIL 291

Query: 326 RVAPGQAVTFTVYE 339
           R+ P   +  T  E
Sbjct: 292 RIGPHTVLCLTFME 305

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 135/310 (43%), Gaps = 36/310 (11%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL------RTGANIYSGEGLL 114
           +++G +AG    L  HPLD +KVR+Q+   + +      F+      R+ AN  SG  + 
Sbjct: 13  VISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSAN--SGRSVT 70

Query: 115 -AFYKGLGAVVIGIIPKMAIRFSSY-----EFYRTLLADRQTGVVSTGNT--------FL 160
              Y+GL   + G      + F  Y       Y+++    +T +   GN           
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLS 130

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG 220
           AG  +G+  A+L  NP+ V+K R+ +             N +Q    +++ +G   L++G
Sbjct: 131 AGASSGLMTAILT-NPIWVIKTRIMSTSKGAQGAYTSMYNGVQQ---LLRTDGFQGLWKG 186

Query: 221 VSLTAARQATNQGA-NFTVYSKL----MERLQEYHGSQNLPSWETSLIGLVSGAIGPFSN 275
             L  A    +QGA  F VY  L    + R +E     +L + ET  I  +   +     
Sbjct: 187 --LVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLV 244

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
            P   +K+ LQ   S R      R+  + + ++  +GF  LYKG++  ++R  P   +TF
Sbjct: 245 YPFQLLKSNLQ---SFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITF 301

Query: 336 TVYEFVRRHL 345
            VYE ++  L
Sbjct: 302 CVYENLKHRL 311

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 121/268 (45%), Gaps = 45/268 (16%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL-----------GAVV 124
            PL+ +K  M   R+         F +   +I+S  G+  FY+GL           GAV+
Sbjct: 34  QPLEVVKTTMAANRQFT-------FFQAINHIWSRGGVFGFYQGLIPWAWIEASTKGAVL 86

Query: 125 IGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRL 184
           + +  +     + Y F       ++ G+ + G   + GV  GV +A L +     +K   
Sbjct: 87  LFVSAE-----AEYHF-------KKLGLNNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVE 134

Query: 185 QAQHLHGAAEQQKYRNAIQAAYLIVKE----EGIGALYRGVSLTAARQATNQGANFTVYS 240
             +H   AA       A Q+++   KE    EGI  + +GV+  A RQ TN G+ F  +S
Sbjct: 135 ITKHKSAAA------GAKQSSWAAFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFG-FS 187

Query: 241 KLMER-LQEYHGSQNLPSWETSLIGLVSGAIG---PFSNAPLDTIKTRLQKDKSTRNLSN 296
           +L+E  L+++ G  N     T+L  + + AIG      N P++ I+  +Q   +  N   
Sbjct: 188 RLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAWNQPIEVIRVEMQSKTNDPNRPK 247

Query: 297 WVRITTIGRQLVQEEGFRALYKGITPRV 324
            + +    R + Q  G + LY+G+TPR+
Sbjct: 248 DLTVGKAFRYIYQSNGVKGLYRGVTPRI 275

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 116/253 (45%), Gaps = 20/253 (7%)

Query: 74  CCHPLDTIKVRMQIYRRANE-GTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
              PL T+  RMQ+  +  E GT+    L     IY  EG++ FY GL + + G+    A
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGM---AA 89

Query: 133 IRFSSYEFY----RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH 188
              + Y FY    R  +  R +  ++T    L+   AG   A+   NP+ VV  R+    
Sbjct: 90  NSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAI-ASNPIWVVNTRMTV-- 146

Query: 189 LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
               +EQ    + +     IV+++G+ AL+ G+   A    +N    +TV+ +L   + +
Sbjct: 147 --AKSEQ----STLAVLLDIVRKDGVTALFNGLR-PALMLVSNPIIQYTVFEQLKNVVLK 199

Query: 249 YHGSQNL-PSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL 307
           + GS  L PSW   L+G V       S  P  T+KTR+   K   +      + ++   +
Sbjct: 200 WSGSDVLLPSW-AFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDI 258

Query: 308 VQEEGFRALYKGI 320
           V++EG + LY GI
Sbjct: 259 VKKEGIQGLYHGI 271

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 74/168 (44%), Gaps = 13/168 (7%)

Query: 56  NPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLA 115
           N +  +++   AG   A+  +P+  +  RM +  ++ + T     L    +I   +G+ A
Sbjct: 115 NTSEAILSSAVAGSMTAIASNPIWVVNTRMTV-AKSEQST-----LAVLLDIVRKDGVTA 168

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYE-FYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVV 174
            + GL   ++ ++    I+++ +E     +L    + V+     FL G   G   A    
Sbjct: 169 LFNGLRPALM-LVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFLLG-AVGKLAATGST 226

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGV 221
            P   +K R+   HL    E    + ++ +  + IVK+EGI  LY G+
Sbjct: 227 YPYITLKTRM---HLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGI 271

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 74.3 bits (181), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 130/307 (42%), Gaps = 24/307 (7%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104
           P N + S ++ +  +  VAG  +G+ +    HP DTIKVR+Q     NE T+  G L   
Sbjct: 11  PVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT--SQNE-TRFKGPLDCV 67

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLA 161
              +  +G+  FY G    ++G I   ++       YR L+          +      ++
Sbjct: 68  YKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS 127

Query: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
           GV AG + +  +  P+E+ K +LQ Q+        +Y+  +     I   +GI  LY+G+
Sbjct: 128 GVLAGWSVS-FIAPPIELAKAKLQVQY---DKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSL---IGLVSGAIGPFSNA-P 277
             T   +      +F  +    E L  +   +N    E ++    G  S + G ++ A P
Sbjct: 184 ISTLIFR-----THFVYWWGSYELLTRWF-RENTKMSEAAINFWAGGFSASFGFWTTAYP 237

Query: 278 LDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
            D +K   L  DK   +  +W    T  + + Q +G    +KG  P  +R  P  A    
Sbjct: 238 SDVVKQVVLCNDKYDGSFKSW---RTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALA 294

Query: 337 VYEFVRR 343
            +EFV R
Sbjct: 295 AFEFVLR 301

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 131/300 (43%), Gaps = 37/300 (12%)

Query: 64  GGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAV 123
           GG AG+F  +  HPLD  KVR+Q           P  ++   +I   EG++  Y GL A 
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQA-----APIPKPTIVQMLRSILKNEGIVGLYAGLSAS 67

Query: 124 VIGIIPKMAIRFSSYEFYR--TLLADRQTGVVS-TGNTFLAGVGAGVTEAVLVVNPMEVV 180
           ++        RF  Y+  +   +  D+ T +    G + ++G   G     L  N  +++
Sbjct: 68  LLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGG-----LAGNFADLI 122

Query: 181 KIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY---------RGVSLTAARQAT- 230
            IR+Q        +++ Y+NAI     I K EG  +L+         RGV +TA++  T 
Sbjct: 123 NIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTY 182

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK--D 288
           +   NF V    M+  +    S +L S       L++G +     +P D IKT +     
Sbjct: 183 DMFKNFLVTKYNMDPKKN---STHLTS------SLLAGFVATTVCSPADVIKTIVMNAHK 233

Query: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           K   N  +  +I     + + +EG   +++G  P   R+AP   + F   E ++++  G+
Sbjct: 234 KPGHNHDSSFKILM---EAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGM 290

>Scas_669.6
          Length = 373

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 123/300 (41%), Gaps = 35/300 (11%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYKGLGAVVIGIIPKMAIR 134
           H LDT+K R Q    A    K          I+  EG+    Y G  A ++G  P  AI 
Sbjct: 70  HSLDTVKTRQQ---GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIF 126

Query: 135 FSSYEF-YRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ-HLHGA 192
           F +YE+  R ++ D   G   T +   AG+      + + V P EV+K RLQ Q  ++  
Sbjct: 127 FGTYEWCKRKMIGD--LGFNDTVSHLSAGLLGDFVSSFVYV-PSEVLKTRLQLQGRVNNP 183

Query: 193 AEQQ--KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME---RLQ 247
             Q    YR+   A  +IV  EG+ AL+ G   T AR        F  Y K  +   +L+
Sbjct: 184 FFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLE 243

Query: 248 EYHGSQ-NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG-- 304
           +   ++ NL        G ++G +      P+D IKTRLQ  ++  N ++   +  I   
Sbjct: 244 KKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAK 303

Query: 305 ------------------RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
                             + + Q EG    + G+ PR +  +   ++   +Y+   R L 
Sbjct: 304 TNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLLN 363

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGF-RALYKGITPRVMRVAPGQAVTFT 336
           LDT+KTR Q    T    N   +TT  R +  EEG  R LY G    ++   P  A+ F 
Sbjct: 72  LDTVKTRQQGAPMTPKYKN---MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 337 VYEFVRRHLEG 347
            YE+ +R + G
Sbjct: 129 TYEWCKRKMIG 139

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 24/104 (23%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQ----------------IYRRANEGTKP----PGFL 101
           +AGG AG+       P+D IK R+Q                I  + N+ ++P        
Sbjct: 263 IAGGLAGIITT----PMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIF 318

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
           R+   +Y  EG++ F+ G+G   +    + +I    Y+    LL
Sbjct: 319 RSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 72.0 bits (175), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 131/316 (41%), Gaps = 36/316 (11%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +AGG AG        PLD IK+  Q    + A       G +R    I + +G   F++G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEV 179
             A ++ I P  AI+F +YE  R+++        S     L+G  AG+  +V V  P+++
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPTWRH-ESHWRRLLSGSLAGLC-SVFVTYPLDL 141

Query: 180 VKIRL---------QAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
           V++RL         + + +      ++   A++  Y+          YRG + T      
Sbjct: 142 VRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIP 201

Query: 231 NQGANFTVYSKLMERLQE----------------YHGSQNLPSWETSLIGLVSGAIGPFS 274
             G +F  +    +  +                 Y  +  L +W   + G ++G     +
Sbjct: 202 YAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTA 261

Query: 275 NAPLDTIKTRLQ----KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
             P + I+ RLQ     D + R+    V I  I + +  E G+R  + G++   ++V P 
Sbjct: 262 AYPFEIIRRRLQVSAITDPTRRHF---VGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPM 318

Query: 331 QAVTFTVYEFVRRHLE 346
            A +F +YE  + +L+
Sbjct: 319 VACSFFIYERTKWYLQ 334

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 80/216 (37%), Gaps = 30/216 (13%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT-----------KPPGFLRTGANIY 108
            L++G  AGL      +PLD ++VR+      ++             +P   LR      
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQ 180

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----------------ADRQTG 151
                  FY+G    VIG+IP   + F +++  + +                  A  +T 
Sbjct: 181 WFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTV 240

Query: 152 VVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE 211
            + T    +AG  AG+        P E+++ RLQ   +     +  +    + A +I  E
Sbjct: 241 PLKTWAQLVAGGLAGMASQT-AAYPFEIIRRRLQVSAITDPTRRH-FVGINEIAKIIYTE 298

Query: 212 EGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQ 247
            G    + G+S+   +       +F +Y +    LQ
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 71.6 bits (174), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 120/284 (42%), Gaps = 43/284 (15%)

Query: 60  NLVAGGTAGLFEALCC-HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYK 118
           N++ G    L E      PL+ +K  M   R          FL +  +++S  G+L +Y+
Sbjct: 22  NILLGACLNLSEVTTLGQPLEVVKTTMAANRNFT-------FLESVKHVWSRGGILGYYQ 74

Query: 119 GL-----------GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGV 167
           GL           GAV++ +  +   RF S             G+ +  +  L GV  GV
Sbjct: 75  GLIPWAWIEASTKGAVLLFVSAEAEYRFKSL------------GLNNFASGILGGVTGGV 122

Query: 168 TEAVLVV---NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224
           T+A L +     M+ V+I        G   Q  +         I K+EGI  + +GV+  
Sbjct: 123 TQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSW----SVFKNIYKKEGIRGINKGVNAV 178

Query: 225 AARQATNQGANFTVYSKLMERLQEYHGSQN----LPSWETSLIGLVSGAIGPFSNAPLDT 280
           A RQ TN G+ F +   + + +++  G  N    L  +E      + G +  + N P++ 
Sbjct: 179 AIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLSAW-NQPIEV 237

Query: 281 IKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
           I+  +Q  K   N    + +    + + Q  G + LY+G+TPR+
Sbjct: 238 IRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRI 281

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 70/180 (38%), Gaps = 29/180 (16%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
           +  L G    ++E   +  P+EVVK  + A       E  K+         +    GI  
Sbjct: 21  SNILLGACLNLSEVTTLGQPLEVVKTTMAANRNFTFLESVKH---------VWSRGGILG 71

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA 276
            Y+G+   A  +A+ +GA     S   E   +  G  N  S      G++ G  G  + A
Sbjct: 72  YYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFAS------GILGGVTGGVTQA 125

Query: 277 PL--------DTIKTRLQKDKSTRNL--SNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
            L         T++    K  S   +  S+W    ++ + + ++EG R + KG+    +R
Sbjct: 126 YLTMGFCTCMKTVEITRHKSASAGGVPQSSW----SVFKNIYKKEGIRGINKGVNAVAIR 181

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 110/265 (41%), Gaps = 25/265 (9%)

Query: 99  GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ--TGVVSTG 156
           G L     I   EG+   ++G+   ++  IP   + F+ YE+ R    DR    G+  T 
Sbjct: 112 GTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVR----DRSPLNGLYPTI 167

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ--KYRNAIQAAYLIVKEEGI 214
           N  + G  A  T A   V P+E++K +LQ+             YR+        +   G+
Sbjct: 168 NPLICGAFAR-TLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGV 226

Query: 215 G-ALYRGVSLTAARQATNQG---ANFTVYSKLMERLQEYHGSQNLPSW----ETSLIGLV 266
              +++G+ +T  R         A++  Y   +  L      +N  +W     + L G +
Sbjct: 227 AQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFI 286

Query: 267 SGAIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIG--RQLVQEEGFRALYK 318
           SG++      P D  KTR Q      K  +  NL      T  G    + + EG  ALY 
Sbjct: 287 SGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYT 346

Query: 319 GITPRVMRVAPGQAVTFTVYEFVRR 343
           G+ PRV ++AP  A+  + YE  +R
Sbjct: 347 GLAPRVAKIAPSCAIMISSYELTKR 371

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 173 VVNPMEVV-KIRLQAQHLHGA-AEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
           VVN ++ V KI  ++          QK+   ++A   I K EG+  L+RG+S+T      
Sbjct: 83  VVNRIDTVPKIFWESTCFQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIP 142

Query: 231 NQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKS 290
                FT Y  + +R    +G    P+    + G  +  +   S APL+ IKT+LQ   S
Sbjct: 143 ANVVYFTGYEYVRDR-SPLNGL--YPTINPLICGAFARTLAATSVAPLELIKTKLQSIPS 199

Query: 291 T----------RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
           +          R+L N ++     R + Q      ++KG+   + R  P  A+ +  YEF
Sbjct: 200 SSMKNGSVIMYRDLFNEIKSEIAMRGVAQ-----TMFKGLEITLWRDVPFSAIYWASYEF 254

Query: 341 VRRHLEGLG 349
            +  +  L 
Sbjct: 255 YKTKVAYLS 263

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 41/97 (42%), Gaps = 14/97 (14%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY-----RRANEGTK------PPGFLRTGANIY 108
           + + G  +G   A+C HP D  K R QI      + AN   K        GFL     I 
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNY---IR 336

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
             EG+ A Y GL   V  I P  AI  SSYE  + L 
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 79/196 (40%), Gaps = 54/196 (27%)

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHL---HGAAEQQKYRNAIQAAYLIVKEEGIGAL 217
           A VG+ +T  +L   PM+VV+IRLQ Q +    G A+  +  ++      + K    G +
Sbjct: 18  ATVGSLLTSVILT--PMDVVRIRLQQQQMLADCGCADISELDDS-----KVRKRISEGGV 70

