Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL310C92914628e-62
YPR043W (RPL43A)92914323e-57
YJR094W-A (RPL43B)92914323e-57
Scas_672.28*92914324e-57
Scas_691.392914324e-57
CAGL0H08734g92914307e-57
KLLA0E05896g92914177e-55
CAGL0L03916g64267582.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL310C
         (91 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL310C [4002] [Homologous to ScYPR043W (RPL43A) - SH; ScYJR094W...   182   8e-62
YPR043W (RPL43A) [5476] chr16 (654161..654162,654566..654842) Ri...   171   3e-57
YJR094W-A (RPL43B) [2986] chr10 (608222..608223,608499..608775) ...   171   3e-57
Scas_672.28*                                                          171   4e-57
Scas_691.3                                                            171   4e-57
CAGL0H08734g join(complement(852251..852252),complement(851585.....   170   7e-57
KLLA0E05896g join(complement(532447..532448),complement(531676.....   165   7e-55
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    27   2.5  

>AGL310C [4002] [Homologous to ScYPR043W (RPL43A) - SH;
          ScYJR094W-A (RPL43B) - SH] (120834..121112) [279 bp, 92
          aa]
          Length = 92

 Score =  182 bits (462), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KKTVAGGAYTFSTAAAATVRSTIRRLREMAE
Sbjct: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91

>YPR043W (RPL43A) [5476] chr16 (654161..654162,654566..654842)
          Ribosomal protein L43A (human L37A), identical to
          Rpl43Bp [279 bp, 92 aa]
          Length = 92

 Score =  171 bits (432), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (94%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLE+QQHARYDCSFCGKK VKRGAAGIW CS C
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KKTVAGGAYT STAAAATVRSTIRRLREM E
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLREMVE 91

>YJR094W-A (RPL43B) [2986] chr10 (608222..608223,608499..608775)
          Ribosomal protein L43B (human L37A), identical to
          Rpl43Ap [279 bp, 92 aa]
          Length = 92

 Score =  171 bits (432), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (94%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLE+QQHARYDCSFCGKK VKRGAAGIW CS C
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KKTVAGGAYT STAAAATVRSTIRRLREM E
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLREMVE 91

>Scas_672.28*
          Length = 92

 Score =  171 bits (432), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 86/91 (94%), Positives = 86/91 (94%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIW C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KK VAGGAYT STAAAATVRSTIRRLREM E
Sbjct: 61 KKCVAGGAYTVSTAAAATVRSTIRRLREMVE 91

>Scas_691.3
          Length = 92

 Score =  171 bits (432), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 86/91 (94%), Positives = 86/91 (94%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIW C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KK VAGGAYT STAAAATVRSTIRRLREM E
Sbjct: 61 KKCVAGGAYTVSTAAAATVRSTIRRLREMVE 91

>CAGL0H08734g
          join(complement(852251..852252),
          complement(851585..851861)) highly similar to sp|P49631
          Saccharomyces cerevisiae YPR043w RPL43A or sp|P49631
          Saccharomyces cerevisiae YJR094wa RPL43B
          Length = 92

 Score =  170 bits (430), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 87/91 (95%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKK V+RGAAGIW+C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKTVRRGAAGIWSCHSC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
          KKTVAGGAYT STAAAATVRSTIRRLR+M E
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLRDMVE 91

>KLLA0E05896g
          join(complement(532447..532448),
          complement(531676..531952)) highly similar to sp|P49631
          Saccharomyces cerevisiae YPR043W (RPL43A) or YJR094W-A
          (RPL43B) 60S ribosomal protein, start by similarity
          Length = 92

 Score =  165 bits (417), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 80/91 (87%), Positives = 86/91 (94%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHA Y+CSFCGK  VKRGAAG+W+CSSC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHATYNCSFCGKTCVKRGAAGVWSCSSC 60

Query: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAE 91
           +T+AGGAYT STAAAATVRSTIRRLR+MAE
Sbjct: 61 NRTIAGGAYTLSTAAAATVRSTIRRLRDMAE 91

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 26.9 bits (58), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 25/67 (37%), Gaps = 15/67 (22%)

Query: 14  YGVRYGSSLRRQVKKLEVQQHAR-----YDCSFCGKKAVKRG----------AAGIWNCS 58
           Y   Y S +  Q   L+V   A      ++C FCGK+  + G              + C 
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAGNLRTHRRLHTGERPFKCD 539

Query: 59  SCKKTVA 65
            C KT A
Sbjct: 540 KCDKTFA 546

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.129    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,306,894
Number of extensions: 64584
Number of successful extensions: 161
Number of sequences better than 10.0: 10
Number of HSP's gapped: 161
Number of HSP's successfully gapped: 10
Length of query: 91
Length of database: 16,596,109
Length adjustment: 62
Effective length of query: 29
Effective length of database: 14,449,793
Effective search space: 419043997
Effective search space used: 419043997
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)