Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL165W46345424220.0
KLLA0D16962g46743015360.0
Kwal_27.1130747944814740.0
CAGL0M04499g46944813890.0
YLR142W (PUT1)47644113440.0
Scas_506.456440713161e-178
Sklu_1345.190882499e-26
Kwal_27.1043338276701.4
CAGL0M03245g56265692.1
ACR072C99047692.3
Scas_709.4237440647.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL165W
         (454 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL165W [4147] [Homologous to ScYLR142W (PUT1) - SH] complement(...   937   0.0  
KLLA0D16962g 1437692..1439095 similar to sp|P09368 Saccharomyces...   596   0.0  
Kwal_27.11307                                                         572   0.0  
CAGL0M04499g 494202..495611 highly similar to sp|P09368 Saccharo...   539   0.0  
YLR142W (PUT1) [3551] chr12 (425187..426617) Proline oxidase (pr...   522   0.0  
Scas_506.4                                                            511   e-178
Sklu_1345.1 YLR142W, Contig c1345 1520-1792                           100   9e-26
Kwal_27.10433                                                          32   1.4  
CAGL0M03245g complement(372122..373810) similar to sp|P39994 Sac...    31   2.1  
ACR072C [1119] [Homologous to ScYHR027C (RPN1) - SH] (489699..49...    31   2.3  
Scas_709.42                                                            29   7.9  

>AGL165W [4147] [Homologous to ScYLR142W (PUT1) - SH]
           complement(387159..388550) [1392 bp, 463 aa]
          Length = 463

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/454 (100%), Positives = 454/454 (100%)

Query: 1   MNSRLGQVLRQAVRVQTGLRGPARSMRGYVSQTQTKQNTVAVVAGAAERFVAPAADAHLK 60
           MNSRLGQVLRQAVRVQTGLRGPARSMRGYVSQTQTKQNTVAVVAGAAERFVAPAADAHLK
Sbjct: 1   MNSRLGQVLRQAVRVQTGLRGPARSMRGYVSQTQTKQNTVAVVAGAAERFVAPAADAHLK 60

Query: 61  TLSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGR 120
           TLSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGR
Sbjct: 61  TLSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGR 120

Query: 121 ALARRGVGNMMLSLTVEDSEGTKNIDIDYIVEETVRSLHGVLLPHMEEQLARAADVNSVP 180
           ALARRGVGNMMLSLTVEDSEGTKNIDIDYIVEETVRSLHGVLLPHMEEQLARAADVNSVP
Sbjct: 121 ALARRGVGNMMLSLTVEDSEGTKNIDIDYIVEETVRSLHGVLLPHMEEQLARAADVNSVP 180

Query: 181 PGYLALKPSALVSDPANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRK 240
           PGYLALKPSALVSDPANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRK
Sbjct: 181 PGYLALKPSALVSDPANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRK 240

Query: 241 SPFFVATIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQA 300
           SPFFVATIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQA
Sbjct: 241 SPFFVATIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQA 300

Query: 301 ERAEREGYKLGLKLVRGAYLHSEPNRDVIHPTKEATDEHYNEVMAKVIQDLLANGEHSVF 360
           ERAEREGYKLGLKLVRGAYLHSEPNRDVIHPTKEATDEHYNEVMAKVIQDLLANGEHSVF
Sbjct: 301 ERAEREGYKLGLKLVRGAYLHSEPNRDVIHPTKEATDEHYNEVMAKVIQDLLANGEHSVF 360

Query: 361 GHLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKY 420
           GHLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKY
Sbjct: 361 GHLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKY 420

Query: 421 VPWGPPKETKDYMHRRLQENGDAVRADNGWPLVK 454
           VPWGPPKETKDYMHRRLQENGDAVRADNGWPLVK
Sbjct: 421 VPWGPPKETKDYMHRRLQENGDAVRADNGWPLVK 454

>KLLA0D16962g 1437692..1439095 similar to sp|P09368 Saccharomyces
           cerevisiae YLR142w PUT1 proline oxidase singleton, start
           by similarity
          Length = 467

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/430 (64%), Positives = 339/430 (78%), Gaps = 4/430 (0%)

Query: 29  YVSQTQTKQNTVAVVAG----AAERFVAPAADAHLKTLSQRELVALGVIGCVTTNARLLK 84
           +VSQT   ++T+A        AA +   PA DAHL+TLS+ EL +LG+IG  T N  +L 
Sbjct: 29  FVSQTNATKSTMAPATAIHDMAASQHTVPAPDAHLRTLSKSELFSLGMIGVCTINKPMLD 88