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPS--WETSLIGLVSGAIGPFSN 275
            R  +L   RQ           SK++ R+        +P   WE++           F N
Sbjct: 71  RRN-TLEQLRQ-----------SKVVNRID------TVPKIFWESTC----------FQN 102

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
                +  R QK   T              ++ + EG   L++GI+  ++   P   V F
Sbjct: 103 -----LNCRNQKFNGTLE---------AFEKIAKFEGVTTLWRGISITLLMAIPANVVYF 148

Query: 336 TVYEFVRRHLEGLGLF 351
           T YE+VR      GL+
Sbjct: 149 TGYEYVRDRSPLNGLY 164

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 72.0 bits (175), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 123/290 (42%), Gaps = 23/290 (7%)

Query: 74  CCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGL-LAFYKGLGAVVIGIIPKMA 132
             H LDT+K R Q    A    K    +     I   EGL    Y G    ++G  P  A
Sbjct: 72  AMHSLDTVKTRQQ---GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAA 128

Query: 133 IRFSSYEFYRTLLADRQTGVVSTGNTFLAG-VGAGVTEAVLVVNPMEVVKIRLQAQHLHG 191
           I F++YE+ +  +   + G+  T +   AG +G  ++  V V  P EV+K RLQ Q  + 
Sbjct: 129 IFFATYEYTKRKMIG-EWGINETFSHLTAGFLGDFISSFVYV--PSEVLKTRLQLQGRYN 185

Query: 192 AA---EQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME---R 245
                    Y+N   A   IV+ EG   L+ G   T +R     G  F  Y K  +    
Sbjct: 186 NPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFA 245

Query: 246 LQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK------DKSTRNLSNWVR 299
           ++     ++L      + G  +G +      PLD +KTR+Q       + S++NL     
Sbjct: 246 VENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTL 305

Query: 300 ITTIGRQLV---QEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
             +I + ++   + EG   L+ G+ PR +  +   ++   +Y+   + L+
Sbjct: 306 TNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTLD 355

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFR-ALYKGITPRVMRVAPGQAVTFT 336
           LDT+KTR Q   ST    N +      R ++ EEG R  LY G +  ++   P  A+ F 
Sbjct: 76  LDTVKTRQQGAPSTVKYKNMIGAY---RTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFA 132

Query: 337 VYEFVRRHLEG 347
            YE+ +R + G
Sbjct: 133 TYEYTKRKMIG 143

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 125/285 (43%), Gaps = 39/285 (13%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I S EG  A   G G  ++G   + +
Sbjct: 33  PIDVVKTRIQLEPTVYNK--------GMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 133 IRFSSYEFYRTLLAD--RQTGVVSTGNTFLAGVGAGVTE--AVLVVNPMEVVKIRLQAQH 188
            +F  YE ++ L  D       V+  N+   G  A + E  A + + P+E  +IRL    
Sbjct: 85  FKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRL---- 139

Query: 189 LHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQ 247
                 Q  + N +   +  I+KEEG G+ Y G +    +Q     A F V+ +  E   
Sbjct: 140 ----VSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYF 195

Query: 248 EYHG-SQNLPSWETSLIGLVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITT 302
              G  ++L +  T+ I L+SG     + A    P DT+ +++ K K     S      T
Sbjct: 196 GMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQS------T 249

Query: 303 IG--RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           IG   QL ++ GF   + G+  R++ V    ++ F +Y  +++ L
Sbjct: 250 IGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTL 294

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG 99
           P   +S+  +T   +NL++G TAGL  A+   P DT      +  + N+  K PG
Sbjct: 200 PKESLSTASTTG--INLLSGLTAGLAAAIVSQPADT------LLSKVNKTKKAPG 246

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 125/328 (38%), Gaps = 66/328 (20%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           +VAG  A +F+    +P + +K  +Q++R           L              ++ G 
Sbjct: 98  IVAGSCASVFQTTISYPFEFLKTGLQLHRS----------LPNAHPFNMMHQFKYYFSGC 147

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLAD--RQTGVVSTGNTFLAGVGAGVTEAVLVVNPME 178
            A+ +G + K   RF+++E    LL D    +  +S     +AG   G  E++ VV P E
Sbjct: 148 AALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVV-PFE 206

Query: 179 VVKIRLQAQHL------------HGAAEQ------------------------------- 195
            +K  +    L             G AE                                
Sbjct: 207 NIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHP 266

Query: 196 -QKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN 254
             ++ + ++  YL     G+    +G + T  RQ  N    FT Y+ L + +     ++ 
Sbjct: 267 TSRFFSTVKEIYLT---RGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISP---NKP 320

Query: 255 LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFR 314
           L  +   ++G +S         P+D IKTR+Q   +  N  N +       ++  EEG  
Sbjct: 321 LNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNC---AYRIFVEEGIP 377

Query: 315 ALYKGITPRVMRVAPGQAVTFTVYEFVR 342
             +KG  PR+M+V     V+F VY++V 
Sbjct: 378 KFWKGWAPRLMKVGLSGGVSFGVYQYVE 405

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 38/98 (38%), Gaps = 5/98 (5%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI-YRRANEGTKPPGFLRTGANI 107
           +S  K  N     V G  +         P+D IK RMQ  Y  AN        L     I
Sbjct: 315 ISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNS----LNCAYRI 370

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
           +  EG+  F+KG    ++ +     + F  Y++   L+
Sbjct: 371 FVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLI 408

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 132/302 (43%), Gaps = 35/302 (11%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGL-LAFYK 118
            +++G TAG    +  HPLD +K+R+Q+       T   G +R   +I+  +      Y+
Sbjct: 11  EVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIR---DIFERQQWGRELYR 67

Query: 119 GLGAVVIGIIPKMAIRFSSYEF-----YRTLLADRQTGVVS----TGNTFLAGVGAGVTE 169
           GLG  ++G     A+ F  Y        R L  +  TG++          LA   +G+  
Sbjct: 68  GLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIAT 127

Query: 170 AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
           AVL  NP+ V+K R+ A    G      Y++     Y + + EG+ A +RGV    +   
Sbjct: 128 AVLT-NPIWVIKTRIMATSRAG-----PYKSTFDGVYKLYQTEGVLAFWRGV--VPSLLG 179

Query: 230 TNQGA-NFTVYSKLMERLQEYHGSQN-----LPSWETSLIGLVSGAIGPFSNAPLDTIKT 283
            +QGA  F +Y  L  +    H S +     L   E   I  +S  I   S  P   +K+
Sbjct: 180 VSQGAIYFALYDTL--KFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKS 237

Query: 284 RLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
           +LQ   +         IT + + +   EG R  Y+G++  ++R  P   +TF VYE ++ 
Sbjct: 238 KLQDFGAPSG------ITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIKY 291

Query: 344 HL 345
            L
Sbjct: 292 RL 293

>Kwal_23.4354
          Length = 343

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 107/251 (42%), Gaps = 27/251 (10%)

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEA 170
           EG+ + ++GL   ++   P   + F  YE  R     R      T N  + G  A V  A
Sbjct: 98  EGVQSLWRGLSITLLMAAPANMVYFIGYESLRD--KSRLQDKYPTLNPLMCGALARVLAA 155

Query: 171 VLVVNPMEVVKIRLQA--QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228
              V P+E+ + RLQ+  +    +      ++ I+ +   + + G  AL+RG+ +T  R 
Sbjct: 156 T-TVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRD 214

Query: 229 ATNQGANFTVY-------SKLMERLQEYHGSQNLPSWETSLIG-LVSGAIGPFSNAPLDT 280
                  +  Y       S   E+      + N   +  S +G    GA+      P D 
Sbjct: 215 VPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDV 274

Query: 281 IKTRLQ--------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332
            KTR+Q        + K ++N+  ++       Q+ + EG  ALY G+ PRV+++AP  A
Sbjct: 275 GKTRMQITYLNSTLEKKPSKNMFKYLN------QMRKSEGLAALYTGLVPRVIKIAPSCA 328

Query: 333 VTFTVYEFVRR 343
           +  + YE  +R
Sbjct: 329 IMISTYEVCKR 339

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 104/236 (44%), Gaps = 44/236 (18%)

Query: 147 DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL----------------- 189
           ++Q G+        A VG+ +T   L++ PM+VV+IRLQ Q +                 
Sbjct: 4   EKQKGIGLKERLLSAVVGSLLTS--LILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRAS 61

Query: 190 -HGAAEQQ-------------KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGAN 235
             G   Q              +Y +   A   I K EG+ +L+RG+S+T    A      
Sbjct: 62  SKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVY 121

Query: 236 FTVYSKLME--RLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK-DKSTR 292
           F  Y  L +  RLQ+ +     P+    + G ++  +   + APL+  +TRLQ   +S+ 
Sbjct: 122 FIGYESLRDKSRLQDKY-----PTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSP 176

Query: 293 NLSNWVRITTI---GRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
             +  + I  +    R  + + G++AL++G+   + R  P  ++ +  YEF + ++
Sbjct: 177 KSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNV 232

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 50  SSKKSTNPAVNLVAGGT-AGLFEALCCHPLDTIKVRMQI-YRRANEGTKPPGFLRTGAN- 106
           SS  + N  VN   GG+  G   A+  HP D  K RMQI Y  +    KP   +    N 
Sbjct: 243 SSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQ 302

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA 146
           +   EGL A Y GL   VI I P  AI  S+YE  + L +
Sbjct: 303 MRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 134/312 (42%), Gaps = 30/312 (9%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN-EGTKPPGFLRTGANI 107
           M S+++ +  +  VAG  +G+ +    HP DT+KVR+Q  +  +  G +  G L      
Sbjct: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVG 164
              +G+   Y G    + G I   +    S   YR LL      +   +      ++GV 
Sbjct: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE--------EGIGA 216
           AG T +  +  P+E+ K +LQ Q+    A+  KY   I     + K+         G+ +
Sbjct: 121 AGWTVS-FIAAPVELAKAKLQVQY---DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERL-QEYHGSQNLPSWETSLI-GLVSGAIGPFS 274
           LY+G+  T   +     +NF  +    E + Q +  + NL +   +   G +S + G ++
Sbjct: 177 LYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT 231

Query: 275 NA-PLDTIK-TRLQKDKSTRNLSNW-VRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
           +A P D +K   L  DK   +  +W   ++ I RQ     G    +KG  P  +R  P  
Sbjct: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQ----RGIHGFFKGFLPSFLRSFPAN 287

Query: 332 AVTFTVYEFVRR 343
           A     +EFV R
Sbjct: 288 AAALAAFEFVLR 299

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 117/275 (42%), Gaps = 36/275 (13%)

Query: 92  NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG 151
           N   K  G L     I S EG+ + ++G+   ++  IP   + FS YE+ R +     T 
Sbjct: 97  NSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIAST- 155

Query: 152 VVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE 211
              T N    G  A V  A  +  P+E+VK +LQ+  +  +++  K    ++      ++
Sbjct: 156 -YPTLNPLFCGAIARVFAATSIA-PLELVKTKLQS--IPRSSKSTKTWMMVKDLLNETRQ 211

Query: 212 E--GIG---ALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI--- 263
           E   +G   AL++G+ +T  R        ++ Y    ERL  +  S    S + + +   
Sbjct: 212 EMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERL--WLDSTRFASKDANWVHFI 269

Query: 264 -----GLVSGAIGPFSNAPLDTIKTRLQKD----------KSTRNLSNWVRITTIGRQLV 308
                G +SG I      P D  KTR Q              +RN+  ++   TI R   
Sbjct: 270 NSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLE--TIWRT-- 325

Query: 309 QEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
             EG  ALY G+  RV+++ P  A+  + YE  ++
Sbjct: 326 --EGLAALYTGLAARVIKIRPSCAIMISSYEISKK 358

 Score = 65.9 bits (159), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 101/255 (39%), Gaps = 58/255 (22%)

Query: 145 LADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL------HGAAE---- 194
           ++DR T    T    +   GAG     L++ PM+VV+IRLQ Q +       GAAE    
Sbjct: 1   MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNA 60

Query: 195 --------------------------------------QQKYRNAIQAAYLIVKEEGIGA 216
                                                   K+   ++A   I   EGI +
Sbjct: 61  VSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITS 120

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG-SQNLPSWETSLIGLVSGAIGPFSN 275
           L+RG+SLT           F+ Y    E +++    +   P+      G ++      S 
Sbjct: 121 LWRGISLTLLMAIPANMVYFSGY----EYIRDVSPIASTYPTLNPLFCGAIARVFAATSI 176

Query: 276 APLDTIKTRLQK-DKSTRNLSNWVRITTIGRQLVQEEGF----RALYKGITPRVMRVAPG 330
           APL+ +KT+LQ   +S+++   W+ +  +  +  QE       RAL+KG+   + R  P 
Sbjct: 177 APLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPF 236

Query: 331 QAVTFTVYEFVRRHL 345
            A+ ++ YE  +  L
Sbjct: 237 SAIYWSSYELCKERL 251

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANE----GTKPPGFLRTGANIYSGEGLLA 115
           +  +G  +G+  A+C HP D  K R QI    N     G +     +    I+  EGL A
Sbjct: 271 SFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAA 330

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR 148
            Y GL A VI I P  AI  SSYE  + +  ++
Sbjct: 331 LYTGLAARVIKIRPSCAIMISSYEISKKVFGNK 363

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 116/264 (43%), Gaps = 36/264 (13%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL-----------GAVV 124
            PL+  K  M   R+        GF +   +++S  G+  FY+GL           GAV+
Sbjct: 36  QPLEVTKTTMAANRQF-------GFSQAVRHVWSRGGVFGFYQGLIPWAWIEASTKGAVL 88

Query: 125 IGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRL 184
           + +  +     + Y+F       R+ G+ + G   L GV  GV +A L +     +K   
Sbjct: 89  LFVSAE-----AEYQF-------RRLGLSNFGAGILGGVSGGVAQAYLTMGFCTCMKTVE 136

Query: 185 QAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244
             +    +A      +++Q    I   EG+  + +GV+  A RQ TN G+ F + S+L+E
Sbjct: 137 ITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGL-SRLVE 195

Query: 245 ----RLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
               R+      + L + E  +   + G +  + N P++ I+  +Q   +  N    + +
Sbjct: 196 DGIRRVTHKRSDEKLSAMEKIVASALGGGLSAW-NQPIEVIRVEMQSRTNDPNRPKNLTV 254

Query: 301 TTIGRQLVQEEGFRALYKGITPRV 324
               R + +  G R LY+G+TPR+
Sbjct: 255 GKTFRYIYENNGLRGLYRGVTPRI 278

>Scas_673.17
          Length = 314

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 120/284 (42%), Gaps = 37/284 (13%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I + EG  A   G G  ++G   + A
Sbjct: 40  PVDVVKTRIQLEPTVYNK--------GMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGA 91

Query: 133 IRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189
            +F  YE ++ L  D    +  V    + ++         A + + P+E  +IRL     
Sbjct: 92  FKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRL----- 146

Query: 190 HGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
                Q  + N +   +  I+KEEG+G+ Y G +    +Q     A F V+ +  E    
Sbjct: 147 ---VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYG 203

Query: 249 YHGSQNLPSWETS-----LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTI 303
             G++   S  T+     L GL +G    F + P DT+ +++ K K     S      TI
Sbjct: 204 IVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQS------TI 257

Query: 304 G--RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           G   QL ++ G    + G+  R++ V    ++ F +Y  ++  L
Sbjct: 258 GLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTL 301

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 55  TNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG--ANIYSGEG 112
           TN  +NL++G TAG   A    P DT      +  + N+  K PG    G  A +    G
Sbjct: 215 TNTGINLLSGLTAGFAAAFVSQPADT------LLSKVNKTKKAPGQSTIGLLAQLAKQLG 268

Query: 113 LLAFYKGLGAVVIGIIPKMAIRFSSY 138
           ++  + GL   +I +    +++F+ Y
Sbjct: 269 VIGSFAGLPTRLIMVGTLTSLQFAIY 294

