Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL097C1096107654260.0
Kwal_23.31601100106539340.0
KLLA0F20658g1082106338750.0
KLLA0E14630g1082106338620.0
CAGL0K12034g1087107736250.0
YDR038C (ENA5)1091107235250.0
YDR039C (ENA2)1091107235180.0
YDR040C (ENA1)1091107235120.0
Scas_569.0d46837615320.0
YGL167C (PMR1)9508948781e-102
CAGL0J01870g9468728721e-101
CAGL0I04312g9518888661e-100
KLLA0A03157g9388838331e-95
Scas_707.48*7417828151e-94
AEL301W9579918103e-92
Kwal_14.14989398578051e-91
Kwal_47.1754712408875558e-58
KLLA0A08910g12809325381e-55
AFL011W12428455148e-53
YGL006W (PMC1)11733934406e-44
CAGL0A00517g11223914236e-42
Scas_297.18002353153e-29
YGL008C (PMA1)9183573074e-28
YPL036W (PMA2)9473553074e-28
CAGL0A00495g9023523021e-27
Scas_688.19133502994e-27
Kwal_47.175228993522975e-27
AGL085C9093122922e-26
Scas_710.419043482852e-25
KLLA0A09031g8993052601e-22
Scas_665.3014398202477e-21
CAGL0M11308g14528082404e-20
Kwal_26.920714698322226e-18
YOR291W14728832191e-17
KLLA0B08217g14398372154e-17
KLLA0C08393g11485121832e-13
Sklu_2193.111437281805e-13
Scas_583.14*8753061761e-12
ADL079C11665081761e-12
CAGL0L00715g11445091708e-12
YIL048W (NEO1)11515051699e-12
Scas_704.3811615071691e-11
Kwal_23.578911335141611e-10
YEL031W (SPF1)12152311611e-10
AFR354C12102831582e-10
AFR567W14493211563e-10
KLLA0A04015g13433001466e-09
CAGL0M08602g10122871412e-08
CAGL0L01419g12142821394e-08
KLLA0E22352g12062821376e-08
ADR350W13113121376e-08
YDR270W (CCC2)10041501367e-08
KLLA0D04092g11522021341e-07
Scas_615.99421821322e-07
CAGL0H04477g16262361296e-07
KLLA0E01650g15502431288e-07
Kwal_26.707013153011271e-06
CAGL0G06270g13283001242e-06
AFL191W15752281215e-06
KLLA0F07447g9752021197e-06
Kwal_23.355615972511207e-06
AGL041C12331471152e-05
Kwal_55.215759891611117e-05
YAL026C (DRS2)13553101109e-05
YBR295W (PCA1)12161581082e-04
Scas_89.12711821042e-04
ACR086C810831072e-04
Scas_669.316381311063e-04
YMR162C (DNF3)16562361027e-04
AGR120C1547177860.056
CAGL0G08085g1578177850.078
YGR208W (SER2)309168820.11
YDR093W (DNF2)1612181830.14
Scas_636.161554174800.30
Scas_505.41025346800.31
YER166W (DNF1)1571177790.45
CAGL0B03245g49154760.77
CAGL0L11814g1576124741.7
Sklu_786.1312119703.1
KLLA0C17644g1576118713.2
YGR276C (RNH70)55335704.5
Scas_576.81591177705.1
YHL035C159268696.3
YJR089W (BIR1)95462688.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL097C
         (1076 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....  2094   0.0  
Kwal_23.3160                                                         1519   0.0  
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...  1497   0.0  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...  1492   0.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...  1400   0.0  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...  1362   0.0  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...  1359   0.0  
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...  1357   0.0  
Scas_569.0d                                                           594   0.0  
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   342   e-102
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   340   e-101
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   338   e-100
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   325   1e-95
Scas_707.48*                                                          318   1e-94
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   316   3e-92
Kwal_14.1498                                                          314   1e-91
Kwal_47.17547                                                         218   8e-58
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   211   1e-55
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   202   8e-53
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   174   6e-44
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   167   6e-42
Scas_297.1                                                            125   3e-29
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   122   4e-28
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   122   4e-28
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   120   1e-27
Scas_688.1                                                            119   4e-27
Kwal_47.17522                                                         119   5e-27
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   117   2e-26
Scas_710.41                                                           114   2e-25
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   104   1e-22
Scas_665.30                                                           100   7e-21
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    97   4e-20
Kwal_26.9207                                                           90   6e-18
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    89   1e-17
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    87   4e-17
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    75   2e-13
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          74   5e-13
Scas_583.14*                                                           72   1e-12
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    72   1e-12
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    70   8e-12
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    70   9e-12
Scas_704.38                                                            70   1e-11
Kwal_23.5789                                                           67   1e-10
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    67   1e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    65   2e-10
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    65   3e-10
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    61   6e-09
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    59   2e-08
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    58   4e-08
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    57   6e-08
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    57   6e-08
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    57   7e-08
KLLA0D04092g complement(344666..348124) some similarities with s...    56   1e-07
Scas_615.9                                                             55   2e-07
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    54   6e-07
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    54   8e-07
Kwal_26.7070                                                           54   1e-06
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    52   2e-06
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    51   5e-06
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    50   7e-06
Kwal_23.3556                                                           51   7e-06
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    49   2e-05
Kwal_55.21575                                                          47   7e-05
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    47   9e-05
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    46   2e-04
Scas_89.1                                                              45   2e-04
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    46   2e-04
Scas_669.3                                                             45   3e-04
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    44   7e-04
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    38   0.056
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    37   0.078
YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine phosph...    36   0.11 
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    37   0.14 
Scas_636.16                                                            35   0.30 
Scas_505.4                                                             35   0.31 
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    35   0.45 
CAGL0B03245g 316192..317667 highly similar to sp|P38353 Saccharo...    34   0.77 
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    33   1.7  
Sklu_786.1 YGR208W, Contig c786 410-1348                               32   3.1  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    32   3.2  
YGR276C (RNH70) [2221] chr7 complement(1043824..1045485) Ribonuc...    32   4.5  
Scas_576.8                                                             32   5.1  
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    31   6.3  
YJR089W (BIR1) [2980] chr10 (587632..590496) Protein involved in...    31   8.1  