Query: 85  LVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGRALARRGVGNMMLSLTVEDSEGTKN 144
           LV + FPYVP  + KL IS LYCGGDT AEV ETG+ L  RG+ NMMLSLT+ED+EGTKN
Sbjct: 89  LVIKLFPYVPLFMVKLFISPLYCGGDTPAEVVETGKRLQNRGINNMMLSLTIEDAEGTKN 148

Query: 145 IDIDYIVEETVRSLHGVLLPHMEEQLARAADVNSVPPGYLALKPSALVSDPANTLLHFAD 204
           +DI+YIV ET++S+H +L P + EQL    D+NS+PPGY+ALKPSALV++PA  LL+F +
Sbjct: 149 VDINYIVSETIKSVHTILKPLLVEQLESGKDINSIPPGYIALKPSALVANPAQVLLNFNN 208

Query: 205 PAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRKSPFFVATIDAEKYEVQCAGVYELQ 264
           P W+ +RD LV N S+I  EVY LNQE+LA+YP RKSPFFV+TIDAEKY++Q AGVYELQ
Sbjct: 209 PEWKTQRDELVNNCSKITQEVYNLNQELLAKYPERKSPFFVSTIDAEKYDLQKAGVYELQ 268

Query: 265 RLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQAERAEREGYKLGLKLVRGAYLHSEP 324
           R++F+K+NP SSP++SC+GTWQLYL D+AADL    ERA++EGYKLGLKLVRGAY+HSEP
Sbjct: 269 RILFSKFNPASSPLISCVGTWQLYLVDSAADLAKDYERAKKEGYKLGLKLVRGAYIHSEP 328

Query: 325 NRDVIHPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVVASHNYQSQMLATMLLQAHG 384
           NR V++ TKE TD +YN+VM   I+DLL NGE S +GHLVVASHNY SQMLAT LL    
Sbjct: 329 NRSVVYATKEGTDANYNKVMTTAIKDLLVNGEKSYYGHLVVASHNYDSQMLATKLLADQK 388

Query: 385 ESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKYVPWGPPKETKDYMHRRLQENGDAV 444
            SVGK+NV L QLLGM+DNVT+DLI NH   NIIKYVPWGPP ETKDY+ RRLQENGDAV
Sbjct: 389 NSVGKANVTLAQLLGMSDNVTHDLITNHKVENIIKYVPWGPPLETKDYLLRRLQENGDAV 448

Query: 445 RADNGWPLVK 454
           RADNG PL+K
Sbjct: 449 RADNGIPLIK 458

>Kwal_27.11307
          Length = 479

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/448 (60%), Positives = 342/448 (76%), Gaps = 9/448 (2%)

Query: 14  RVQTGLRGPARSMRGYVSQTQTKQNTVAVVAGAAE-------RFVAPAADAHLKTLSQRE 66
           +V +GL GP    +  V+Q+ T + T+ + A  A+           P ++AHL++LS +E
Sbjct: 13  KVLSGL-GPMAVTKRLVTQSSTNKATLKMEAARAQVDTTKPMAVRTPTSEAHLESLSAKE 71

Query: 67  LVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGRALARRG 126
           L++LGVIG  T N  +L LV + FP+VP  + KLL+S+LYCGGD   EVRETG  L +RG
Sbjct: 72  LISLGVIGMATINKPMLDLVLKMFPFVPVWLMKLLVSSLYCGGDNFKEVRETGERLRQRG 131

Query: 127 VGNMMLSLTVEDSEGTKNIDIDYIVEETVRSLHGVLLPHMEEQLARAADVNSVPPGYLAL 186
           + NMMLSLT+ED+EG KNIDI++IV ET+ SLH +L P+++  L  A+D+NS+PPGYLAL
Sbjct: 132 INNMMLSLTIEDAEGVKNIDINHIVSETIGSLHEILKPNLQAGLDSASDINSIPPGYLAL 191

Query: 187 KPSALVSDPANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRKSPFFVA 246
           KPSALVS+P  TLLHF DP W+ +R+ L+ N + I  EVY LNQE    YP RK PFFVA
Sbjct: 192 KPSALVSNPYETLLHFNDPEWKSQRETLINNCTAITQEVYNLNQEFAKLYPERKIPFFVA 251