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 266 VSGAIG----PFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321
           ++GAIG      S  P+D +KTR+Q + +  N           ++++ +EG  AL  G  
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSF----KKIIADEGAGALLTGFG 80

Query: 322 PRVMRVAPGQAVTFTVYEFVRR 343
           P ++  +   A  F  YE  ++
Sbjct: 81  PTLLGYSVQGAFKFGGYEVFKK 102

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 121/286 (42%), Gaps = 22/286 (7%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL-AFYKGLGAVVIGIIPKMAIR 134
           H LDT+K R Q    A    K    +     +   EG+    Y G GA ++G  P  A+ 
Sbjct: 72  HSLDTVKTRQQ---GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVF 128

Query: 135 FSSYEFY-RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAA 193
           F +YE+  R ++ + Q  +  T +   AG    +  +V+ V P EV+K RLQ Q  +   
Sbjct: 129 FGTYEWVKRQMINEWQ--IHETYSHLAAGFLGDLFSSVVYV-PSEVLKTRLQLQGCYNNR 185

Query: 194 EQQ---KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMER---LQ 247
             Q    YR    A   IV+ EG+ AL+ G   T +R        F  Y +  +    L+
Sbjct: 186 HFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLE 245

Query: 248 EYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK----DKSTRNLSNWVRIT-T 302
                 +L      + G  +G +      PLD +KTR+Q        T + S   R+  +
Sbjct: 246 RKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGS 305

Query: 303 IGRQL---VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           I R L   ++ EG    + G+ PR +  +   ++   +Y+   R L
Sbjct: 306 IFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALRTL 351

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 127/324 (39%), Gaps = 59/324 (18%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +++AG  A +F+    HP + +K   Q++R        PG     A          ++ G
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKTGQQLHRAL------PG----AAAFNMLHPFKYYFSG 72

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLVVNPM 177
             A+ +G + K   RF+++E     L D +     ++     LAG   G  E++ VV P 
Sbjct: 73  CAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVV-PF 131

Query: 178 EVVKI-----------RLQAQ----------------HLHGAA-------------EQQK 197
           E +K            R+Q +                  H A              E+Q 
Sbjct: 132 ESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERWLLHYERQP 191

Query: 198 YRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPS 257
             +       I +  G+    +G   T  RQ  N    FT Y+ +++ L  +   + L  
Sbjct: 192 SSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPH---KALDE 248

Query: 258 WETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALY 317
           ++    G +S A       P+D IKTR+Q   +     +         ++  EEGFR ++
Sbjct: 249 YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKS---SLNCAYRIFVEEGFRYMW 305

Query: 318 KGITPRVMRVAPGQAVTFTVYEFV 341
           KG  PR+ +V+    ++F VY++V
Sbjct: 306 KGWVPRLFKVSLSGGISFGVYQYV 329

>Scas_645.9
          Length = 391

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 114/280 (40%), Gaps = 44/280 (15%)

Query: 92  NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG 151
           N   +  G L     I+  EG+   ++G+   ++  IP   + F+ YE+ R    D    
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR----DNSPL 179

Query: 152 VVS--TGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIV 209
             S  T N  + G  A +  A  V  P+E++K +LQ+          K   +      ++
Sbjct: 180 ATSSPTFNPLMCGAIARILAASTVA-PLELLKTKLQS-----IPRVSKSTTSWMMVKELL 233

Query: 210 KEE--------GIGALYRGVSLTAARQATNQGANFTVYS--KLMERLQEYHGSQNLPSWE 259
           KE            AL++G+ +T  R        +  Y   K    +       NL  + 
Sbjct: 234 KETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFI 293

Query: 260 TSLIG-LVSGAIGPFSNAPLDTIKTRLQ------KDKS---------TRNLSNWVRITTI 303
            S IG  +SG I      P D  KTR Q       DKS         T+N+  ++R    
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLR---- 349

Query: 304 GRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 343
              + + EG+ ALY G+ PR++++AP  A+  + YE  +R
Sbjct: 350 --NIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 112/290 (38%), Gaps = 56/290 (19%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGL 120
           +++  T  L  +L   P+D +++R+Q                        + LL      
Sbjct: 40  MLSASTGSLLTSLTLTPMDVVRIRLQ-----------------------QQELLPDCSCE 76

Query: 121 GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVV 180
              V   +PK     SS +  R          +STGN             V   NP    
Sbjct: 77  TIAVKDFLPKAKTDLSSVQVSRA-------ATISTGNK----------NKVFWDNPC--- 116

Query: 181 KIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYS 240
                 Q L+      ++   ++A   I K EGI  L+RG+S+            FT Y 
Sbjct: 117 -----FQELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE 171

Query: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK-DKSTRNLSNWVR 299
            L +       S   P++   + G ++  +   + APL+ +KT+LQ   + +++ ++W+ 
Sbjct: 172 YLRDNSPLATSS---PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMM 228

Query: 300 ITTIGRQLVQEEGF----RALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           +  + ++  QE        AL+KG+   + R  P  A+ +  YEF + HL
Sbjct: 229 VKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHL 278

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 41/98 (41%), Gaps = 15/98 (15%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEG---TKPPG---------FLRTGANI 107
           + + G  +G   AL  HP D  K R QI    N      K P          FLR   NI
Sbjct: 295 SFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLR---NI 351

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL 145
           +  EG  A Y GL   ++ I P  AI  SSYE  + L 
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 131/311 (42%), Gaps = 50/311 (16%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL---RTGANIYSGEGLLAF 116
           +L+ G   GL  A+   P D +K R+Q     N+ T   G L   R+   ++ G    + 
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQ----QNKDTTLWGTLKEIRSPKQLWRGALPSSL 65

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGV-------GAGVTE 169
              +G+         A+  S+   +RT +A  +T  ++ G++FL  +           T 
Sbjct: 66  RTSIGS---------ALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTR 116

Query: 170 AV--LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
            V   +  P+ ++K+R ++           Y++  +A   I   EGI   + G   T  R
Sbjct: 117 GVVGFITMPITIIKVRYEST-------MYSYKSLGEATRHIYSTEGIRGFFNGCGATVMR 169

Query: 228 QATNQGANFTVYSK--------LMERLQEYHGSQNLPSWETSLI----GLVSGAIGPFSN 275
            A   G    +Y K        L      Y  +    ++ ++++      +S ++     
Sbjct: 170 DAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTIT 229

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
           +P DTIKTR+Q D +    S + +   +   +V +E F+ L+ G+T R+ R A    + +
Sbjct: 230 SPFDTIKTRMQLDPT--KFSGFYKTLVL---IVSKEKFKNLFDGLTLRLTRKAFSAGIAW 284

Query: 336 TVY-EFVRRHL 345
            +Y E ++R +
Sbjct: 285 GIYEELIKRFM 295

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 89/206 (43%), Gaps = 32/206 (15%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVR----MQIYRRANEGTKPPGFLRTGANIYSGEGLLA 115
           NL +G            P+  IKVR    M  Y+   E T+         +IYS EG+  
Sbjct: 108 NLASGAFTRGVVGFITMPITIIKVRYESTMYSYKSLGEATR---------HIYSTEGIRG 158

Query: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTL---------LADRQTGVVST-GNTFLAGVGA 165
           F+ G GA V+   P   +    YE  + L         ++  + G+ +T  +T +  + A
Sbjct: 159 FFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISA 218

Query: 166 GVTE--AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
            ++   A  + +P + +K R+Q        +  K+    +   LIV +E    L+ G++L
Sbjct: 219 FMSASLATTITSPFDTIKTRMQ-------LDPTKFSGFYKTLVLIVSKEKFKNLFDGLTL 271

Query: 224 TAARQATNQGANFTVYSKLMERLQEY 249
              R+A + G  + +Y +L++R   Y
Sbjct: 272 RLTRKAFSAGIAWGIYEELIKRFMAY 297

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 15/95 (15%)

Query: 55  TNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLL 114
           T+  VN ++   +         P DTIK RMQ+     + TK  GF +T   I S E   
Sbjct: 209 TSTVVNSISAFMSASLATTITSPFDTIKTRMQL-----DPTKFSGFYKTLVLIVSKEKFK 263

Query: 115 AFYKGL----------GAVVIGIIPKMAIRFSSYE 139
             + GL            +  GI  ++  RF +Y 
Sbjct: 264 NLFDGLTLRLTRKAFSAGIAWGIYEELIKRFMAYS 298

>Kwal_33.15597
          Length = 305

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 122/285 (42%), Gaps = 39/285 (13%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I S EG  A   G G  ++G   + +
Sbjct: 33  PIDVVKTRIQLEPTVYNK--------GMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 133 IRFSSYEFYRTLLADR--QTGVVSTGNTFLAGVGAGVTE--AVLVVNPMEVVKIRLQAQH 188
            +F  YE ++ L  D       V+  N+   G  A + E  A + + P+E  +IRL    
Sbjct: 85  FKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRL---- 139

Query: 189 LHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQ 247
                 Q  + N +   +  I+KEEG+ + Y G +    +Q     A F V+ +  E   
Sbjct: 140 ----VSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYF 195

Query: 248 EYHGSQNLPSWETS-----LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITT 302
              G +   S  T+     L GL +G      + P DT+ +++ K K     S      T
Sbjct: 196 GMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQS------T 249

Query: 303 IGR--QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           IG   QL +E GF   + G+  R++ V    ++ F +Y  +++ L
Sbjct: 250 IGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTL 294

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 11/77 (14%)

Query: 277 PLDTIKTRLQKDKSTRN---LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           P+D +KTR+Q + +  N   +S++       +Q++  EG  AL  G  P ++  +   + 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSF-------KQIISSEGAGALLTGFGPTLLGYSLQGSF 85

Query: 334 TFTVYE-FVRRHLEGLG 349
            F  YE F +  ++ LG
Sbjct: 86  KFGGYEVFKKLFIDTLG 102

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 120/288 (41%), Gaps = 45/288 (15%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I + EG  A   G G  ++G   + A
Sbjct: 33  PIDVVKTRIQLEPTVYNK--------GMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGA 84

Query: 133 IRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189
            +F  YE ++    D     T      + ++    A    A + + P+E  +IRL     
Sbjct: 85  FKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL----- 139

Query: 190 HGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
                Q  + N +   +  I+KEEG+G+ Y G +    +Q     A F V+    ER  E
Sbjct: 140 ---VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVF----ERASE 192

Query: 249 YHGSQNLPS---WETSLI------GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVR 299
            + S   P     +TSL       GL +G      + P DT+ +++ K       S    
Sbjct: 193 LYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQS---- 248

Query: 300 ITTIGR--QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
             T+G   QL ++ GF   + G+  R++ V    ++ F +Y  +++ L
Sbjct: 249 --TVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSL 294

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 10/100 (10%)

Query: 252 SQNLPSWETSLIG--LVSGAIGPFSN----APLDTIKTRLQKDKSTRNLSNWVRITTIGR 305
           S  LP +  S      ++GAIG  S      P+D +KTR+Q + +  N           R
Sbjct: 2   SNQLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF----R 57

Query: 306 QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           +++ EEG  AL  G  P ++  +   A  F  YE  ++  
Sbjct: 58  KIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFF 97

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG 99
           P + +S    T  A+NL++G TAGL  A+   P DT      +  + N+ +K PG
Sbjct: 200 PKDTLSQTSLT--AINLLSGLTAGLAAAIVSQPADT------LLSKVNKTSKAPG 246

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 133/316 (42%), Gaps = 56/316 (17%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT--KPPGFLRTGANIYSGEGLLAFY 117
           +L+ G   GL  A+   PLD +K R Q   +   GT  +    L T   ++ G    A  
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ---QTKGGTLWQTVKSLDTPWQLWRGTLPSAIR 63

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN-- 175
             +G+         A+  SS    RT LA R+     T ++ + G  + + +  +  N  
Sbjct: 64  TSVGS---------ALYLSSLNLMRTALAKRKQ--FDTADSVVTGKSSNLPQLSMYENLV 112

Query: 176 --------------PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
                         P+ ++K+R ++   +       Y++  +AA  I  +EGI   +RG 
Sbjct: 113 TGAFARGTVGYITMPITIIKVRYESTLYN-------YKSIAEAAKSIAAQEGIRGFFRGF 165

Query: 222 SLTAARQATNQGANFTVYSKLM--------ERLQEYHGSQNLPSWETSLI----GLVSGA 269
             T  R A   G    +Y KL         + L +        ++ ++ I     ++S +
Sbjct: 166 GPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSAS 225

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
           +     AP DTIKTR+Q +  T+  + W  +TTI   + QE   + ++ G++ R+ R A 
Sbjct: 226 MATTVTAPFDTIKTRMQLEP-TKFKTFWSTLTTI---VTQEHPIK-IFSGLSMRLTRKAL 280

Query: 330 GQAVTFTVYEFVRRHL 345
              + + +YE + +H 
Sbjct: 281 SAGIAWGIYEELIKHF 296

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 85/205 (41%), Gaps = 31/205 (15%)

Query: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQ---------QKYRNAIQA 204
           STG+  + G   G++ AV  + P++++K R Q Q   G   Q         Q +R  + +
Sbjct: 4   STGH-LIGGFAGGLSSAV-ALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQLWRGTLPS 60

Query: 205 AYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPS---WETS 261
           A   ++     ALY   SL   R A  +   F     ++        S NLP    +E  
Sbjct: 61  A---IRTSVGSALYLS-SLNLMRTALAKRKQFDTADSVVT-----GKSSNLPQLSMYENL 111

Query: 262 LIG-LVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
           + G    G +G +   P+  IK R +       L N+  I    + +  +EG R  ++G 
Sbjct: 112 VTGAFARGTVG-YITMPITIIKVRYES-----TLYNYKSIAEAAKSIAAQEGIRGFFRGF 165

Query: 321 TPRVMRVAPGQAVTFTVYEFVRRHL 345
            P  +R AP   +   +YE ++  L
Sbjct: 166 GPTCLRDAPYSGLYVLLYEKLKHTL 190

>Kwal_26.7972
          Length = 358

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 80/334 (23%), Positives = 138/334 (41%), Gaps = 49/334 (14%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           +AGG AG        PLD IK+  Q     Y + +  T   G +R GA+I + +G+  FY
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTM--GLIRAGAHINAHDGIRGFY 89

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPM 177
           +G  A +I I P  AI+F +YE  R  +   +    +      +G  AG+  +V +  P+
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKE-YETHARRLASGSMAGLC-SVFMTYPL 147

Query: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA-------------LYRGVSLT 224
           +++++RL          + K    I+  Y     E + +              YRG + T
Sbjct: 148 DLIRVRLAYV---TDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPT 204

Query: 225 AARQATNQGANF---------------TVYSKLMERLQEY------HGSQNLPSWETSLI 263
                   G +F               + YS L    +E         S+ L +W   + 
Sbjct: 205 VLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVA 264

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKD-KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322
           G ++G     ++ P + I+ RLQ    S  ++ N+  I  + R + +E G+R  + G++ 
Sbjct: 265 GGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLSI 324

Query: 323 RVMRVAPGQAVTFTVY---EFVRRHLEGLGLFGS 353
             ++V P  A +F      E V  +L    +F S
Sbjct: 325 GYIKVTPMVACSFFRLRKNEVVSEYLRTYTIFSS 358

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 82/213 (38%), Gaps = 48/213 (22%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRM----------------QIY-RRANE 93
           SK+    A  L +G  AGL      +PLD I+VR+                QIY  RA+E
Sbjct: 120 SKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASE 179

Query: 94  GTKPPGFL-RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEF------------ 140
                 ++ R  A+         FY+G    V+G+IP   + F +++             
Sbjct: 180 SLTSKSYVPRWFAH------WCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSP 233

Query: 141 YRTL-LADRQTGVVS---------TGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLH 190
           Y  L ++D +  + S         T    +AG  AG+        P E+++ RLQ   + 
Sbjct: 234 YSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQT-ASYPFEIIRRRLQVS-VV 291

