Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL308W2162129611e-134
KLLA0E05918g211441411e-10
Kwal_47.18209257431253e-08
YJR094C (IME1)360421087e-06
CAGL0M09042g452481052e-05
Scas_691.2d26562820.013
YMR232W (FUS2)67743651.9
KLLA0C12969g75735643.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL308W
         (212 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL308W [4004] [Homologous to ScYJR094C (IME1) - SH] complement(...   374   e-134
KLLA0E05918g 534222..534857 no similarity, hypothetical start          59   1e-10
Kwal_47.18209                                                          53   3e-08
YJR094C (IME1) [2985] chr10 complement(604486..605568) Transcrip...    46   7e-06
CAGL0M09042g 901459..902817 weakly similar to sp|P21190 Saccharo...    45   2e-05
Scas_691.2d                                                            36   0.013
YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required fo...    30   1.9  
KLLA0C12969g 1098631..1100904 similar to sp|Q9HF59 Ashbya gossyp...    29   3.1  

>AGL308W [4004] [Homologous to ScYJR094C (IME1) - SH]
           complement(121864..122514) [651 bp, 216 aa]
          Length = 216

 Score =  374 bits (961), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 187/212 (88%)

Query: 1   MAAHTLDSYLQLDGDEPHTPCEDGLAFELDLASQRRLLIHTQPIYLINTSKLQTPQQQVV 60
           MAAHTLDSYLQLDGDEPHTPCEDGLAFELDLASQRRLLIHTQPIYLINTSKLQTPQQQVV
Sbjct: 1   MAAHTLDSYLQLDGDEPHTPCEDGLAFELDLASQRRLLIHTQPIYLINTSKLQTPQQQVV 60

Query: 61  RPEGGTLLDTRQSSIFSAPGLGEDALHVLDAALTPACAEKLRMPRIVPREEPDYGALAAD 120
           RPEGGTLLDTRQSSIFSAPGLGEDALHVLDAALTPACAEKLRMPRIVPREEPDYGALAAD
Sbjct: 61  RPEGGTLLDTRQSSIFSAPGLGEDALHVLDAALTPACAEKLRMPRIVPREEPDYGALAAD 120

Query: 121 ELLFEXXXXXXXXXXXXXXXXXXXXXXXXXRFVQAAHTFHDDATWDSPEQYEFVHALTSK 180
           ELLFE                         RFVQAAHTFHDDATWDSPEQYEFVHALTSK
Sbjct: 121 ELLFELSAPIPLALPAGPAPGLLGPSLDLGRFVQAAHTFHDDATWDSPEQYEFVHALTSK 180

Query: 181 LSRYCGYFVADSKEMEYFDKIRLQEVEYRLSK 212
           LSRYCGYFVADSKEMEYFDKIRLQEVEYRLSK
Sbjct: 181 LSRYCGYFVADSKEMEYFDKIRLQEVEYRLSK 212

>KLLA0E05918g 534222..534857 no similarity, hypothetical start
          Length = 211

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 36/44 (81%)

Query: 169 EQYEFVHALTSKLSRYCGYFVADSKEMEYFDKIRLQEVEYRLSK 212
           E+ +FV+ LT+KL  Y GYF+ADS +++YFDKIR QE++Y+ SK
Sbjct: 165 EKDQFVYTLTNKLLPYFGYFLADSNDLDYFDKIRFQEIDYKFSK 208

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 10/51 (19%)

Query: 38  LIHTQPIYLI---NTSKLQTP-----QQQVVRPEGG--TLLDTRQSSIFSA 78
           +IHTQP++LI   N   LQT      +Q+++       +L DTR SS+FS+
Sbjct: 63  MIHTQPVHLIHVHNLKFLQTSFEEEDEQRIICSSSTPPSLADTRHSSVFSS 113

>Kwal_47.18209
          Length = 257

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 3/43 (6%)

Query: 170 QYEFVHALTSKLSRYCGYFVADSKEMEYFDKIRLQEVEYRLSK 212
           Q  FV  +T KLSRYCGY  +DS    Y DK+RLQE+ YR SK
Sbjct: 213 QDSFVQYITHKLSRYCGYLASDS---HYHDKLRLQEIMYRFSK 252

>YJR094C (IME1) [2985] chr10 complement(604486..605568)
           Transcription factor required for sporulation, positive
           regulator of IME2 and many sporulation genes [1083 bp,
           360 aa]
          Length = 360

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 172 EFVHALTSKLSRYCG-YFVADSKEMEYFDKIRLQEVEYRLSK 212
           EF+  L SKLSRY   Y  + S + +Y+DK+R QE+ Y+ SK
Sbjct: 316 EFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYKFSK 357

>CAGL0M09042g 901459..902817 weakly similar to sp|P21190
           Saccharomyces cerevisiae YJR094c IME1 transcription
           factor required for sporulation, hypothetical start
          Length = 452

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 166 DSPEQYEFVHALTSKLSRYC-GYFVADSKEMEYFDKIRLQEVEYRLSK 212
           DS    EF  +L SKL RYC   +   S+  EY+DK+R QE+ Y+ SK
Sbjct: 402 DSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYKFSK 449

>Scas_691.2d
          Length = 265

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 15/62 (24%)

Query: 166 DSPEQYEFVHALTSKLSRYC-----GYFVAD----------SKEMEYFDKIRLQEVEYRL 210
           ++ +++EF+  L  KL+RY       Y   +          S E EYFDK+R QE+ ++ 
Sbjct: 201 ENTQEFEFLKQLHMKLARYTTKPTTNYLYCNPDPNKCQLQLSLEQEYFDKVRFQEISFKF 260

Query: 211 SK 212
           SK
Sbjct: 261 SK 262

>YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required for
           cell fusion during mating, localizes to dots beneath the
           tip of mating projection (shmoo) [2034 bp, 677 aa]
          Length = 677

 Score = 29.6 bits (65), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 163 ATWDSPEQYEFVHALTSKLSRYCGYFVADSKEMEYFDKIRLQE 205
           +T+D  E +E  H L  K S Y  YFV+  K+ME F  +R+ +
Sbjct: 214 STFDISEAFE-QHLLRIK-STYTSYFVSHQKQMELFTTLRMNK 254

>KLLA0C12969g 1098631..1100904 similar to sp|Q9HF59 Ashbya gossypii
           Cdc24, start by similarity
          Length = 757

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 169 EQYEFVHALTSKLSRYCGYFVADSKEMEYFDKIRL 203
           E YE V  L  ++  + GY +A   E+ YFD+I +
Sbjct: 441 ENYEVVKRLYGRVVNWKGYRIAKFGELLYFDRISI 475

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,070,747
Number of extensions: 212592
Number of successful extensions: 398
Number of sequences better than 10.0: 11
Number of HSP's gapped: 392
Number of HSP's successfully gapped: 13
Length of query: 212
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 115
Effective length of database: 13,238,163
Effective search space: 1522388745
Effective search space used: 1522388745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)