Query: 247 TIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQAERAERE 306
            IDAEKY +Q AGVYELQR++F K+NP  S  VSC+GTWQLYL D+AADL    ERAE+E
Sbjct: 252 VIDAEKYALQKAGVYELQRILFQKFNPKESSQVSCVGTWQLYLTDSAADLTKDYERAEKE 311

Query: 307 GYKLGLKLVRGAYLHSEPNRD-VIHPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVV 365
           GYKLGLK+VRGAY+HSEPNRD +I+P +  TD ++N VM KVI DL++ G+ S +GHLVV
Sbjct: 312 GYKLGLKIVRGAYIHSEPNRDTIIYPDQAGTDANFNGVMKKVIDDLVSKGQDSTYGHLVV 371

Query: 366 ASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKYVPWGP 425
           ASHNY+SQ+LAT +L+ H   +GK+NVVLGQLLGMADNVT+DLI+NH A NIIKYVPWGP
Sbjct: 372 ASHNYESQLLATEILKGHDGEIGKANVVLGQLLGMADNVTHDLINNHNATNIIKYVPWGP 431

Query: 426 PKETKDYMHRRLQENGDAVRADNGWPLV 453
           P ETKDY+ RR+QENGDAVRADNG+PLV
Sbjct: 432 PAETKDYLFRRMQENGDAVRADNGFPLV 459

>CAGL0M04499g 494202..495611 highly similar to sp|P09368
           Saccharomyces cerevisiae YLR142w PUT1 Proline oxidase,
           hypothetical start
          Length = 469

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/448 (58%), Positives = 336/448 (75%), Gaps = 22/448 (4%)

Query: 27  RGYVSQTQTKQNTVAVVAGAAERF-------------VAPAADAHLKTLSQRELVALGVI 73
           R YVSQT    N  A+VA   +               + P++ A+LKTLS+ E+ +LG+I
Sbjct: 14  RRYVSQTAQTSN--AMVADTTDPMMNPMQPKLSSHSQLPPSSVAYLKTLSRAEVFSLGMI 71

Query: 74  GCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGRALARRGVGNMMLS 133
           G  TT+  +L LV + FPYVP P+ K+ +S LYCGGD + EV+  G  L +RG+ NMMLS
Sbjct: 72  GLATTSKPVLNLVIKLFPYVPMPLIKMFVSRLYCGGDNINEVKTFGEKLQKRGISNMMLS 131

Query: 134 LTVEDSEGTKNIDIDYIVEETVRSLHGVLLPHMEEQLAR----AADVNSVPPGYLALKPS 189
           LT+EDSEGTKNIDI+YIVEET++S+HGVL P++  QL +    A  +N + PGY+ALKPS
Sbjct: 132 LTIEDSEGTKNIDINYIVEETIKSVHGVLKPNLVNQLEKCGNDAKKINEIAPGYIALKPS 191

Query: 190 ALVSDPANTLLHF--ADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRKSPFFVAT 247
           ALVS+P + L++F   DP W  +R+ L+ N SRI  E+Y LN ++L +YP R +PF VAT
Sbjct: 192 ALVSNPHDVLMNFNNPDPHWVAQREKLIDNCSRIAQEIYDLNNDLLKKYPSRTAPFCVAT 251

Query: 248 IDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQAERAEREG 307
           IDAEKY++Q +GVYELQR++F K+N +SSP+VS IGTWQLYL D+AA L  +  RA +EG
Sbjct: 252 IDAEKYDLQNSGVYELQRILFQKFNKLSSPMVSVIGTWQLYLVDSAAQLAREHARAMKEG 311

Query: 308 YKLGLKLVRGAYLHSEPNRD-VIHPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVVA 366
           YKLG+KLVRGAY+HSE  RD +I  TKE TDE+Y+ VM  VIQDLL NG  S +GHLVVA
Sbjct: 312 YKLGVKLVRGAYIHSETKRDSIIFKTKEGTDENYDAVMTTVIQDLLKNGTKSYYGHLVVA 371

Query: 367 SHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKYVPWGPP 426
           SHNY SQMLAT +L+   E+VGK+N+VLGQLLGM+DNVT+DLI  HGA+NIIKYVPWGPP
Sbjct: 372 SHNYGSQMLATKILKDAPENVGKANIVLGQLLGMSDNVTHDLITKHGAKNIIKYVPWGPP 431