Query: 191 GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
                  ++       +I KE G    + G+S+
Sbjct: 292 SPTSIHNFQTIPDMIRIIYKERGWRGFFVGLSI 324

>Scas_696.9
          Length = 312

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 130/295 (44%), Gaps = 45/295 (15%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCC-HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           S KK +    N++ G T  + E      PL+ +K  M   R  N       F+ +   ++
Sbjct: 10  SPKKRSINFSNIILGATINMAEVTSLGQPLEVVKTTMAANRNLN-------FVNSMKYVW 62

Query: 109 SGEGLLAFYKGL-----------GAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGN 157
           S  G++ FY+GL           GAV++ +  +   RF            +  G+ +  +
Sbjct: 63  SRGGIVGFYQGLIPWAWIEASTKGAVLLFVSAESEYRF------------KLLGMGNFTS 110

Query: 158 TFLAGVGAGVTEAVLVV---NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGI 214
             L GV  GVT++ L +     M+ V+I        GA  Q  + N  ++ Y    +EG+
Sbjct: 111 GILGGVLGGVTQSYLTMGFCTCMKTVEITRLKSASAGAPVQSSW-NVFRSIY---AKEGL 166

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLP-----SWETSLIGLVSGA 269
             +Y+GV+  A RQ TN G+ F  +S+L+E        +  P     +WE      V G 
Sbjct: 167 RGIYKGVNAVAIRQMTNWGSRFG-FSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGG 225

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324
           +  + N P++ I+  +Q  K   N    + +    + +++  G + LY+G+TPR+
Sbjct: 226 LSAW-NQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>Scas_717.20
          Length = 356

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 140/332 (42%), Gaps = 62/332 (18%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRAN-EGTKPPGFL----RTGANIYSGEGLLAF 116
           +AGG +G        PLD IK+   +++ +N   TK  G L        +I+  +G+  F
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKI---LFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGF 93

Query: 117 YKGLGAVVIGIIPKMAIRFSSYEFYR-TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVN 175
           ++G    ++ I P  A++F +YE  R TL+  ++    S     ++G  AG+  +V    
Sbjct: 94  FQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE--SHWRRLMSGSLAGLC-SVFTTY 150

Query: 176 PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGAL----------------YR 219
           P++++++RL          + K  + +     I KE     L                YR
Sbjct: 151 PLDLIRVRL------AYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYR 204

Query: 220 GVSLTAARQATNQGANFTVYSKLMERL-------------------QEYHGSQNLP--SW 258
           G + T        G +F  +  L + L                   + +   Q LP  +W
Sbjct: 205 GYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTW 264

Query: 259 ETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSN-----WVRITTIGRQLVQEEGF 313
              L G ++G     +  P + I+ RLQ   ST ++S      +  I+ I + + +E G+
Sbjct: 265 AELLSGGLAGMASQTAAYPFEIIRRRLQ--VSTLSVSQMYDHRFQSISEIAKIIYKERGW 322

Query: 314 RALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           R  + G++   ++V P  A +F VYE ++ HL
Sbjct: 323 RGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 83/198 (41%), Gaps = 22/198 (11%)

Query: 161 AGVGAGVTE--AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           +G+  G++   A  ++ P++ +KI  Q  + H            +AA  I   +GI   +
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERL---QEYHGSQNLPSWETSLIGLVSGAIGPFSN 275
           +G S+T  R        F  Y ++   L   +EY        W   + G ++G    F+ 
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESH-----WRRLMSGSLAGLCSVFTT 149

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQ----LVQEEGFRA--------LYKGITPR 323
            PLD I+ RL      + +S    + TI ++     ++ +G+           Y+G TP 
Sbjct: 150 YPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPT 209

Query: 324 VMRVAPGQAVTFTVYEFV 341
           V+ + P   V+F  ++ +
Sbjct: 210 VLGMIPYAGVSFFAHDLL 227

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 90/232 (38%), Gaps = 38/232 (16%)

Query: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRT-----GA 105
           SK+  +    L++G  AGL      +PLD I+VR+  Y   ++     G ++T      +
Sbjct: 125 SKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLA-YVTEHKRISLLGLVKTIYKEPAS 183

Query: 106 NIYSGEGLLA--------FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA----------- 146
                +G +         FY+G    V+G+IP   + F +++    +L            
Sbjct: 184 TTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLA 243

Query: 147 -----------DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLH-GAAE 194
                        Q   + T    L+G  AG+        P E+++ RLQ   L      
Sbjct: 244 LSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQT-AAYPFEIIRRRLQVSTLSVSQMY 302

Query: 195 QQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL 246
             ++++  + A +I KE G    + G+S+   +       +F VY ++   L
Sbjct: 303 DHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 117/285 (41%), Gaps = 39/285 (13%)

Query: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           PLD +K R+Q+    YR   +G K          I   EGL   + G+GA  IG   + A
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDGWK---------TIVRSEGLSKVFTGVGATFIGYSLQGA 85

Query: 133 IRFSSYEFYR---TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189
            ++  YE+++   + L   +T        +L    +    A +++ P E +K++ Q    
Sbjct: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ---- 141

Query: 190 HGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT--------VYSK 241
                    +N ++    I   EG+  LY+G++    RQ       FT        +Y+K
Sbjct: 142 --TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199

Query: 242 LMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           L    QE   SQ +     S + G ++G +    + P D + +++  D+          +
Sbjct: 200 LPRSKQEMSPSQQI---GVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SM 251

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
               +++    GF  L+ G+  R+  +    +  + +Y+  + ++
Sbjct: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 75/185 (40%), Gaps = 46/185 (24%)

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           V P+++VK RLQ          Q YR+ +     IV+ EG+  ++ GV           G
Sbjct: 33  VTPLDLVKCRLQVN-------PQLYRSNLDGWKTIVRSEGLSKVFTGV-----------G 74

Query: 234 ANFTVYSKLMERLQEYHGSQ-------NLPSWET-----SLIGLVSGAIGPFSN----AP 277
           A F  YS  ++   +Y G +       NL S ET     + + L + A   F       P
Sbjct: 75  ATFIGYS--LQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP 132

Query: 278 LDTIKTRLQKD--KSTRN-LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334
            + IK + Q       +N L  W +IT         EG   LYKGITP   R  P     
Sbjct: 133 WEAIKVKQQTTIPPFCKNFLEGWSKITA-------AEGLSGLYKGITPLWCRQIPYTMCK 185

Query: 335 FTVYE 339
           FT +E
Sbjct: 186 FTSFE 190

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 9/105 (8%)

Query: 51  SKKSTNPA----VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106
           SK+  +P+    V+ V G  AG+  A+  HP D +  ++   R+  E       +     
Sbjct: 203 SKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SMVEASKR 257

Query: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG 151
           IYS  G    + GL   +  I    + ++  Y+ ++  +    TG
Sbjct: 258 IYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 117/312 (37%), Gaps = 41/312 (13%)

Query: 64  GGTAGLFEALCCHPLDTIKVRMQIYRR------ANEGTKPPGFLRTGANIYSGEGLLAFY 117
           G  A    A   +PLD  K  +Q   +      + E  K    +     I+   G L  Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRT-----------LLADRQTGVVSTGNTFLAGVGAG 166
           +GL   V     +  I F  Y   R+           L  D +   +ST      G+ AG
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 167 VTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG---ALYRGVSL 223
               V V NP+ V+  R   Q L    E    +  I+  Y    EE  G   A ++G  +
Sbjct: 130 AMTQV-VTNPISVISTR---QQLTKDGEDASLKAVIKQIY----EESNGDLTAFWKGFKV 181

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHG-------SQNLPSWETSLIGLVSGAIGPFSNA 276
            A   +TN    +  Y KL   +    G       S  L + E  L+G+ S  I  F   
Sbjct: 182 -ALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQ 240

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           PL   K  LQ   S      +     + + + Q EGF +L+KG+ P+V +    Q + FT
Sbjct: 241 PLIVAKITLQGKGS-----KFKTFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFT 295

Query: 337 VYEFVRRHLEGL 348
             + + R +  L
Sbjct: 296 YKDEIVRVIRKL 307

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 88/204 (43%), Gaps = 24/204 (11%)

Query: 170 AVLVVNPMEVVKIRLQAQHLHG----AAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225
           A   V P+++ K  +Q QH +     + E++KY+N I     I K+ G   LY+G++   
Sbjct: 17  AATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNV 76

Query: 226 ARQATNQGANFTVYSKLME--------RLQEYHGSQ--NLPSWETSLIGLVSGAIGPFSN 275
           A         F  YS +          RLQ    S+   L + E   +G+ +GA+     
Sbjct: 77  AANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAGAMTQVVT 136

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG--FRALYKGI-TPRVMRVAPGQA 332
            P+  I TR Q  K   + S    +  + +Q+ +E      A +KG     V+   P  A
Sbjct: 137 NPISVISTRQQLTKDGEDAS----LKAVIKQIYEESNGDLTAFWKGFKVALVLSTNP--A 190

Query: 333 VTFTVYEFVRRH-LEGLGLFGSAK 355
           +T+  Y+ ++   L   GL GS K
Sbjct: 191 ITYGSYQKLKSMILTAKGLSGSQK 214

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 133/320 (41%), Gaps = 50/320 (15%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           +AGG +G        PLD IK+  Q     Y +        G +    +I+  +G+  F+
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLI--GLVEAAKHIWINDGVRGFF 95

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYR-TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
           +G  A ++ I P  A++F +YE  R TL+  ++    S     ++G  AG+  +V +  P
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKE--FESHWRRLVSGSLAGLC-SVFITYP 152

Query: 177 MEVVKIRLQAQHLH-----GAAEQQKYRNAIQAAYLIVKEEGI-------GALYRGVSLT 224
           +++V++RL  +  H     G   ++ Y+    A   ++K + I          YRG   T
Sbjct: 153 LDLVRVRLAYETEHKRVKLGRIIKKIYKEPASAT--LIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 225 AARQATNQGANFTVYSKL----------------------MERLQEYHGSQNLPSWETSL 262
                   G +F  +  L                      +ER+Q+    + L +W   +
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQK-KQRRPLRTWAELI 269

Query: 263 IGLVSGAIGPFSNAPLDTIKTRLQKDK---STRNLSNWVRITTIGRQLVQEEGFRALYKG 319
            G ++G     +  P + I+ RLQ       T     +  I+ I   + +E G R  + G
Sbjct: 270 SGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVG 329

Query: 320 ITPRVMRVAPGQAVTFTVYE 339
           ++   ++V P  A +F VYE
Sbjct: 330 LSIGYIKVTPMVACSFFVYE 349

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 90/229 (39%), Gaps = 36/229 (15%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI---YRRANEGT------KPPG 99
           + SK+  +    LV+G  AGL      +PLD ++VR+     ++R   G       K P 
Sbjct: 124 IPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPA 183

Query: 100 FLRTGANIYSGEGLLA---FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD--------- 147
                 N Y          FY+G    V+G+IP   + F +++    +L           
Sbjct: 184 SATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVL 243

Query: 148 -------------RQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLH-GAA 193
                        +Q   + T    ++G  AG+        P E+++ RLQ   L     
Sbjct: 244 ELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQT-AAYPFEIIRRRLQVSALSPKTM 302

Query: 194 EQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKL 242
              K+++  + A++I KE G+   + G+S+   +       +F VY ++
Sbjct: 303 YDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERM 351

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 82/206 (39%), Gaps = 26/206 (12%)

Query: 161 AGVGAGVTE--AVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           +G+  G++   A  ++ P++ +KI  Q  + H           ++AA  I   +G+   +
Sbjct: 36  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPS-WETSLIGLVSGAIGPFSNAP 277
           +G S T  R        F  Y ++   L     S+   S W   + G ++G    F   P
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIP---SKEFESHWRRLVSGSLAGLCSVFITYP 152

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRAL----------------YKGIT 321
           LD ++ RL  +   +     V++  I +++ +E     L                Y+G  
Sbjct: 153 LDLVRVRLAYETEHKR----VKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYV 208

Query: 322 PRVMRVAPGQAVTFTVYEFVRRHLEG 347
           P V+ + P   V+F  ++ +   L+ 
Sbjct: 209 PTVLGMIPYAGVSFFAHDLLHDVLKS 234

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 130/306 (42%), Gaps = 15/306 (4%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGA 105
           + ++ TN A+N + GG +         P++ +K+ +Q    + ++     K  G +    
Sbjct: 5   AKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFK 64

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT---GVVSTGNTFLAG 162
                EGL++F++G  A VI   P  A+ F+  +  + +   ++    G    GN  LA 
Sbjct: 65  RTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGN--LAS 122

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGALYRGV 221
            GA    ++L V  ++  + RL A          +  N +   Y   +K +GI  LYRG 
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
             +       +G  F ++  L   +    GS +     + L+G V        + PLDT+
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLV--LTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV 240

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
           + R+    ++     +       +++V  EG  +L+KG    ++R   G  V  ++Y+ +
Sbjct: 241 RRRMM--MTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI-SMYDQL 297

Query: 342 RRHLEG 347
           +  L G
Sbjct: 298 QMILFG 303

>Kwal_23.5757
          Length = 307

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 118/279 (42%), Gaps = 38/279 (13%)

Query: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           PLD +K R Q+    Y+   +G +          I   EG    + G+GA  IG   + A
Sbjct: 39  PLDLVKCRRQVDASLYKSNLDGWR---------QIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 133 IRFSSYEFYR---TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189
            ++  YEF++   + L   +T        FLA   +    A + + P E +K+R Q    
Sbjct: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT--- 146

Query: 190 HGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY 249
             A      RN   A   +V  EG  +LY+G++    RQ       FT + +++E +   
Sbjct: 147 --AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI--- 201

Query: 250 HGSQNLPSWETSLIGLVS---------GAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300
           +     P  E S +G +S         G +    + P D + +++  ++ +   +  ++ 
Sbjct: 202 YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST--LQA 259

Query: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           T+   ++  + GF  L+ G+  R++ +    +  + +Y+
Sbjct: 260 TS---RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 66/169 (39%), Gaps = 13/169 (7%)

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           V P+++VK R Q        +   Y++ +     IV+ EG   ++ GV  TA   +    
Sbjct: 37  VTPLDLVKCRRQV-------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 234 ANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA---IGPFSNAPLDTIKTRLQKDKS 290
             +  Y     +  +    +   S+ T +    S +   I      P + IK R Q    
Sbjct: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVP 149

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                N   +     ++V  EGF +LYKGITP   R  P     FT +E
Sbjct: 150 PPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 13/92 (14%)

Query: 261 SLIGLVSGAIGPFSNA--PLDTIKTRLQKDKS--TRNLSNWVRITTIGRQLVQEEGFRAL 316
           +L GLV  A GP  +A  PLD +K R Q D S    NL  W       RQ+V+ EG   +
Sbjct: 23  TLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-------RQIVRSEGATKV 73

Query: 317 YKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348
           + G+    +  +   A  +  YEF +     L
Sbjct: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL 105

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 7/100 (7%)

Query: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102
           P P   MS     +  V+   G  AG+  A+  HP D +  ++   R++ E T     L+
Sbjct: 206 PTPKREMSQLGQIS--VSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST-----LQ 258

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142
             + IY   G    + GL   ++ I    + ++  Y+ ++
Sbjct: 259 ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298

>Kwal_55.21338
          Length = 323

 Score = 63.2 bits (152), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 120/278 (43%), Gaps = 38/278 (13%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRF 135
           +PL  +  ++Q      E       ++   +IY  +G + F+ GL + + G      + +
Sbjct: 41  YPLIVVTTKLQTQDAKGEKLSLADTIK---DIYRKDGAMGFFAGLESALFGTTLSNFVYY 97

Query: 136 SSYE-FYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAE 194
             YE   R +L  R T  ++T  + L G  AG   A    NP+ V   R+          
Sbjct: 98  YCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNAT-AANPLWVANTRMTV-------- 148

