Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL307W3233179321e-126
Kwal_33.143742822193653e-41
KLLA0E05940g2952113141e-33
Scas_691.2342843003e-31
YJR093C (FIP1)327902993e-31
CAGL0M09064g327912951e-30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL307W
         (317 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL307W [4005] [Homologous to ScYJR093C (FIP1) - SH] complement(...   363   e-126
Kwal_33.14374                                                         145   3e-41
KLLA0E05940g 535755..536642 some similarities with sp|P45976 Sac...   125   1e-33
Scas_691.2                                                            120   3e-31
YJR093C (FIP1) [2984] chr10 complement(603137..604120) Component...   119   3e-31
CAGL0M09064g 903560..904543 similar to sp|P45976 Saccharomyces c...   118   1e-30

>AGL307W [4005] [Homologous to ScYJR093C (FIP1) - SH]
           complement(122936..123907) [972 bp, 323 aa]
          Length = 323

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 199/317 (62%), Positives = 199/317 (62%)

Query: 1   MQLRAAQHLIAEELQMASSDDEDEKFLYGSEDEADGPRGQQKRKLIPQGTAQIQEPDTKR 60
           MQLRAAQHLIAEELQMASSDDEDEKFLYGSEDEADGPRGQQKRKLIPQGTAQIQEPDTKR
Sbjct: 1   MQLRAAQHLIAEELQMASSDDEDEKFLYGSEDEADGPRGQQKRKLIPQGTAQIQEPDTKR 60

Query: 61  ARGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIIGTGADSSKLDXXXXXXXXXXXX 120
           ARGA                               IIIGTGADSSKLD            
Sbjct: 61  ARGADDGDVDMLDDDDEEEDDDEDEDDEDSDSDVEIIIGTGADSSKLDSKALTTPSTAAT 120

Query: 121 XXXXXXXXXXPVSEQSAPVAAVQSGDSGAAMDKAVGALDINAVGEYEGTPITDIDPEVLK 180
                     PVSEQSAPVAAVQSGDSGAAMDKAVGALDINAVGEYEGTPITDIDPEVLK
Sbjct: 121 ATSAAESAIAPVSEQSAPVAAVQSGDSGAAMDKAVGALDINAVGEYEGTPITDIDPEVLK 180

Query: 181 EKPWRQPGANLSDYFNYGFTEETWMEYLHKQEKLRKEYNPRKIXXXXXXXXXXXXXXXXX 240
           EKPWRQPGANLSDYFNYGFTEETWMEYLHKQEKLRKEYNPRKI                 
Sbjct: 181 EKPWRQPGANLSDYFNYGFTEETWMEYLHKQEKLRKEYNPRKILMGLLALQQQGKLGDGG 240

Query: 241 XXXXXXXSAGGMAHNDIKSPNKNNGSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                  SAGGMAHNDIKSPNKNNGSL                                 
Sbjct: 241 AGDGVMLSAGGMAHNDIKSPNKNNGSLPQPPAFPMGMPPMFGGFPPFPFPGMIPPNLGAA 300

Query: 301 XXXXXXXXHQNMGTSSG 317
                   HQNMGTSSG
Sbjct: 301 SGNNGSGNHQNMGTSSG 317

>Kwal_33.14374
          Length = 282

 Score =  145 bits (365), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 108/219 (49%), Gaps = 14/219 (6%)

Query: 18  SSDDEDEKFLYGSEDEADGPRGQQKRKLIPQGTAQIQEPD--TKRARGAXXXXXXXXXXX 75
           +S DEDEKFLYGS++E   P    K+ +I     Q+ E D  ++  +             
Sbjct: 2   NSSDEDEKFLYGSDEEGAAPE-NGKQVVINDKKRQMPEVDGESEAKKAKIDNSEANNASS 60

Query: 76  XXXXXXXXXXXXXXXXXXXXIIIGTGADSSKLDXXXXXXXXXXXXXXXXXXXXXXPVSEQ 135
                                IIG GADSSKLD                       V   
Sbjct: 61  SSSDAESSDNEDSDEESDVEFIIGVGADSSKLDSKQQSSSANLAQKPATITASAADVGTT 120

Query: 136 SA--PVAAVQSGDSGAAMDKAVGA---------LDINAVGEYEGTPITDIDPEVLKEKPW 184
            A    AAV SGD  A  D +  A         +D++AVG+     +TDIDPEVLKEKPW
Sbjct: 121 IADSEAAAVASGDDVAGGDTSTTAAPGTERLPAIDLDAVGKLGDKAVTDIDPEVLKEKPW 180

Query: 185 RQPGANLSDYFNYGFTEETWMEYLHKQEKLRKEYNPRKI 223
           RQPGANLSDYFNYGF E+TWMEYLH+QEKLR EYNP K+
Sbjct: 181 RQPGANLSDYFNYGFNEQTWMEYLHRQEKLRAEYNPHKL 219

>KLLA0E05940g 535755..536642 some similarities with sp|P45976
           Saccharomyces cerevisiae YJR093c FIP1 component of
           pre-mRNA polyadenylation factor PF I singleton,
           hypothetical start
          Length = 295

 Score =  125 bits (314), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 102/211 (48%), Gaps = 11/211 (5%)