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 2094 bits (5426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1020/1076 (94%), Positives = 1020/1076 (94%)

Query: 1    MSKSQKVAISGGTDVYERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGE 60
            MSKSQKVAISGGTDVYERTDFHALPAHEVA            AEEARARLEVVGDNTLGE
Sbjct: 1    MSKSQKVAISGGTDVYERTDFHALPAHEVARLLGTDLRRGLTAEEARARLEVVGDNTLGE 60

Query: 61   EEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNAC 120
            EEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNAC
Sbjct: 61   EEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNAC 120

Query: 121  KTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDE 180
            KTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDE
Sbjct: 121  KTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDE 180

Query: 181  ALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAE 240
            ALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAE
Sbjct: 181  ALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAE 240

Query: 241  SLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXX 300
            SLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHR                 
Sbjct: 241  SLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFA 300

Query: 301  XXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLE 360
               MATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLE
Sbjct: 301  LIVMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLE 360

Query: 361  ALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWE 420
            ALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWE
Sbjct: 361  ALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWE 420

Query: 421  YQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH 480
            YQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH
Sbjct: 421  YQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH 480

Query: 481  GDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSA 540
            GDPTEIAIQVFATRMDHPHHALTT            NDAARIYEHAAEFPFDSSIKRMSA
Sbjct: 481  GDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSA 540

Query: 541  VYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEG 600
            VYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEG
Sbjct: 541  VYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEG 600

Query: 601  LRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRA 660
            LRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRA
Sbjct: 601  LRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRA 660

Query: 661  GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPV 720
            GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPV
Sbjct: 661  GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPV 720