Query: 195 QQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQN 254
           Q+  R  +   + IVK+EGI  L++G++  A     N    +TVY +L   +     ++ 
Sbjct: 149 QKSDRGTLSTIFDIVKDEGISGLFKGLN-PALILVINPIIQYTVYEQLKNWILSSRQTRT 207

Query: 255 L-PSWETSLIGLVSGAIGPF----SNAPLDTIKTRLQ---KDKST-----RNLSNWVRIT 301
           L PSW       + GA+G      S  P  T+K R+    + KS+     R+L       
Sbjct: 208 LSPSW-----AFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSL------L 256

Query: 302 TIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           ++  ++++++G   LY+GI  ++++     A  F   E
Sbjct: 257 SLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKE 294

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 80/167 (47%), Gaps = 9/167 (5%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           A +++ G  AG   A   +PL     RM + ++++ GT     L T  +I   EG+   +
Sbjct: 119 AESMLVGSIAGSLNATAANPLWVANTRMTV-QKSDRGT-----LSTIFDIVKDEGISGLF 172

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRT-LLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
           KGL   +I +I  + I+++ YE  +  +L+ RQT  +S    F+ G   G   A     P
Sbjct: 173 KGLNPALILVINPI-IQYTVYEQLKNWILSSRQTRTLSPSWAFILG-AVGKLAATGSTYP 230

Query: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223
              +K R+     H ++     R+ +     I+K++GI  LYRG+ +
Sbjct: 231 YVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGI 277

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKPPGFLRTGANIYSG 110
           ++ +P+   + G    L      +P  T+K RM +    +++    P   L   A I   
Sbjct: 206 RTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKK 265

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRF 135
           +G+L  Y+G+G  ++  I   A  F
Sbjct: 266 DGILGLYRGIGIKLVQSILTAAFLF 290

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 126/283 (44%), Gaps = 15/283 (5%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIY 108
           + ++  V+ + GG +         P++ +K+ MQ    + ++ +  T+  G L       
Sbjct: 9   QQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTA 68

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVS---TGNTFLAGVG 164
           + EG+++F++G  A V+   P  A+ F+  +  ++LL+ DR+    +    GN F  G  
Sbjct: 69  THEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAA 128

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSL 223
            G++  +L V  ++  + RL A      +  Q+  N +   Y   +K +G+  LYRG   
Sbjct: 129 GGLS--LLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVP 186

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKT 283
           +       +G  F +Y      L    G+       + L+G V       ++ PLDT++ 
Sbjct: 187 SVLGIIVYRGLYFGLYDSFKPVLLT--GALEGSFVASFLLGWVITMGASTASYPLDTVRR 244

Query: 284 RLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
           R+    ++     +       R++VQ+EG  +L+KG    + R
Sbjct: 245 RMMM--TSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 85/192 (44%), Gaps = 18/192 (9%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKP---PGFLRTGANIYSGEGLL 114
           A NL +GG AG    L  + LD  + R+    R ++ T      G L         +GLL
Sbjct: 119 AGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLL 178

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVV--STGNTFLAG--VGAGVTEA 170
             Y+G    V+GII    + F  Y+ ++ +L    TG +  S   +FL G  +  G + A
Sbjct: 179 GLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLL---TGALEGSFVASFLLGWVITMGASTA 235

Query: 171 VLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQAT 230
                P++ V+ R+    +  + +  KY  A+     IV++EG  +L++G      R   
Sbjct: 236 SY---PLDTVRRRM----MMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVA 288

Query: 231 NQGANFTVYSKL 242
             G   ++Y +L
Sbjct: 289 AAGV-ISLYDQL 299

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 80/203 (39%), Gaps = 14/203 (6%)

Query: 147 DRQTGVVSTGNTFLAGVGAGVTEAVLVVN--PMEVVKIRLQAQH--LHGAAEQQKYRNAI 202
           + QT     G  FL G   GV+ A+      P+E VK+ +Q Q   L   +   +Y+  +
Sbjct: 5   ETQTQQSHFGVDFLMG---GVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGIL 61

Query: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS- 261
                    EGI + +RG +    R    Q  NF    K+   L           W    
Sbjct: 62  DCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGN 121

Query: 262 -LIGLVSGAIGPFSNAPLDTIKTRLQKD----KSTRNLSNWVRITTIGRQLVQEEGFRAL 316
              G  +G +       LD  +TRL  D    KST     +  +  + ++ ++ +G   L
Sbjct: 122 LFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQ-RQFNGLLDVYKKTLKTDGLLGL 180

Query: 317 YKGITPRVMRVAPGQAVTFTVYE 339
           Y+G  P V+ +   + + F +Y+
Sbjct: 181 YRGFVPSVLGIIVYRGLYFGLYD 203

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 4/89 (4%)

Query: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNL----SNWVRITTIGRQLVQEEGFRALY 317
           L+G VS AI     AP++ +K  +Q  +         + +  I    ++    EG  + +
Sbjct: 18  LMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFW 77

Query: 318 KGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
           +G T  V+R  P QA+ F   + ++  L 
Sbjct: 78  RGNTANVLRYFPTQALNFAFKDKIKSLLS 106

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 77/181 (42%), Gaps = 26/181 (14%)

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218
           F+AG  AG      VV+P E VKI LQ Q    +A      NA+   Y   KEEG+  L+
Sbjct: 15  FIAGGVAGAVSRT-VVSPFERVKILLQVQS-STSAYNHGIINAVGQVY---KEEGVAGLF 69

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYH-----GSQNLPSWETSLIGLVSGAIGPF 273
           RG  L   R        F VY    + +  +H     G + L +W+    G + G +   
Sbjct: 70  RGNGLNCVRIFPYSAVQFVVYEWCKKHI--FHVDGTVGKEQLLNWQRLSAGALCGGMSVL 127

Query: 274 SNAPLDTIKTRLQKDKSTRNLSNWVR------------ITTIGRQLVQEEGFRALYKGIT 321
           +  PLD ++TRL     T NL+   +               + +   +E G R LY+GI 
Sbjct: 128 ATYPLDLVRTRL--SIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIY 185

Query: 322 P 322
           P
Sbjct: 186 P 186

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 13/179 (7%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           ++  +AGG AG        P + +K+ +Q+  +++      G +     +Y  EG+   +
Sbjct: 12  SIAFIAGGVAGAVSRTVVSPFERVKILLQV--QSSTSAYNHGIINAVGQVYKEEGVAGLF 69

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLL--ADRQTGVVSTGNTFLAGVGAGV-TEAVLVV 174
           +G G   + I P  A++F  YE+ +  +   D   G     N      GA     +VL  
Sbjct: 70  RGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT 129

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQ----AAYLIVK----EEGIGALYRGVSLTA 225
            P+++V+ RL  Q  + A   +     I        L+VK    E GI  LYRG+  T+
Sbjct: 130 YPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPTS 188

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G V+GA+     +P + +K  LQ   ST   ++ + I  +G Q+ +EEG   L++G    
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGI-INAVG-QVYKEEGVAGLFRGNGLN 75

Query: 324 VMRVAPGQAVTFTVYEFVRRHL 345
            +R+ P  AV F VYE+ ++H+
Sbjct: 76  CVRIFPYSAVQFVVYEWCKKHI 97

>Scas_667.4
          Length = 308

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 124/292 (42%), Gaps = 18/292 (6%)

Query: 52  KKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGANI 107
           KK +N A++ + GG +         P++ +K+ +Q    + ++ +  +K  G +      
Sbjct: 8   KKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRT 67

Query: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT---GVVSTGNTFLAGVG 164
              EG++AF++G  A VI   P  A+ F+  +  + +   ++    G    GN  LA  G
Sbjct: 68  AKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGN--LASGG 125

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQ---HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
           A    ++L V  ++  + RL A       G + Q  Y+  I      +  +G+  LYRG 
Sbjct: 126 AAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQ--YKGLIDVYKQTLATDGMAGLYRGF 183

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
             +       +G  F +Y  L   +    GS       + L+G +       ++ PLDT+
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAV--LTGSLEGSFLASFLLGWIVTTGASTASYPLDTV 241

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           + R+    ++     +       R++V  EG  +L+KG    ++R   G  V
Sbjct: 242 RRRMM--MTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 85/193 (44%), Gaps = 10/193 (5%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH--LHGAAEQQKYRNAIQAAYLIVKEEGI 214
           +  + GV A V +     +P+E VK+ +Q Q   +   +   KY+  I+      K EGI
Sbjct: 16  DFLMGGVSAAVAKTA--ASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGI 73

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI--GLVSGAIGP 272
            A +RG +    R    Q  NF    K+ + +  +   +    W    +  G  +G +  
Sbjct: 74  IAFWRGNTANVIRYFPTQALNFAFKDKI-KAMFGFKKEEGYGKWFAGNLASGGAAGGLSL 132

Query: 273 FSNAPLDTIKTRLQKD-KSTRNLSN--WVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
                LD  +TRL  D KS++   +  +  +  + +Q +  +G   LY+G  P V+ +  
Sbjct: 133 LFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIV 192

Query: 330 GQAVTFTVYEFVR 342
            + + F +Y+ ++
Sbjct: 193 YRGLYFGLYDSLK 205

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 122/304 (40%), Gaps = 46/304 (15%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIY------RRANEGTKPPG-----FLRTGANIYSG 110
           + G  A     +  +PLD  K  +Q          +NEG   P       +    NI+  
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR-TLLADRQTGVVSTGN-----------T 158
           +G+L  Y+G+    +    +  + F  Y F R + +  +  G+ S  N            
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG--IGA 216
            + GV A  + + L  +PM VV  R Q  H   +AE  K+ N I+  Y   +E    I A
Sbjct: 128 LVLGVAAA-SISQLFTSPMAVVATRQQTVH---SAESAKFTNVIKDIY---RENNGDITA 180

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQ--NLPSWETSLIGLVSGAIGPFS 274
            ++G+  T      N    +  + +L E     H +   +L + +  ++G++S  I    
Sbjct: 181 FWKGLR-TGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLV 239

Query: 275 NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLV---QEEGFRALYKGITPRVMRVAPGQ 331
             PL   K  LQ   S        + TT    L+   + EG ++L+KG+ P++ +    Q
Sbjct: 240 TQPLIVAKAMLQSAGS--------KFTTFQEALLYLYKNEGLKSLWKGVLPQLTKGVIVQ 291

Query: 332 AVTF 335
            + F
Sbjct: 292 GLLF 295

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 82/193 (42%), Gaps = 20/193 (10%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY--SGEGLLAFYK 118
           LV G  A     L   P+  +  R Q    A E  K   F     +IY  +   + AF+K
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSA-ESAK---FTNVIKDIYRENNGDITAFWK 183

Query: 119 GL-GAVVIGIIPKMAIRFSSYEFYRTLLADRQT---GVVSTGNTFLAGVGAGVTEAVLVV 174
           GL   + + I P  +I ++S++  + +     +   G +S    F+ GV + +  + LV 
Sbjct: 184 GLRTGLALTINP--SITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMI-STLVT 240

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
            P+ V K  LQ+          K+    +A   + K EG+ +L++GV     +    QG 
Sbjct: 241 QPLIVAKAMLQS-------AGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTKGVIVQGL 293

Query: 235 NFTVYSKLMERLQ 247
            F    +L + L+
Sbjct: 294 LFAFRGELTKSLK 306

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 11/105 (10%)

Query: 259 ETSLIGLVSGAIGPFSNAPLDTIKTRLQK--DKSTRNLSN---------WVRITTIGRQL 307
           E++L G V+ A+   +  PLD  KT +Q     S+   SN         +  +      +
Sbjct: 5   ESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINI 64

Query: 308 VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFG 352
            +E+G   LY+G+T   +       V F  Y F+R+      L G
Sbjct: 65  FKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLG 109

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 119/285 (41%), Gaps = 39/285 (13%)

Query: 77  PLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           P+D +K R+Q    +Y +        G + +   I S EG  A   G G  ++G   + +
Sbjct: 33  PIDVVKTRIQLEPTVYNK--------GMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 133 IRFSSYEFYRTLLADRQ--TGVVSTGNTFLAGVGAGVTE--AVLVVNPMEVVKIRLQAQH 188
            +F  YE ++ L  D       V+  NT   G  A + E  A + + P+E  +IRL    
Sbjct: 85  FKFGGYELFKKLAIDNMGYDNAVNYKNTIYIG-SAAIAEFFADIALCPLEATRIRL---- 139

Query: 189 LHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQ 247
                 Q  + N +   +  I+KEEG+G+ Y G +    +Q     A F V+        
Sbjct: 140 ----VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYF 195

Query: 248 EYHGSQNLPSWET-----SLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITT 302
              G +   S  T        GL +G      + P DT+ +++ K K     S      T
Sbjct: 196 GLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPGQS------T 249

Query: 303 IG--RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           IG   QL ++ GF   + G+  R++ V    ++ F +Y  +++ L
Sbjct: 250 IGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSL 294

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 83/197 (42%), Gaps = 25/197 (12%)

Query: 160 LAG-VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGAL 217
           LAG +G G+T + +V  P++VVK R+Q        E   Y   + +++  I+  EG GAL
Sbjct: 18  LAGAIGCGITHSSMV--PIDVVKTRIQL-------EPTVYNKGMVSSFKQIISSEGAGAL 68

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF---- 273
             G   T    +      F  Y    +   +  G  N  +++ + I + S AI  F    
Sbjct: 69  LTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNT-IYIGSAAIAEFFADI 127

Query: 274 SNAPLDTIKTRLQKDKSTRN--LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
           +  PL+  + RL    +  N     + RI       ++EEG  + Y G TP + +  P  
Sbjct: 128 ALCPLEATRIRLVSQPTFANGLFGGFSRI-------LKEEGVGSFYNGFTPILFKQIPYN 180

Query: 332 AVTFTVYEFVRRHLEGL 348
              F V+E       GL
Sbjct: 181 IAKFFVFEHAANAYFGL 197

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 261 SLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320
           +L G +   I   S  P+D +KTR+Q + +  N      + +  +Q++  EG  AL  G 
Sbjct: 17  ALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKG----MVSSFKQIISSEGAGALLTGF 72

Query: 321 TPRVMRVAPGQAVTFTVYEFVRR 343
            P ++  +   +  F  YE  ++
Sbjct: 73  GPTLLGYSLQGSFKFGGYELFKK 95

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 127/304 (41%), Gaps = 39/304 (12%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLG 121
           +AG   G       +PL TI   +Q   + NE  +P   L T   IY+  G++ ++ GL 
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQ--TKENEA-RPK--LETIKEIYNKNGIIGYFLGLE 70

Query: 122 AVVIGIIPKMAIRFSSYEF----YRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPM 177
           + V G+     + +  YE+     RTL   +    +ST  + LA   AG   AV   NP+
Sbjct: 71  SAVYGMATTNFVYYYFYEWCAKTARTLTTKQY---LSTWESILASTIAGSMTAV-ASNPI 126

Query: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT 237
            V   R+        +     R  I     IVK +G   L  G+   A    +N    +T
Sbjct: 127 WVANTRMTV----AKSNHSTLRTVID----IVKTDGPLTLLNGLK-PALVLVSNPIIQYT 177

Query: 238 VYSKLMERLQEYHGSQNL-PSWETSLIGLVSGAIGPF----SNAPLDTIKTR--LQKDKS 290
           VY +L   +      + L PSW       + GAIG      +  P  T+KTR  L ++  
Sbjct: 178 VYEQLKNLVLRLQRKKVLSPSW-----AFLLGAIGKLAATGTTYPYITLKTRMHLMQNDP 232

Query: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE-FVRRHLEGLG 349
               S W  I     ++V+++G   LY G+  ++++     A  F   E F++  L+ + 
Sbjct: 233 KHQKSMWSLIV----EIVKKDGVSGLYNGVAVKLVQSIMTAAFLFFFKEGFIQWSLKFIK 288