Query: 427 KETKDYMHRRLQENGDAVRADNGWPLVK 454
            ETKDY+ RRLQENGDAV++DNG+PLVK
Sbjct: 432 LETKDYLLRRLQENGDAVKSDNGFPLVK 459

>YLR142W (PUT1) [3551] chr12 (425187..426617) Proline oxidase
           (proline dehydrogenase), first step in synthesis of
           glutamate from proline [1431 bp, 476 aa]
          Length = 476

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/441 (55%), Positives = 323/441 (73%), Gaps = 14/441 (3%)

Query: 27  RGYVSQTQTKQNTVAVV--------AGAAERFVAPAADAHLKTLSQRELVALGVIGCVTT 78
           R YVS+T T  NT A +        A        P +   L+TL ++EL  LG IG  T 
Sbjct: 25  RSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPNSINFLQTLPKKELFQLGFIGIATL 84

Query: 79  NARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGRALARRGVGNMMLSLTVED 138
           N+  L  + + FPY+P PV K  +S+LYCGG+   EV E G+ L +RG+ NMMLSLT+E+
Sbjct: 85  NSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLSLTIEN 144

Query: 139 SEGTKNID---IDYIVEETVRSLHGVLLPHMEEQLARAADVNSVPPGYLALKPSALVSDP 195
           SEGTK++    +D IV+ET+ S+H +LLP++  QL  +  +N + PGY+ALKPSALV +P
Sbjct: 145 SEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQL-ESKPINDIAPGYIALKPSALVDNP 203

Query: 196 ANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRKSPFFVATIDAEKYEV 255
              L +F++PA++ +RD L+ N S+I  E+++LNQ +L +YP RK+PF V+TIDAEKY++
Sbjct: 204 HEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDL 263

Query: 256 QCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQAERAEREGYKLGLKLV 315
           Q  GVYELQR++F K+NP SS ++SC+GTWQLYLRD+   ++ + + A+  GYKLGLKLV
Sbjct: 264 QENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLV 323

Query: 316 RGAYLHSEPNRD-VIHPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVVASHNYQSQM 374
           RGAY+HSE NR+ +I   K  TDE+Y+ ++ +V+ DL+ NGE S FGHLVVASHNYQSQM
Sbjct: 324 RGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQSQM 383

Query: 375 LATMLLQA-HGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKYVPWGPPKETKDYM 433
           L T LL++    S  KSN+VLGQLLGMADNVTYDLI NHGA+NIIKYVPWGPP ETKDY+
Sbjct: 384 LVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVPWGPPLETKDYL 443

Query: 434 HRRLQENGDAVRADNGWPLVK 454
            RRLQENGDAVR+DNGWPL+K
Sbjct: 444 LRRLQENGDAVRSDNGWPLIK 464

>Scas_506.4
          Length = 564

 Score =  511 bits (1316), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 236/407 (57%), Positives = 306/407 (75%), Gaps = 5/407 (1%)

Query: 53  PAADAHLKTLSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCGGDTM 112
           P +  +LKTLS  EL +LG IG  T N + L L+ + FPY+P P+ K+ +S LYCGG T 
Sbjct: 149 PDSTHYLKTLSFHELFSLGCIGIATINKQFLNLIIKLFPYIPIPLIKIFVSKLYCGGITP 208

Query: 113 AEVRETGRALARRGVGNMMLSLTVEDSEGTK-NIDIDYIVEETVRSLHGVLLPHMEEQLA 171
            EV + G+ L  RG+ NMMLSLT+E+SEG K NIDI++I++ET+ S+H VL P++  Q+ 
Sbjct: 209 TEVLKCGQNLQLRGITNMMLSLTIENSEGGKQNIDINHIIQETINSIHTVLKPNLLNQIE 268

Query: 172 RAADVNSVPPGYLALKPSALVSDPANTLLHF---ADPAWREKRDALVANFSRIVGEVYKL 228
           +  D+N + PGY+ALKPSALV +P   LL+F    DP W EKR  L+ N S+I   +++L
Sbjct: 269 KVDDINDIAPGYIALKPSALVDNPREVLLNFQNETDPIWVEKRTQLIENCSKINEIIFQL 328

Query: 229 NQEMLARYPGRKSPFFVATIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLY 288
           N ++   YP RK+PFFV TIDAEK+++Q  GVY LQR++  K+NPVSSP+VSCIGTWQLY
Sbjct: 329 NNDLFKLYPERKAPFFVCTIDAEKFDLQINGVYALQRILMQKFNPVSSPLVSCIGTWQLY 388