Query: 721  LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 780
            LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA
Sbjct: 721  LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 780

Query: 781  SDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVF 840
            SDIVLSDDNFASILNAVEEGRRMSDNIQKF            IYLMLGLTFLDEDKLSVF
Sbjct: 781  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVF 840

Query: 841  PLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMA 900
            PLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMA
Sbjct: 841  PLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMA 900

Query: 901  VCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMR 960
            VCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMR
Sbjct: 901  VCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMR 960

Query: 961  RSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYE 1020
            RSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYE
Sbjct: 961  RSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYE 1020

Query: 1021 WGIAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS 1076
            WGIAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS
Sbjct: 1021 WGIAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS 1076

>Kwal_23.3160
          Length = 1100

 Score = 1519 bits (3934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/1065 (68%), Positives = 852/1065 (80%), Gaps = 9/1065 (0%)

Query: 21   FHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMIL 80
            FH + A + A            + EA AR+   G+N+LG++  I+ ++ILL Q+CNAMIL
Sbjct: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82

Query: 81   VLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNG 140
            VL ISMVI LAI+DWISGGVIAFVV +NV+IG+YQEY A KTMNSLK LSTPSA VIR+G
Sbjct: 83   VLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDG 142

Query: 141  EDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVF-- 198
             D  + S Q+VPGD+  V+ GDTVPADLRL+E +N ETDEALLTGE+LP+AK+ + V+  
Sbjct: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202

Query: 199  EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGL 258
             +DTPVGDRLNLAFASSTVSKGRATGIVV+TGL +EIGKIA+SL+G  SLIS+DENK+  
Sbjct: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262

Query: 259  QNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIY 318
             N  +T+ A++GSFLGT  GTPLHR                    MATQKF+VN+EVAIY
Sbjct: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIY 322

Query: 319  AICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQ 378
            AICVA+SMIPSSLVVVLTITMS GAK+M+TRNV+VR+LDSLEALGAVND+CSDKTGTLTQ
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382

Query: 379  GKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQR 438
            GKMI+KQ WVP FGT+ V+ S+ PFDPT G + LIPRFSP +Y+HD  EDVGII +FK +
Sbjct: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442

Query: 439  WQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHP 498
            + ++ LP GLN + F +WL TA LANIA V++D +++EW+AHGDPTEIAIQVFA ++D P
Sbjct: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502

Query: 499  HHALTTXXXXXXXXXXXXNDAARI------YEHAAEFPFDSSIKRMSAVYINLRDKNTRH 552
             +ALT                 +       Y+H AEFPFDSSIKRMSAVY++L + N   
Sbjct: 503  RNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHR 562

Query: 553  VFTKGAFERVLKCCTRWKLDP-GTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTI 611
            VFTKGAFERVL CCT+W  D        P+TE+D E + KNV+TLS+EGLRVLAFATK+ 
Sbjct: 563  VFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSF 622

Query: 612  PAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDF 671
               +A  + E L K+RDFVESDLIFQGLVGIYDPPR ETAGAVK+ H+AGINVHMLTGDF
Sbjct: 623  TESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDF 682

Query: 672  PGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQ 731
            PGTAKAIAQEVGILP NLYHYPKEVVD MVMTA QFD LTDEE+D L +LPLVIARCAPQ
Sbjct: 683  PGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQ 742

Query: 732  TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA 791
            TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA
Sbjct: 743  TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA 802

Query: 792  SILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWII 851
            SILNAVEEGRRMSDNIQKF            +YLM+GL FLDED+LSVFPLSPVEVLWII
Sbjct: 803  SILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWII 862

Query: 852  VVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSII 911
            VVTSC PAMGLGLEK+APDIMEK P DSKAGIFTWE+I+DM++YG  MA CCL CF+++I
Sbjct: 863  VVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLACFITVI 922