Query: 350 LFGS 353
           L  S
Sbjct: 289 LLRS 292

>Kwal_27.12481
          Length = 304

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 134/309 (43%), Gaps = 21/309 (6%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPG----FL 101
            SKK +N AV+ + GG +         P++ +K+ +Q    + ++ +   +  G    F 
Sbjct: 3   DSKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFK 62

Query: 102 RTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVSTGNTFL 160
           RT AN    EG+ +F++G  A VI   P  A+ F+  +  + +    ++ G        L
Sbjct: 63  RTAAN----EGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNL 118

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAE--QQKYRNAIQAAYLIVKEEGIGALY 218
           A  GA    +++ V  ++  + RL A    GA +  ++++   +      +  +GI  LY
Sbjct: 119 ASGGAAGGLSLMFVYSLDYARTRLAADS-KGAKKGGERQFNGLVDVYKKTLASDGIAGLY 177

Query: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278
           RG   +       +G  F  Y  L   L    GS       + L+G         ++ PL
Sbjct: 178 RGFLPSVVGIVVYRGLYFGGYDSLKPLL--LTGSLEGSFLASFLLGWAVTTGASTASYPL 235

Query: 279 DTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338
           DT++ R+    ++     +       R++V  EG ++L+KG    ++R   G  V  ++Y
Sbjct: 236 DTVRRRMM--MTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI-SMY 292

Query: 339 EFVRRHLEG 347
           + ++  L G
Sbjct: 293 DQLQMILFG 301

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 123/294 (41%), Gaps = 15/294 (5%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTG 104
           MS  K +N  +N + GG +         P++ +K+ +Q    + ++ +   +  G +   
Sbjct: 1   MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCF 60

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQ--TGVVSTGNTFLAG 162
               + EG+++F++G  A VI   P  A+ F+  +  + +   R+   G        LA 
Sbjct: 61  KRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLAS 120

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGALYRGV 221
            GA    ++L V  ++  + RL A         ++  N +   Y   +  +GI  LYRG 
Sbjct: 121 GGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPS--WETSLIGLVSGAIGPFSNAPLD 279
             +       +G  F +Y  L   L     + NL S    + L+G         ++ PLD
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLL----TGNLESSFIASFLLGWAVTTGASTASYPLD 236

Query: 280 TIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           T++ R+    ++     +       R++V  EG ++L+KG    ++R   G  V
Sbjct: 237 TVRRRMM--MTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 74/193 (38%), Gaps = 15/193 (7%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH--LHGAAEQQKYRNAIQAAYLIVKEEGI 214
           N  + GV A V++      P+E VK+ +Q Q   L   +  ++Y   +         EG+
Sbjct: 12  NFMMGGVSAAVSKT--AAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGV 69

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI--GLVSGAIGP 272
            + +RG +    R    Q  NF    K+               W    +  G  +G +  
Sbjct: 70  ISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSL 129

Query: 273 FSNAPLDTIKTRLQKDKST------RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
                LD  +TRL  D  +      R  +  V +    ++ +  +G   LY+G  P V+ 
Sbjct: 130 LFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVY---KKTLASDGIAGLYRGFLPSVVG 186

Query: 327 VAPGQAVTFTVYE 339
           +   + + F +Y+
Sbjct: 187 IVVYRGLYFGMYD 199

>Scas_715.45
          Length = 305

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/287 (19%), Positives = 113/287 (39%), Gaps = 41/287 (14%)

Query: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132
           PLD IK R+Q+    YR    G            I   EGL   + G+GA  IG   + A
Sbjct: 36  PLDLIKCRLQVDPTLYRSNTSGI---------IQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 133 IRFSSYEFYRTLLA-----DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ 187
            ++  YE ++ L +     D  T      + +L         A +++ P E +K++ Q  
Sbjct: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146

Query: 188 HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT--------VY 239
                       N I+    +  +EG+   Y+G++    RQ       FT        +Y
Sbjct: 147 MPPWC------NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY 200

Query: 240 SKLMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWV 298
           ++L  +  E    Q +     S + G ++G +    + P D + +++  ++      N  
Sbjct: 201 ARLPTKKSEMSALQQI---SVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMN-- 255

Query: 299 RITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
                 +++    GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 256 ---VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233
           V P++++K RLQ        +   YR+       I+K+EG+G L+ GV  T    +    
Sbjct: 34  VTPLDLIKCRLQV-------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 234 ANFTVYSKLMERLQEYHGSQNLPS---WETSLIGLVSGAIGPFSN---APLDTIKTRLQK 287
             +  Y +L +RL   H  ++  +   + TS+  L S     F++    P + IK + Q 
Sbjct: 87  GKYGGY-ELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT 145

Query: 288 DKSTRNLSNWVRITTIG-RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
                 +  W      G +++  +EG    YKGITP   R  P     FT +E
Sbjct: 146 -----TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 18/133 (13%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP---GFLRTGANIYSGEGLL 114
           ++ L++  TA  F  +   P + IKV+ Q        T PP     +     +Y+ EGL 
Sbjct: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQT-------TMPPWCNNVIEGWKKMYAKEGLN 168

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADR--QTGVVSTGNTFLAGVGAGV 167
            FYKG+  +    IP    +F+S+E      Y  L   +   + +     +F+ G  AG+
Sbjct: 169 GFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228

Query: 168 TEAVLVVNPMEVV 180
             A+ V +P +V+
Sbjct: 229 LCAI-VSHPADVM 240

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102
           P   + MS+ +    +V+ V G  AG+  A+  HP D +  ++   R+ NE         
Sbjct: 204 PTKKSEMSALQQI--SVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMN-----V 256

Query: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142
               IYS  G +  + GL   ++ I    + ++  Y+ ++
Sbjct: 257 ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 128/299 (42%), Gaps = 43/299 (14%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAI-R 134
           +PL TI  ++Q  +  +E  +    L T   IY  +GLL FY GL + + G    MA+  
Sbjct: 32  YPLVTITTKLQT-QGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYG----MALTN 86

Query: 135 FSSYEFY----RTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLH 190
           F  Y FY    R +L  R+   ++T  + L G  AG   A+   NP+ V   R+      
Sbjct: 87  FVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAI-ASNPIWVANTRMTV---- 141

Query: 191 GAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYH 250
                +  + A+     IVK++    L+ G+   A     N    +TV+ +L   +  ++
Sbjct: 142 ----TKSEKTALATIIEIVKKDSAKTLFNGLK-PALVLVMNPIVQYTVFEQLKNLVLAWN 196

Query: 251 GSQNL-PSWETSLIGLVSGAIGPF----SNAPLDTIKTRLQKDKSTRNLSN--------- 296
               L PSW       + GA+G      S  P  T+KTR+   +S ++  +         
Sbjct: 197 KQGILSPSW-----AFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGH 251

Query: 297 ---WVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE-FVRRHLEGLGLF 351
                 + ++  ++V+++G   LY+G+  ++ +     A  F   E  V   ++ L LF
Sbjct: 252 KASSKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILTAAFLFFFKEGLVLWSIKVLKLF 310

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112
           K  N   +++ G  AG   A+  +P+     RM + +           L T   I   + 
Sbjct: 107 KKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTA------LATIIEIVKKDS 160

Query: 113 LLAFYKGLG-AVVIGIIPKMAIRFSSYEFYRTL-LADRQTGVVSTGNTFLAGVGAGVTEA 170
               + GL  A+V+ + P   ++++ +E  + L LA  + G++S    FL G   G   A
Sbjct: 161 AKTLFNGLKPALVLVMNP--IVQYTVFEQLKNLVLAWNKQGILSPSWAFLLG-ALGKLAA 217

Query: 171 VLVVNPMEVVKIRLQ----AQHLHG-AAEQQKYRNAIQAAYL-----IVKEEGIGALYRG 220
                P   +K R+      +H    + ++ K   A   + L     IVK++G+  LYRG
Sbjct: 218 TGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRG 277

Query: 221 VSLTAAR 227
           V +  A+
Sbjct: 278 VGIKLAQ 284

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 122/323 (37%), Gaps = 62/323 (19%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTK------------------PPGFLRT 103
           ++G  A        +PLD +K  +Q   + +E  K                  PP  ++ 
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 104 GAN--------------IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEF-----YRTL 144
             N              IY  EG+   Y+GL   V+    +    F  Y F     +R  
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 145 LADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQ 203
           L +R+    +T    L G+ A  T  +   NP+ ++  R Q  Q + G        + + 
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFT-NPISLISARQQTRQGIDGD------NDFLT 180

Query: 204 AAYLIVKEE-GIGALYRGVSLTAARQATNQGANFTVYSKLMERL----------QEYHGS 252
            A  I KE+  I   ++G+ ++      N    +T Y KL + L          +    S
Sbjct: 181 VAKEIYKEQRSIKGFWKGLKVSLML-TINPSITYTSYEKLKDALFTTDTMNLKKELVDSS 239

Query: 253 QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG 312
             L  ++   +G++S  I      PL   K  LQ     RN SN+     +   L + EG
Sbjct: 240 SQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-----RNGSNFSSFQQVLYYLYKNEG 294

Query: 313 FRALYKGITPRVMRVAPGQAVTF 335
            R+ +KG++P++ +    Q + F
Sbjct: 295 LRSWWKGLSPQLAKGVLVQGLLF 317

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGE-GLLAFYKG 119
           +VA  T+ +F     +P+  I  R Q  R+  +G     FL     IY  +  +  F+KG
Sbjct: 146 IVAAATSQIF----TNPISLISARQQT-RQGIDGDN--DFLTVAKEIYKEQRSIKGFWKG 198

Query: 120 LG-AVVIGIIPKMAIRFSSYEFYRTLLADRQT-----------GVVSTGNTFLAGVGAGV 167
           L  ++++ I P  +I ++SYE  +  L    T             +S    F  GV + +
Sbjct: 199 LKVSLMLTINP--SITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSKM 256

Query: 168 TEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
             A++ + P+ + K  LQ    + ++ QQ         Y + K EG+ + ++G+S   A+
Sbjct: 257 ISAIITM-PLIISKAWLQRNGSNFSSFQQ-------VLYYLYKNEGLRSWWKGLSPQLAK 308

Query: 228 QATNQGANFTV---YSKLMERLQEY 249
               QG  F      +KLM+RL  Y
Sbjct: 309 GVLVQGLLFMFKGELTKLMKRLLLY 333

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 19/159 (11%)

Query: 197 KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYS---------KLMERLQ 247
           +Y +   A Y I K+EGI  LY+G++ +         + F  YS         KL+ R  
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINR-- 131

Query: 248 EYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL 307
               +    + E  L+G+V+ A       P+  I  R Q  +     ++++   T+ +++
Sbjct: 132 ---KNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFL---TVAKEI 185

Query: 308 VQEE-GFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
            +E+   +  +KG+   +M +    ++T+T YE ++  L
Sbjct: 186 YKEQRSIKGFWKGLKVSLM-LTINPSITYTSYEKLKDAL 223

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 117/279 (41%), Gaps = 27/279 (9%)

Query: 77  PLDTIKVRMQIYRRANEGTK-PPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRF 135
           P+D +K R+Q+     E  K   G + +   I   EG  A   G G  ++G   + A +F
Sbjct: 35  PIDVVKTRIQL-----EPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKF 89

Query: 136 SSYEFYRTLLADR---QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGA 192
             YE ++    D    +T        ++         A + + P+E  +IRL        
Sbjct: 90  GGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRL-------- 141

Query: 193 AEQQKYRNAIQAAYL-IVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHG 251
             Q  + N +   +  I+KEEGIG+ Y G +    +Q     A F V+           G
Sbjct: 142 VSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAANAYFGLAG 201

Query: 252 S-QNLPSWETSLIGLVSGAIGPFS----NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQ 306
           S +NL +   + I L++G     +    + P DT+ +++ K K     S +  +  + +Q
Sbjct: 202 SKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQ 261

Query: 307 LVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           L    GF   + G+  R++ V    ++ F +Y  +++ L
Sbjct: 262 L----GFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSL 296

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 83/197 (42%), Gaps = 25/197 (12%)

Query: 160 LAG-VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGAL 217
           LAG +G G T + +V  P++VVK R+Q + L       KY + +  ++  IV EEG  AL
Sbjct: 20  LAGAIGCGATHSAMV--PIDVVKTRIQLEPL-------KYSSGMVGSFRKIVGEEGAAAL 70

Query: 218 YRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF---- 273
             G   T    +      F  Y    +   +  G +    + T  I + S AI  F    
Sbjct: 71  LTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTP-IYIGSAAIAEFFADI 129

Query: 274 SNAPLDTIKTRLQKDKSTRN--LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331
           +  PL+  + RL    +  N  +  + RI       ++EEG  + Y G TP + +  P  
Sbjct: 130 ALCPLEATRIRLVSQPTFANGLVGGFARI-------LKEEGIGSFYNGFTPILFKQIPYN 182

Query: 332 AVTFTVYEFVRRHLEGL 348
              F V+E       GL
Sbjct: 183 IAKFVVFEHAANAYFGL 199

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336
           P+D +KTR+Q +     L     +    R++V EEG  AL  G  P ++  +   A  F 
Sbjct: 35  PIDVVKTRIQLEP----LKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFG 90

Query: 337 VYE-FVRRHLEGLG 349
            YE F +  ++ LG
Sbjct: 91  GYEVFKKAFVDALG 104

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 129/327 (39%), Gaps = 48/327 (14%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +AGG AG        PLD IK+  Q              G L  G +I+S + L   ++G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLL---ADRQTGVVSTGNTFLAGVGAGVTEAVLVVNP 176
             A ++ I P  A++F +YE  R ++    + +T      +  LAG+      +V    P
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLC-----SVFCTYP 172

Query: 177 MEVVKIRLQAQHLHGAAE-----QQKYRN-AIQA----AYLIVKEEGIGALYRGVSLTAA 226
           ++++++RL     H         +Q Y   A +A    AY+          YRG   T  
Sbjct: 173 LDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVI 232

Query: 227 RQATNQGANFTVYSKLMERL-------------------------QEYHGSQNLP--SWE 259
                 G +F  +    + L                         Q     + +P  +W 
Sbjct: 233 GMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWA 292

Query: 260 TSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSN-WVRITTIGRQLVQEEGFRALYK 318
             L G ++G     +  P + I+ RLQ    T  L + +  ++ + + +  E G+R  + 
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFV 352

Query: 319 GITPRVMRVAPGQAVTFTVYEFVRRHL 345
           G++   ++V P  A +F VYE ++ ++
Sbjct: 353 GLSIGYIKVTPMVACSFFVYERMKWYM 379

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 94/248 (37%), Gaps = 56/248 (22%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRM----------------QIYRR-A 91
           + SK+       L +G  AGL    C +PLD I+VR+                QIY   A
Sbjct: 144 IPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPA 203

Query: 92  NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL------ 145
           +E      ++      +       FY+G    VIG+IP   + F +++ +  +L      
Sbjct: 204 SEALSSKAYVPKWFAQWCN-----FYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIA 258

Query: 146 ----------------ADRQTG------VVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIR 183
                            D QT        ++T    LAG  AG+        P E+++ R
Sbjct: 259 PYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQT-AAYPFEIIRRR 317

Query: 184 LQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLM 243
           LQ   +    E  K+ +  + A +I  E G    + G+S+   +       +F VY    
Sbjct: 318 LQVGAVTNPLEH-KFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVY---- 372

Query: 244 ERLQEYHG 251
           ER++ Y G
Sbjct: 373 ERMKWYMG 380

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 17/135 (12%)

Query: 225 AARQATNQGANFTVY----------SKLMERLQ----EYHGSQNLPS-WETSLIGLVSGA 269
           AA++ATN G   TV           S L+ R       Y   QN     ++ L G V+G+
Sbjct: 6   AAKKATNDGTGGTVTACSMNSNTKNSGLLPRKSGDAAAYTSKQNFDYILKSGLAGGVAGS 65