Query: 18  SSDDEDEKFLYGSEDEADGPRGQQ----KRKLIPQGTAQIQEPDTKRARGAXXXXXXXXX 73
           SS+DED+KFLY  E++++    Q+    KR+ + + T +I   D                
Sbjct: 2   SSEDEDDKFLYSDEEDSNVVAKQEGPALKRQKV-EETPKILAHDVPEGN-----TNEVES 55

Query: 74  XXXXXXXXXXXXXXXXXXXXXXIIIGTGADSSKLDXXXXXXXXXXXXXXXXXXXXXXPVS 133
                                 IIIGTG D+SK+D                         
Sbjct: 56  EASNQDSSSDEDDSSDSDSDVEIIIGTGNDTSKIDSGKSQISAITDTTPLGTADHAIAAV 115

Query: 134 EQSAPVAAVQSGD-SGAAMDKAVGALDINAVGEYEGTPITDIDPEVLKEKPWRQPGANLS 192
              + V  VQ G        +    +D+N   +++G PI  IDPE+LKEKPWRQPGAN+S
Sbjct: 116 AGISDVVPVQEGSIPPEQQQQQQQTIDLNPDAQFDGKPIVQIDPEILKEKPWRQPGANIS 175

Query: 193 DYFNYGFTEETWMEYLHKQEKLRKEYNPRKI 223
           DYFNYGF E+TWMEYLH+QE L KEYNP+KI
Sbjct: 176 DYFNYGFNEQTWMEYLHRQEHLTKEYNPQKI 206

>Scas_691.2
          Length = 342

 Score =  120 bits (300), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 65/84 (77%)

Query: 140 AAVQSGDSGAAMDKAVGALDINAVGEYEGTPITDIDPEVLKEKPWRQPGANLSDYFNYGF 199
            A  + DS    +  +G++D++  G +EG  IT+IDPEVL+EKPWRQPGANLSDYFNYGF
Sbjct: 137 TATLTSDSLKNNNTMLGSIDLDKDGLFEGESITNIDPEVLREKPWRQPGANLSDYFNYGF 196

Query: 200 TEETWMEYLHKQEKLRKEYNPRKI 223
            E TW EYL++QEKLR +YNPR+I
Sbjct: 197 NEYTWTEYLNRQEKLRADYNPRRI 220

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 17/18 (94%)

Query: 16 MASSDDEDEKFLYGSEDE 33
          M+SS+DED+KFLYGS+ E
Sbjct: 1  MSSSEDEDDKFLYGSDTE 18

>YJR093C (FIP1) [2984] chr10 complement(603137..604120) Component of
           polyadenylation factor that interacts with poly(A)
           polymerase [984 bp, 327 aa]
          Length = 327

 Score =  119 bits (299), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 135 QSAPVAAVQSGDSGAAMDKAV-GALDINAVGEYEGTPITDIDPEVLKEKPWRQPGANLSD 193
           Q      V++ +S   + KA+ G++D++  G ++   IT IDPEVLKEKPWRQPGANLSD
Sbjct: 140 QGVTATTVKATESDGNVPKAMTGSIDLDKEGIFDSVGITTIDPEVLKEKPWRQPGANLSD 199

Query: 194 YFNYGFTEETWMEYLHKQEKLRKEYNPRKI 223
           YFNYGF E TWMEYLH+QEKL+++YNPR+I
Sbjct: 200 YFNYGFNEFTWMEYLHRQEKLQQDYNPRRI 229

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 16 MASSDDEDEKFLYGSEDEADGPRGQQKR 43
          M+SS+DED+KFLYGS+ E   P  ++ R
Sbjct: 1  MSSSEDEDDKFLYGSDSELALPSSKRSR 28

>CAGL0M09064g 903560..904543 similar to sp|P45976 Saccharomyces
           cerevisiae YJR093c component of pre-mRNA polyadenylation
           factor PF I, start by similarity
          Length = 327

 Score =  118 bits (295), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 7/91 (7%)

Query: 133 SEQSAPVAAVQSGDSGAAMDKAVGALDINAVGEYEGTPITDIDPEVLKEKPWRQPGANLS 192
           +E   P    +SG S          +D++  G Y   P++ IDPEVLKEKPWRQPGAN+S
Sbjct: 149 NETLGPETTTKSGTSAEG-------IDLDKEGLYNDEPVSTIDPEVLKEKPWRQPGANIS 201

Query: 193 DYFNYGFTEETWMEYLHKQEKLRKEYNPRKI 223
           DYFNYGF E TWMEYLH+QEKLR+EYNPR+I
Sbjct: 202 DYFNYGFNEYTWMEYLHRQEKLRQEYNPRRI 232

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 24/28 (85%), Gaps = 2/28 (7%)

Query: 16 MASSDDEDEKFLYGSEDEADGPRGQQKR 43
          M+SS+DED+KFLYGS++E   P+ ++KR
Sbjct: 1  MSSSEDEDDKFLYGSDNEE--PKNEKKR 26

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.128    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,884,357
Number of extensions: 232624
Number of successful extensions: 654
Number of sequences better than 10.0: 12
Number of HSP's gapped: 649
Number of HSP's successfully gapped: 17
Length of query: 317
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 215
Effective length of database: 13,065,073
Effective search space: 2808990695
Effective search space used: 2808990695
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 61 (28.1 bits)