Query: 912  YKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETD 971
            Y  G+G LG NCN  YS+SC +V+ GRAATFA+MTWCALILAWEVIDMRRSFF M+PETD
Sbjct: 923  YGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKMQPETD 982

Query: 972  TPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVF 1031
            TPYTQ  KDIWSN+FLFWSVIFGF SVFPVVYIPVIN  VF H GIGYEWG+A A+++ F
Sbjct: 983  TPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVAYTIAF 1042

Query: 1032 WLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS 1076
            W+ AE +K+ KR Y++NK RA NPE DLE+RR+HDPFEKY++  S
Sbjct: 1043 WIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNTAYS 1087

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 1497 bits (3875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1063 (67%), Positives = 846/1063 (79%), Gaps = 8/1063 (0%)

Query: 16   YERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMC 75
            Y R DFH L A +V               +   RL +VG+NTLG++  IN++ IL+ Q+C
Sbjct: 14   YARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQIC 73

Query: 76   NAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSAR 135
            NAMI+VLIISMVI LAIKDWISGGV+AFVV +NV IGAYQEYNA KTMNSLK LSTPSA 
Sbjct: 74   NAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAH 133

Query: 136  VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195
            VIR+G D+ + S ++VPGDI  ++VGDTVPADLRL+E++NLETDEALLTGE+LPVAK  +
Sbjct: 134  VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHS 193

Query: 196  AVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENK 255
             V+E+DTPVGDRLNLAFA+STV+KGRATGIV++T L +EIGKIA+SL+ + S IS+DENK
Sbjct: 194  EVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENK 253

Query: 256  SGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREV 315
            S  QN  +T+K ++GSFLGTNVGTPLHR                    M TQK+ VN++V
Sbjct: 254  SFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQV 313

Query: 316  AIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGT 375
            AIYAICVA+SMIPSSLVVVLTITMSAGAKVM+TRNVIVR+LDSLEALGAVNDICSDKTGT
Sbjct: 314  AIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGT 373

Query: 376  LTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANF 435
            LTQGKMI KQ+W+P+FGT+ V  SN PF+PT+G++ LIP+FSP++Y+HD+EEDVGII +F
Sbjct: 374  LTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDF 433

Query: 436  KQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRM 495
            K ++ +  L   LN   F+ WL+TATLANIATVF+DS++++W+AHGDPTEIAIQVFATRM
Sbjct: 434  KSKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRM 492

Query: 496  DHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNT--RHV 553
            D P H LT               A   +EH AEFPFDSS+KRMSA+Y N  D  T    V
Sbjct: 493  DLPRHVLTGEDKDDEKDAR----ANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEV 548

Query: 554  FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPA 613
            FTKGAFERVL+CC  W   P  G   PL+++DLE IQKNVDTLS+EGLRVLAFA K+   
Sbjct: 549  FTKGAFERVLQCCDSWYTTPD-GKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNE 607

Query: 614  EEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPG 673
             E  +  ++L K+RDFVE  L F GL+GIYDPPR E+  AVKKCH+AGINVHMLTGDFPG
Sbjct: 608  SEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667

Query: 674  TAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTK 733
            TAK+IAQEVGILPHNLYHYPKEVV+ MVM AT FD+L+D+E+D L VLPLVIARCAPQTK
Sbjct: 668  TAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTK 727

Query: 734  VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASI 793
            VRMI+ALHRR KFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLSDDNFASI
Sbjct: 728  VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASI 787

Query: 794  LNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVV 853
            LNAVEEGRRMSDNIQKF            +YLM+GL F+D++  SVFPLSPVEVLWIIVV
Sbjct: 788  LNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVV 847

Query: 854  TSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYK 913
            TSC PAMGLGLEKA+ D+MEKPP D+KA +FTWEVI+DM+VYG++MA CC+ CFV+++Y 
Sbjct: 848  TSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMACFVTVLYG 907