Query: 270 IGPFSNAPLDTIKTRLQKDKS--TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRV 327
                 APLD IK   Q       +   ++  +   G  +   +  R +++G +  ++R+
Sbjct: 66  CAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRI 125

Query: 328 APGQAVTFTVYEFVR 342
            P  AV F  YE +R
Sbjct: 126 FPYAAVKFIAYEQIR 140

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/281 (19%), Positives = 122/281 (43%), Gaps = 36/281 (12%)

Query: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136
           PLD +K R+Q+  +    +   GF +  AN    EG    Y G GA  +G   + A ++ 
Sbjct: 38  PLDLVKCRLQVNPKLYT-SNLQGFRKIIAN----EGWKKVYTGFGATFVGYSLQGAGKYG 92

Query: 137 SYEFYRTLLADRQTGVVSTGNT-FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQ 195
            YE+++ L +      +S G T +L         A +++ P E +K++ Q          
Sbjct: 93  GYEYFKHLYSSW----LSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQ-------TTM 141

Query: 196 QKYRNAIQAAY--LIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL------- 246
             + N +   +  +  +  G+ A Y+G+     RQ       FT + K+++++       
Sbjct: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK 201

Query: 247 -QEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIG 304
            +E +  Q +     S + G ++G +    + P D + +++  ++          ++   
Sbjct: 202 KEEMNALQQI---SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE-----SMSVAS 253

Query: 305 RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
           +++ Q+ GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 254 KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYV 294

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 5/94 (5%)

Query: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117
           +V+ V G  AG+  A   HP D +  ++   R+ANE             IY   G    +
Sbjct: 212 SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS-----VASKRIYQKIGFTGLW 266

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG 151
            GL   ++ I    + ++  Y+ ++  +    TG
Sbjct: 267 NGLMVRIVMIGTLTSFQWLIYDSFKAYVGLPTTG 300

>Kwal_27.11419
          Length = 298

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 125/309 (40%), Gaps = 56/309 (18%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN-----EGTKPPGFLRTGANIYSGEGLL 114
           + + G   GL  A+   P D +K R+Q  + +N        + PG       ++ G    
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIETPG------QLWKGTLPS 63

Query: 115 AFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGN---TFLAG-------VG 164
           A    +G+         A+  S+    R+ +AD++   ++  N   +FL         + 
Sbjct: 64  ALRTSVGS---------ALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLIS 114

Query: 165 AGVTEAVLVVN--PMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222
             +T A + V   P+ V+K+R ++   +       Y++  +AA  I + EGI  L+ G  
Sbjct: 115 GAITRAAVGVATMPITVLKVRFESTMYN-------YKSLGEAATHIYRSEGIRGLFSGCG 167

Query: 223 LTAARQATNQGANFTVYS-------KLMERLQEYHGSQNLPSWETSLI-----GLVSGAI 270
            T  R A   G     Y        +++      H    + S +TS I        S ++
Sbjct: 168 ATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASL 227

Query: 271 GPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPG 330
                +P DTIKTR+Q      N S +       + +++ E  R L+ G++ R+ R A  
Sbjct: 228 ATTITSPFDTIKTRMQ-----LNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALS 282

Query: 331 QAVTFTVYE 339
             + + +YE
Sbjct: 283 AGIAWGIYE 291

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVR-ITTIGRQLVQEEGFRALYKGITP 322
           G V G        P D +KTRLQ++KS+ NL + VR I T G+          L+KG  P
Sbjct: 14  GFVGGLTSAVILQPFDLLKTRLQQNKSS-NLLDVVRSIETPGQ----------LWKGTLP 62

Query: 323 RVMRVAPGQAVTFTVYEFVR 342
             +R + G A+  +    VR
Sbjct: 63  SALRTSVGSALFLSTLNIVR 82

>Scas_718.24
          Length = 337

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 132/308 (42%), Gaps = 16/308 (5%)

Query: 49  MSSKK-STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRT 103
           MS++K  +N A++ + GG +         P++ +K+ +Q    + ++    TK  G +  
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 104 GANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT---GVVSTGNTFL 160
                  EG+++F++G  A VI   P  A+ F+  +  + +   ++    G    GN  L
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGN--L 150

Query: 161 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGALYR 219
           A  GA    ++L V  ++  + RL A          +  N +   Y   +K +G+  LYR
Sbjct: 151 ASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYR 210

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLD 279
           G   +       +G  F +Y  +   L    GS       + L+G V        + PLD
Sbjct: 211 GFLPSVVGIIVYRGLYFGLYDSIKPVL--LTGSLEGSFLASFLLGWVVTTGASTCSYPLD 268

Query: 280 TIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
           T++ ++    ++     +       +++V  EG  +L+KG    ++R   G  V  ++Y+
Sbjct: 269 TVRRKMM--MTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI-SMYD 325

Query: 340 FVRRHLEG 347
            ++  L G
Sbjct: 326 QLQMILFG 333

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 125/301 (41%), Gaps = 15/301 (4%)

Query: 55  TNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGANIYSG 110
           +N  ++ + GG +         P++ +K+ +Q    + ++     K  G L       + 
Sbjct: 21  SNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQ 80

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVSTGNTFLAGVGAGVTE 169
           EG+++F++G  A VI   P  A+ F+  +  + +    ++ G        LA  GA    
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGAL 140

Query: 170 AVLVVNPMEVVKIRLQAQ---HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAA 226
           ++L V  ++  + RL A       G A Q  +   I      +K +G+  LYRG   +  
Sbjct: 141 SLLFVYSLDYARTRLAADSKSSKKGGARQ--FNGLIDVYKKTLKSDGVAGLYRGFLPSVV 198

Query: 227 RQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286
                +G  F +Y  L   L    GS       + L+G V        + PLDT++ R+ 
Sbjct: 199 GIVVYRGLYFGMYDSLKPLL--LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMM 256

Query: 287 KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346
              ++     +       R++V  EG  +L+KG    ++R   G  V  ++Y+ ++  L 
Sbjct: 257 --MTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI-SMYDQLQMILF 313

Query: 347 G 347
           G
Sbjct: 314 G 314

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 86/207 (41%), Gaps = 35/207 (16%)

Query: 61  LVAGGTAGLFEALCCHPLDTIKVRM----QIYRRANEGTKP------------------- 97
           L+AG   G+ E+L   P + IK  +     I  +  E  +P                   
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 98  --PGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVST 155
                L    ++Y   G  AF +G  A +   I   +I+F++Y  ++ LL  R       
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN----DK 194

Query: 156 GNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIG 215
            ++ + G+    T  V +  P++VVK R+ +Q+      + +Y+N +   Y I  +EG+ 
Sbjct: 195 ASSVITGLATSFT-LVAMTQPIDVVKTRMMSQN-----AKTEYKNTLNCMYRIFVQEGMA 248

Query: 216 ALYRGVSLTAARQATNQGANFTVYSKL 242
             ++G      +   + G  FTVY ++
Sbjct: 249 TFWKGSIFRFMKVGISGGLTFTVYEQV 275

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 80/209 (38%), Gaps = 38/209 (18%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRL----QAQH---------------LHGAAEQ-- 195
           N  +AG   G+ E++ ++ P E +K  L       H                H  A +  
Sbjct: 77  NLLIAGTLTGIVESLFII-PFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKST 135

Query: 196 -----QKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYH 250
                +K   A++  Y   +  G  A  +G + T  RQ  N    FT Y+     LQ  +
Sbjct: 136 PVARIEKLLPAVKHMY---QTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN 192

Query: 251 GSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQE 310
              +     + + GL +         P+D +KTR+    +     N   +  + R  VQE
Sbjct: 193 DKAS-----SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKN--TLNCMYRIFVQE 245

Query: 311 EGFRALYKGITPRVMRVAPGQAVTFTVYE 339
            G    +KG   R M+V     +TFTVYE
Sbjct: 246 -GMATFWKGSIFRFMKVGISGGLTFTVYE 273

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 128/310 (41%), Gaps = 43/310 (13%)

Query: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           MS K    PA +LV+G   GL       PLD +K R+Q   +A+        +RT   ++
Sbjct: 1   MSEKAGGVPA-HLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLRSVLREVRTTRELW 58

Query: 109 SGEGLLAFYKGLG-AVVIGII--PKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGV 163
            G    A    +G A+ + ++   + A+   S    R+ L  R      + TG    A V
Sbjct: 59  RGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAV 118

Query: 164 GAGVTEAVLVVNPMEVVKIRLQAQ--HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221
           G       LV  P+ V+K+R ++     +G AE  ++         I + EG    ++G 
Sbjct: 119 G-------LVTMPITVIKVRYESTLYAYNGLAEATRH---------IWRSEGARGFFKGA 162

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLI------------GLVSGA 269
           + T  R A   G    +Y +  E L     +  L + E+  +              +S +
Sbjct: 163 AATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSAS 222

Query: 270 IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAP 329
           +     AP DTIKTR+Q        S+ V      R +V EE  R L+ G++ R+ R A 
Sbjct: 223 LATTLTAPFDTIKTRMQLQ------SHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAM 276

Query: 330 GQAVTFTVYE 339
              + + +YE
Sbjct: 277 SACIAWGIYE 286

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 77/185 (41%), Gaps = 28/185 (15%)

Query: 170 AVLVVNPMEVVKIRLQ---AQHLHGAAEQ-----QKYRNAIQAAYLIVKEEGIG-ALYRG 220
           +V  + P++++K RLQ   A  L     +     + +R  + +A        IG ALY  
Sbjct: 22  SVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRGTLPSAL----RTSIGSALYLS 77

Query: 221 VSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDT 280
           + L  +R A  +G+     S L+ RLQ Y   QNL      L G +S A       P+  
Sbjct: 78  L-LNYSRSALARGSEARTRSSLLPRLQSY---QNL------LTGALSRAAVGLVTMPITV 127

Query: 281 IKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340
           IK R +       L  +  +    R + + EG R  +KG     +R AP   +   +YE 
Sbjct: 128 IKVRYES-----TLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQ 182

Query: 341 VRRHL 345
            +  L
Sbjct: 183 AKEML 187

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 85/192 (44%), Gaps = 20/192 (10%)

Query: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234
           NP+E VK RLQ Q    A   + Y    QA  LI + EG+  L +G++   A Q    G+
Sbjct: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89

Query: 235 NFTVYSKLMERL-------QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287
              +Y  L   L       +  +G+  L    T+            S  PL  +KTR+Q 
Sbjct: 90  RLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGS--PLQLVKTRMQA 147

Query: 288 DKSTRNLSNWVRITTIGRQLV---QEEGFRALYKGITPRVMRVAPGQAVTFTVY----EF 340
               R      R   +GR+LV   ++ G R LY+G+   ++R   G AV   VY    E 
Sbjct: 148 LAPRRVPPLPGR---MGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204

Query: 341 VRRHL-EGLGLF 351
           + RH+ +G+ L+
Sbjct: 205 LSRHVPDGMALY 216

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 108/275 (39%), Gaps = 24/275 (8%)

Query: 76  HPLDTIKVRMQIYRRANEGTKP--PGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAI 133
           +P++T+K R+Q+      G      G  +  + IY  EGL    +GL       I     
Sbjct: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89

Query: 134 RFSSYEFYR-----TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH 188
           R   Y+  R      +L+DR+T   +          A       + +P+++VK R+QA  
Sbjct: 90  RLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQALA 149

Query: 189 LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248
                           A  + K+ G+  LY+GV     R          VYS   E L  
Sbjct: 150 PRRVPPLPGRMGRRLVA--LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL-- 205

Query: 249 YHGSQNLPSWET--SLIGLVSGAIGPFSNAPLDTIKTRLQKDKS--TRNLSNWVRITTIG 304
              S+++P      +L   +S      +  P D   TR+   +    R   + +  T   
Sbjct: 206 ---SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKT--- 259

Query: 305 RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339
              V++EGF ALYKG   +++R+AP   +  T+ E
Sbjct: 260 ---VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 123/302 (40%), Gaps = 46/302 (15%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119
           +L+ G + GL  A+   P D +K R+Q         K     +T  +I +   L   ++G
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQ-------QDKTSTLWKTLKSIETPSQL---WRG 59

Query: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLAD-RQTGVVSTGNTFLAGV-------GAGVTEAV 171
                I      A+  +     R  ++  + TG  STG+++L  +          VT A+
Sbjct: 60  ALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTG--STGSSYLPQLNMYENMFSGAVTRAL 117

Query: 172 --LVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229
             L+  P+ V+K+R +       +   +Y +   A   I + EG+   +RG   TA R A
Sbjct: 118 TGLITMPITVIKVRYE-------STLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDA 170

Query: 230 TNQGANFTVYSK--------LMERLQEYHGSQNLPSWETSLI----GLVSGAIGPFSNAP 277
              G     Y +        L   + + +      ++ ++LI       +  I     AP
Sbjct: 171 PYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAP 230

Query: 278 LDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337
            DT+KTR+Q +      + +   T+    +  +E  R L+ GI+ R+ R A    + + +
Sbjct: 231 FDTVKTRMQLEP-----AKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGI 285

Query: 338 YE 339
           YE
Sbjct: 286 YE 287

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 260 TSLIGLVSGA-IGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYK 318
           T LIG  SG  +      P D +KTRLQ+DK+          +T+ + L   E    L++
Sbjct: 9   THLIGGFSGGLVSAIILQPFDLLKTRLQQDKT----------STLWKTLKSIETPSQLWR 58

Query: 319 GITPRVMRVAPGQAVTFTVYEFVRRHLE 346
           G  P  +R + G A+  T+   +R+ + 
Sbjct: 59  GALPSCIRTSVGSAMYLTMLNSIRQAIS 86

>Scas_705.9
          Length = 323

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 114/300 (38%), Gaps = 38/300 (12%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGT----------KPPGFLRTGANIYSGE 111
           + G  A     +  +PLD  K  +Q   +A E            +    +R    I+   
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 112 GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR------TLLADRQ---TGVVSTGNTFLAG 162
           GL   Y+G+   V     +    F  Y F R       LL + Q      +ST    + G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG-IGALYRGV 221
           VGA     V V NP+EV+   L  Q      +   + + ++  Y  V+  G + + ++G 
Sbjct: 128 VGAAALTQV-VNNPIEVI---LTKQQTTDDKDNVDFYSVLKQIY--VESNGKLSSYWKGF 181

Query: 222 SLTAARQATNQGANFTVYSKLMERL------QEYHGSQNLPSWETSLIGLVSGAIGPFSN 275
            ++      N    F  Y +  + L       E   S  L   +  ++G ++  I     
Sbjct: 182 KVSLIL-TVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIIT 240

Query: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335
            PL   K  LQ     R+ S +     + R L +EEG  AL+KG+ P++ +    Q + F
Sbjct: 241 QPLIVAKVSLQ-----RSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVF 295

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 84/190 (44%), Gaps = 30/190 (15%)

Query: 42  QPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFL 101
           Q  P N +S+ +       L+ G  A     +  +P++ I  + Q      +      F 
Sbjct: 111 QARPINSISTVEE------LIVGVGAAALTQVVNNPIEVILTKQQ----TTDDKDNVDFY 160

Query: 102 RTGANIY--SGEGLLAFYKGLG-AVVIGIIPKMAIRFSSYEFYRTLLADR-------QTG 151
                IY  S   L +++KG   ++++ + P  +I F++Y+ ++ +L  +        +G
Sbjct: 161 SVLKQIYVESNGKLSSYWKGFKVSLILTVNP--SITFAAYQRFKDILLKQVSNSEKSYSG 218

Query: 152 VVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE 211
            ++    F+ G  A +   + +  P+ V K+ LQ  +        K+++  +    + KE
Sbjct: 219 QLTVNQNFILGALAKIISTI-ITQPLIVAKVSLQRSN-------SKFKHFEEVLRYLYKE 270

Query: 212 EGIGALYRGV 221
           EG+ AL++GV
Sbjct: 271 EGVLALWKGV 280

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 10/107 (9%)