Query: 289 LRDAAADLVAQAERAEREGYKLGLKLVRGAYLHSEPNRD-VIHPTKEATDEHYNEVMAKV 347
           LRD+   L  + + A+  GYKLGLKLVRGAY+HSE NRD +IH  K  TD +Y++++  +
Sbjct: 389 LRDSKQHLNEEIKLAKENGYKLGLKLVRGAYMHSELNRDSIIHSNKFDTDMNYDQIVMDI 448

Query: 348 IQDLLANGEHSVFGHLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTYD 407
           I+DL  NG+ S++GHLVVASHNY+SQ++AT LL+        SNVVLGQLLGMADNVT+D
Sbjct: 449 IKDLSKNGDQSIYGHLVVASHNYKSQLIATKLLKESKSLYANSNVVLGQLLGMADNVTHD 508

Query: 408 LIHNHGARNIIKYVPWGPPKETKDYMHRRLQENGDAVRADNGWPLVK 454
           L++NHGA+NIIKYVPWGPP ETKDY+ RRLQENGDAVRADNGWPL K
Sbjct: 509 LVYNHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRADNGWPLCK 555

>Sklu_1345.1 YLR142W, Contig c1345 1520-1792
          Length = 90

 Score =  100 bits (249), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 64/88 (72%), Gaps = 3/88 (3%)

Query: 26  MRGYVSQTQTKQNTVA---VVAGAAERFVAPAADAHLKTLSQRELVALGVIGCVTTNARL 82
           MR YVSQT + +  V+   V   ++  F AP++DAHLKTLS+REL +LG+IG  TT+  +
Sbjct: 1   MRTYVSQTPSHKTVVSMDSVAPPSSAPFAAPSSDAHLKTLSKRELFSLGIIGVATTSNLM 60

Query: 83  LKLVTQAFPYVPTPVAKLLISALYCGGD 110
           L LV + FPYVP P+ KLL+S+LYCGGD
Sbjct: 61  LNLVIKMFPYVPMPIVKLLVSSLYCGGD 88

>Kwal_27.10433
          Length = 382

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 362 HLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLGMADNVTY--DLIHNHGARNIIK 419
           +L++++      +++T LL+   E   ++ +   Q+L +   +TY   LI+ +  RN I 
Sbjct: 42  YLLISNLFNSLMIVSTKLLETDPEL--ETPITPLQILVVRMFITYLGTLIYMYWKRNSIG 99

Query: 420 YVPWGPPKETKDYMHR 435
            VPWGPP+  K  + R
Sbjct: 100 NVPWGPPEMRKWLILR 115

>CAGL0M03245g complement(372122..373810) similar to sp|P39994
           Saccharomyces cerevisiae YEL020c, hypothetical start
          Length = 562

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 36  KQNTVAVVAGAAERFVAPAADAHLKTLSQRELVALGVIGCVTTNARLLKLVTQA-FPYVP 94
           K  T  +  G   R +A       +   +  LV LG  GC+ ++  L   + +  FP++P
Sbjct: 178 KHETKRITTGPDPRSIAEVTSLIKEHQDKNILVVLGK-GCINSSLALRHFIEEFNFPFLP 236

Query: 95  TPVAK 99
           TP+AK
Sbjct: 237 TPMAK 241

>ACR072C [1119] [Homologous to ScYHR027C (RPN1) - SH]
           (489699..492671) [2973 bp, 990 aa]
          Length = 990

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 62  LSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISALYCG 108
           +S   + A+G+ GC T NARL +L+ Q   Y       L ++ L  G
Sbjct: 804 VSINSIFAMGLCGCGTNNARLAQLLRQLASYYSKEQNTLFVTRLAQG 850

>Scas_709.42
          Length = 374

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 330 HPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVVASHN 369
           HPT     E Y  ++   IQDLL+  +  V+G L + S+N
Sbjct: 20  HPTLRQDSEEYQTLLTSTIQDLLS-LKTIVYGKLALFSNN 58

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,556,474
Number of extensions: 541360
Number of successful extensions: 1410
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1426
Number of HSP's successfully gapped: 13
Length of query: 454
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 349
Effective length of database: 12,961,219
Effective search space: 4523465431
Effective search space used: 4523465431
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)