Query: 914  DGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETDTP 973
             G GNLG++CN    ++C  VF GRAA FATMTWCALILAWEV+DMRRSFF M PE++TP
Sbjct: 908  TGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMMNPESETP 967

Query: 974  YTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVFWL 1033
            YTQVFKDIWSN+FLFWS++ GF SVFPVVYIPVIN KVFLH  I YEWG A  FS  FW 
Sbjct: 968  YTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIGFSFAFWA 1027

Query: 1034 VAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS 1076
              E +K+ KR Y+  KDR  NPE+DLE R +HDPFE+Y+++ S
Sbjct: 1028 GVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYTTSFS 1070

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 1492 bits (3862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1063 (67%), Positives = 846/1063 (79%), Gaps = 8/1063 (0%)

Query: 16   YERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMC 75
            Y R DFH+L    V               +   RL ++G+NTLG++  IN++ I + Q+C
Sbjct: 14   YARDDFHSLSVSRVETLLSTHINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQIC 73

Query: 76   NAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSAR 135
            NAMI+VLIISMVI+ AIKDWISGGVIAFVV +NV IGAYQEYNA KTMNSLK LSTPSA 
Sbjct: 74   NAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAH 133

Query: 136  VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195
            VIR G D+ + S ++VPGDI  +RVGDTVPADLRL EA+NLETDEALLTGE+LPVAK   
Sbjct: 134  VIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAKSHG 193

Query: 196  AVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENK 255
             V+EQDTPVGDRLNLAFA+STV+KGRATGIV++T L +EIGKIA+SL+ + SLISRD++K
Sbjct: 194  EVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEASLISRDKSK 253

Query: 256  SGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREV 315
            S  +N  +T++ S+G+FLGT+VGTPLHR                    M TQKF VN++V
Sbjct: 254  SFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQV 313

Query: 316  AIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGT 375
            AIYAICVALSMIPSSLVVVLTITMSAGAKVM+TR+VI+R+LDSLEALGAVNDICSDKTGT
Sbjct: 314  AIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGT 373

Query: 376  LTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANF 435
            LTQGKMI KQ+W+P+FGT+ V  SN PF+PT+G++ LIP+FSP++Y+HD+EEDVG+I +F
Sbjct: 374  LTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDF 433

Query: 436  KQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRM 495
            K ++ ++ L   LN   F  WL+TATLANIATVF+D ++++W+AHGDPTEIAIQVFATRM
Sbjct: 434  KSKYYADELGP-LNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRM 492

Query: 496  DHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNT--RHV 553
            D P   LT             ND    +EH AE+PFDSS+KRMSA+Y N+ +       V
Sbjct: 493  DLPRRVLT--GEDNDDEKNIHNDIT--FEHVAEYPFDSSVKRMSAIYKNVEEPKAPIYEV 548

Query: 554  FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPA 613
            FTKGAFERVL+CC  W   P  G   PLTE+DLE +QKNVDTLS+EGLRVLAFA KT   
Sbjct: 549  FTKGAFERVLQCCNSWYTTPD-GSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNE 607

Query: 614  EEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPG 673
             +     ++L K+RDFVE++L F GLVGIYDPPR E+  AVKKCH AGINVHMLTGDFPG
Sbjct: 608  SQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPG 667

Query: 674  TAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTK 733
            TAK+IAQEVGILPHNLYHYPKEVV+ MVMTAT FD+L+D+E+D+LPVLPLVIARCAPQTK
Sbjct: 668  TAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARCAPQTK 727

Query: 734  VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASI 793
            VRMI+ALHRR +FCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLSDDNFASI
Sbjct: 728  VRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASI 787

Query: 794  LNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVV 853
            LNAVEEGRRMSDNIQKF            +YLM+GL FLDE+  SVFPLSPVEVLW+IVV
Sbjct: 788  LNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVV 847

Query: 854  TSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYK 913
            TSC PAMGLGLEKA  D+MEKPP D+KA IFTWEVIVDM+VYG+++A CC+ CFV++IY 
Sbjct: 848  TSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMACFVTVIYG 907