Query: 255 LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ---KDKSTRNLSN----WVRITTIGRQL 307
           + + E+++ G ++  +      PLD  KT +Q   K K T  LS      +R   + R L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 308 VQ---EEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLF 351
           ++   + G R LY+G++  V          F  Y F+RR    L L 
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLL 107

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/306 (19%), Positives = 129/306 (42%), Gaps = 15/306 (4%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGA 105
           + K  +N A++ + GG +         P++ +K+ +Q    + ++ +   +  G +    
Sbjct: 4   TKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQ 63

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVS--TGNTFLAG 162
                EG+++F++G  A VI   P  A+ F+  +  + +    ++ G      GN    G
Sbjct: 64  RTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGG 123

Query: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAY-LIVKEEGIGALYRGV 221
           +  G++  ++ V  ++  + RL A         ++  N +   Y   +  +G+  LYRG 
Sbjct: 124 IAGGLS--LMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281
             +       +G  F +Y      L    GS       + L+G V       ++ PLDT+
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLL--LTGSLEGSFIASFLLGWVVTTGASTASYPLDTV 239

Query: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341
           + R+    ++     +       +++V  EG  +L+KG    ++R   G  V  ++Y+ +
Sbjct: 240 RRRMM--MTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI-SLYDQL 296

Query: 342 RRHLEG 347
           +  L G
Sbjct: 297 QMILFG 302

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 120/290 (41%), Gaps = 10/290 (3%)

Query: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQ----IYRRANEGTKPPGFLRTGA 105
           + KK +N A++ + GG +         P++ +K+ +Q    + ++ +   +  G +    
Sbjct: 3   TDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFK 62

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-DRQTGVVSTGNTFLAGVG 164
              + EG+ +F++G  A VI   P  A+ F+  +  + +    ++ G        LA  G
Sbjct: 63  RTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGG 122

Query: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYL-IVKEEGIGALYRGVSL 223
                ++L V  ++  + RL A         ++  N +   Y   +  +G+  LYRG   
Sbjct: 123 LAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLP 182

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKT 283
           +       +G  F +Y  L   L    GS       + L+G         ++ PLDT++ 
Sbjct: 183 SVVGIVVYRGLYFGLYDSLKPLL--LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRR 240

Query: 284 RLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333
           R+    ++     +       R++V  EG ++L+KG    ++R   G  V
Sbjct: 241 RMMM--TSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 81/193 (41%), Gaps = 16/193 (8%)

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH--LHGAAEQQKYRNAIQAAYLIVKEEGI 214
           +  + GV A V++      P+E VK+ +Q Q   +   +  ++Y   ++       +EG+
Sbjct: 13  DFLMGGVSAAVSKTA--AAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGV 70

Query: 215 GALYRGVSLTAARQATNQGANFTVYSKL--MERLQEYHGSQNLPSWETSLIGLVSGAIGP 272
            + +RG +    R    Q  NF    K+  M   ++  G     +   +  GL  G    
Sbjct: 71  ASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGLAGGLSLL 130

Query: 273 FSNAPLDTIKTRLQKDKST------RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
           F  + LD  +TRL  D  +      R  +  V +    ++ +  +G   LY+G  P V+ 
Sbjct: 131 FVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVY---KKTLASDGVAGLYRGFLPSVVG 186

Query: 327 VAPGQAVTFTVYE 339
           +   + + F +Y+
Sbjct: 187 IVVYRGLYFGLYD 199

>Kwal_55.21106
          Length = 328

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 111/307 (36%), Gaps = 45/307 (14%)

Query: 62  VAGGTAGLFEALCCHPLDTIKVRMQIYRR-----ANEGTKPPG------------FLRTG 104
           + G  A     +  +PLD +K  +Q   +     +  G KP               L   
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADRQTGVVSTGNTF 159
             I+  +G+L  Y+GL   +I    +    F  Y      F+R  L   + G  ST    
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEEL 127

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           L G+ A     +   +P+ V+  R   Q    +  +  +R  +   Y   ++  I   +R
Sbjct: 128 LLGIVAAAVSQIFT-SPIGVISTR---QQTSTSGSKGGFREVLHQIY--SEQNNITGFWR 181

Query: 220 GVSLTAARQATNQGANFTVYSKLMERL-----------QEYHGSQNLPSWETSLIGLVSG 268
           G  ++      N    F  Y KL +             Q    S  L   +  L+G+ S 
Sbjct: 182 GFKVSLIL-TVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSK 240

Query: 269 AIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVA 328
            I      PL   K  LQ     R  SN+     +   L ++EG  +L+KG+ P++ +  
Sbjct: 241 VISTLITQPLIVSKAYLQ-----RTGSNFQSFQQVLLYLYKQEGLISLWKGLAPQLSKGI 295

Query: 329 PGQAVTF 335
             Q + F
Sbjct: 296 LVQGLLF 302

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 100/262 (38%), Gaps = 37/262 (14%)

Query: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---------QTGVVSTG 156
            +Y  EG    Y GL A ++G      I+  SY F+ TL+            +    ST 
Sbjct: 96  KVYRNEGFGGLYHGLSASLLGTF----IQSFSYFFWYTLIRRHYFRVKKVKGEAARFSTI 151

Query: 157 NTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGA 216
              L  + A  T   L  NP+ +V  + Q +   G      ++   +  Y    E+GI  
Sbjct: 152 EELLLSMLAAATSQ-LFTNPINIVSTKQQTRR--GLEGDNSFKAIAKEVY---DEDGITG 205

Query: 217 LYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS----------LIGLV 266
            ++ + ++      N    +    KL + L  YH   N      S          LIG++
Sbjct: 206 FWKSLKVSLVL-TINPSITYASAEKLKDIL--YHVEWNAKDLNDSSLQLKPGQNFLIGVL 262

Query: 267 SGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
           S  I      PL   K  LQ     R+ S +     +   L + EG  AL+KG+ P++ +
Sbjct: 263 SKIISTCLTHPLIVAKASLQ-----RSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQLTK 317

Query: 327 VAPGQAVTFTVYEFVRRHLEGL 348
               Q + F     + +H++ L
Sbjct: 318 GVIVQGLLFMFKGELAKHIKKL 339

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 195 QQKYRNAIQAAYLIVKEEGIGALYRGVS---LTAARQATNQGANFTVYSKLMERLQEYHG 251
           +Q+Y++A+     + + EG G LY G+S   L    Q+ +    +T+  +   R+++  G
Sbjct: 84  EQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKG 143

Query: 252 -SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQE 310
            +    + E  L+ +++ A       P++ + T   K ++ R L        I +++  E
Sbjct: 144 EAARFSTIEELLLSMLAAATSQLFTNPINIVST---KQQTRRGLEGDNSFKAIAKEVYDE 200

Query: 311 EGFRALYKGI 320
           +G    +K +
Sbjct: 201 DGITGFWKSL 210

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 76/159 (47%), Gaps = 12/159 (7%)

Query: 192 AAEQQKYRNAIQAAYLIVKEEGIGALYRGV---SLTAARQATNQGANFTVYSKLMERLQE 248
           AAEQ  Y+ A+ A   I   EG+  LYRG+   ++    Q+ +    +T+  K   RL++
Sbjct: 68  AAEQ--YKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQ 125

Query: 249 YHGSQ-NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL 307
             G      + E  ++G+V+ A       P++ + TR Q        ++   + T+ R++
Sbjct: 126 ARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAAD---MRTVAREV 182

Query: 308 VQEEGFRALYKGI-TPRVMRVAPGQAVTFTVYEFVRRHL 345
             E G+R  + G+    V+ V P  ++T+  YE +R  L
Sbjct: 183 HAENGWRGFWAGLKVSLVLTVNP--SITYATYERLREAL 219

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 127/350 (36%), Gaps = 73/350 (20%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY-------------------RRANEGTKP--- 97
           N V G TA     +  +PLD  K  +Q                     RR N   KP   
Sbjct: 5   NAVIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNR-IKPIAL 63

Query: 98  ---------PGFLRTGANIYSGEGLLAFYKGLG-AVVIGIIPKMAIRFSSYEFYRTLL-- 145
                     G L     IY  EG+   Y+GLG + V G I        SY F+ TL+  
Sbjct: 64  RSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSF-----SYFFWYTLVRK 118

Query: 146 -------ADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ-HLHGAAEQQK 197
                  A       ST    + G+ A  T   L VNP+ VV  R Q +    GAA+ + 
Sbjct: 119 HYFRLKQARGGDARFSTPEELVLGIVAAATSQ-LFVNPINVVATRQQTRGQAAGAADMRT 177

Query: 198 YRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERL--------QEY 249
               + A      E G    + G+ ++      N    +  Y +L E L           
Sbjct: 178 VAREVHA------ENGWRGFWAGLKVSLVL-TVNPSITYATYERLREALFPTPAAASHLV 230

Query: 250 HGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQ 309
             +  L   +  ++G++S  +      PL   K  LQ     R+ S +     +   L  
Sbjct: 231 DSAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQ-----RSGSCFQDFHQVLHHLYS 285

Query: 310 EEGFRALYKGITPRVMRVAPGQAVTFT----VYEFVRRHLEGLGLFGSAK 355
            EG  +L+KG+ P++ +    Q + F     + + +R+ +  L L  S++
Sbjct: 286 TEGPLSLWKGLGPQITKGVLVQGLLFMFKGELTKMLRKLMFYLALLRSSR 335

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 132/330 (40%), Gaps = 59/330 (17%)

Query: 51  SKKSTNP--AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108
           ++++T P  + +L+ G   GL  A+   PLD +K R+Q  ++A              N+ 
Sbjct: 2   TEQATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----------LWKNLK 51

Query: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGN----------- 157
             +  L  ++G     +      A+  S     R+ LA R+  V S  N           
Sbjct: 52  EIDSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSS 111

Query: 158 ----TFLAGVGAGVTEAVLV---VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVK 210
               T    +  G     LV     P+ V+K+R ++   +       Y +  +A   I  
Sbjct: 112 LPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYN-------YSSLKEAITHIYT 164

Query: 211 EEGIGALYRGVSLTAARQATNQGANFTVYSK--------LMERLQEYHGSQNLPSWETSL 262
           +EG+   +RG   T  R A   G    +Y K        L  R   Y+      ++ ++ 
Sbjct: 165 KEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTT 224

Query: 263 I----GLVSGAIGPFSNAPLDTIKTRLQKD--KSTRNLSNWVRITTIGRQLVQEEGFRAL 316
           +     ++S ++     AP DTIKTR+Q +  K T + + +  I       V+ E    L
Sbjct: 225 VNTTSAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTSI-------VKNENVLKL 277

Query: 317 YKGITPRVMRVAPGQAVTFTVY-EFVRRHL 345
           + G++ R+ R A    + + +Y E V+R +
Sbjct: 278 FSGLSMRLARKAFSAGIAWGIYEELVKRFM 307

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 254 NLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQL 307
           NL +     +G +SG +      P D ++ R Q       +   R  S    + TIG+  
Sbjct: 7   NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKT- 65

Query: 308 VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345
              EG +  YKG+T  + +V P  AV++ VYE +R  +
Sbjct: 66  ---EGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAM 100

 Score = 30.8 bits (68), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRA-NE-GTKPPGFLRTGANIYSGEGLLAFY 117
            L  G  +G       +P D ++ R Q+     NE G +          I   EG   +Y
Sbjct: 13  KLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYY 72

Query: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 147
           KGL A +  +IP  A+ +  YE  R  + +
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 30.8 bits (68), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219
           +  +  GV + +  V P ++++ R Q   + G     +Y++   A   I K EG    Y+
Sbjct: 16  MGAISGGVAQTL--VYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYK 73

Query: 220 GVSLTAARQATNQGANFTVYSKLMERLQEY 249
           G++    +   +   ++ VY  + E + E+
Sbjct: 74  GLTANLFKVIPSTAVSWLVYEVIREAMVEW 103

>Scas_328.1
          Length = 227

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 13/135 (9%)

Query: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAG--VGAGVT 168
           +G+L  Y+G    V+GI+    + F  Y+  + +L    TG  S  N FL    +G  VT
Sbjct: 93  DGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLL---TG--SFENAFLPSFLLGWAVT 147

Query: 169 -EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227
             A     P++ V+ R+    +  + +  KY+ AI     IV +EG+ +L++G      R
Sbjct: 148 ISASTTSYPLDTVRRRM----MMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

Query: 228 QATNQGANFTVYSKL 242
                G   ++Y +L
Sbjct: 204 GVAAAGV-ISLYDQL 217

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 4/115 (3%)

Query: 212 EGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIG 271
           +G+  LYRG   +       +G  F +Y  L   L    GS       + L+G       
Sbjct: 93  DGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLT--GSFENAFLPSFLLGWAVTISA 150

Query: 272 PFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326
             ++ PLDT++ R+    ++     +       +Q+V +EG  +L+KG    + R
Sbjct: 151 STTSYPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 76  HPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGA 122
           +PLDT++ RM +   + +  K  G +     I S EG+ + +KG GA
Sbjct: 155 YPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGA 199

>Scas_613.24
          Length = 177

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 14/87 (16%)

Query: 263 IGLVSGAIGPFSNA----PLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYK 318
           + LVSG IG  S+A    PLD +KTR+Q+ K     + W  I  I +  +Q       ++
Sbjct: 10  VHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGA---TLWSAIKDI-KDPIQ------FWR 59

Query: 319 GITPRVMRVAPGQAVTFTVYEFVRRHL 345
           G  P  +R + G A+  +    +R  L
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQL 86

 Score = 34.7 bits (78), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 51 SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN 92
          S KS   +V+LV+G   GL  A+   PLD +K R+Q ++ A 
Sbjct: 2  SDKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGAT 43

 Score = 33.9 bits (76), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLA 115
           NL+ G  A         P+  +KVR +     Y+  NE  K         +IY  EG+  
Sbjct: 109 NLLTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIK---------DIYKMEGISG 159

Query: 116 FYKGLGAVV-IGIIPK 130
           F+KG G  V IGI P+
Sbjct: 160 FFKGFGPTVGIGIPPQ 175

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%)

Query: 264 GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPR 323
           G ++GA     +AP+D I TR   D+   +   +  +    R  ++E G    + G    
Sbjct: 167 GFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGFGLS 226

Query: 324 VMRVAPGQAVTFTVYEFVR 342
            +R + G A+ FT +E +R
Sbjct: 227 FIRESFGFALYFTTFEMIR 245

>Scas_671.1*
          Length = 123

 Score = 33.1 bits (74), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 261 SLIGLVSGAIGPFSNAPLDTIKTRLQ-KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319
           S+  + S ++     AP DTIKTR+Q K K   N    + + T      + E    L+ G
Sbjct: 43  SVSAIASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVLIT------KNESIFQLFSG 96

Query: 320 ITPRVMRVAPGQAVTFTVYE 339
           ++ R+ R A    + + +YE
Sbjct: 97  LSMRLTRKALSAGIAWGIYE 116

>KLLA0D10483g complement(884177..887839) similar to sp|Q02773
           Saccharomyces cerevisiae YML091c RPM2 ribonuclease P
           precursor, mitochondrial singleton, start by similarity
          Length = 1220

 Score = 30.0 bits (66), Expect = 3.8,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSL 262
           + A++ T++GA   V   L++RL++     ++P+WET L
Sbjct: 185 SGAKEQTDKGA---VPEALLDRLKDVRLDDSIPAWETDL 220

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 314 RALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGLFGS 353
           R LYKG     + + PG A    + E++R  L+G   + S
Sbjct: 387 RWLYKGFLRNTLAIIPGTATGLLLLEYMRTSLDGSAQYSS 426

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,374,410
Number of extensions: 408937
Number of successful extensions: 2798
Number of sequences better than 10.0: 214
Number of HSP's gapped: 1385
Number of HSP's successfully gapped: 542
Length of query: 355
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 252
Effective length of database: 13,030,455
Effective search space: 3283674660
Effective search space used: 3283674660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)