Query: 914  DGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETDTP 973
             G GNLG  CN  + DSC+ VF GRAA FATMTWCALILAWEV+DMRRSFF M PET+TP
Sbjct: 908  TGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFMMNPETETP 967

Query: 974  YTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVFWL 1033
            YTQVFKD+WSN+FLFWS++ GF SVFPVVYIPVIN KVFLH  I YEWG +  FSL FW 
Sbjct: 968  YTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYDITYEWGFSLGFSLAFWA 1027

Query: 1034 VAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSSTLS 1076
             AE +K+ KRRY+ +KDR  NPESDLE R + DPFE+Y+++ +
Sbjct: 1028 GAELYKYGKRRYFGSKDRVENPESDLEKRSVQDPFEQYTTSFT 1070

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 1400 bits (3625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1077 (63%), Positives = 819/1077 (76%), Gaps = 14/1077 (1%)

Query: 9    ISGGTDVYERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRA 68
            ++ G   +E +D+HAL   +               EE +ARL   G+N+LG++  I+ +A
Sbjct: 1    MTNGQIDFEFSDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKA 60

Query: 69   ILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKD 128
            +L+ Q+CNAMILVLIISM+I+ AI+DWI+GGVI FV+ +NV IG  QEY A KTMN+L+ 
Sbjct: 61   MLIHQICNAMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA 120

Query: 129  LSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEAL 188
            LS+P+A VIRNG   V+ S  VVPGD+V V+VGDT+PADLRLV   N ETDEALLTGE+L
Sbjct: 121  LSSPNAHVIRNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESL 180

Query: 189  PVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248
            PV+KD   +F+ +TPVGDR+NLAF+SSTV KGRA GI ++TGL +EIGKIA+SL+G   L
Sbjct: 181  PVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240

Query: 249  ISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQK 308
            ISRD  K+  QN  ++ K +VG+FLGT  GTPLHR                    MA+QK
Sbjct: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQK 300

Query: 309  FIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDI 368
            F V+R VAIYA+CVALSMIPSSLVVVLTITMS GA VM++RNVI+R+LDSLEALGAVNDI
Sbjct: 301  FDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI 360

Query: 369  CSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEED 428
            CSDKTGTLTQGKMI KQ+WVP+FGT+ V  SN P +P  GD++ IP  SP+EY H+E ED
Sbjct: 361  CSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETED 420

Query: 429  VGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAI 488
            VGI+ NFK +++  S+P     + F+ WL TA+LANIA+VF D ++KEW+AHGDPTEIAI
Sbjct: 421  VGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAI 480

Query: 489  QVFATRMDHPHHALT---------TXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMS 539
            QVFATRMD P H LT                        A   + HAAEFPFDS+IKRMS
Sbjct: 481  QVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMS 540

Query: 540  AVYINLRDKNTRHVFTKGAFERVLKCCTRW-KLDPGTGVTHPLTEDDLEIIQKNVDTLSN 598
            +VY   RD  T  ++TKGAFE VL CCT W   DP T     +T+ D++ I++N+D++S+
Sbjct: 541  SVY-ESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATV--MTDADVDTIKENIDSMSS 597

Query: 599  EGLRVLAFATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKC 657
            EGLRVLAFA K+ P  +  E   +++ K+RD+ E+ L F GL+GIYDPPR ETAGAVKK 
Sbjct: 598  EGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKF 657

Query: 658  HRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQ 717
            H+AGINV MLTGDFPGTAKAIAQEVGILP NLYHY KEVVDIMVMT  QFD+L+++E+D 
Sbjct: 658  HQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDN 717

Query: 718  LPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVA 777
            LPVLPLVIARC+PQTKVRMI+ALHRREKFCAMTGDGVNDSPSLK ANVGIAMGINGSDVA
Sbjct: 718  LPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 777

Query: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKL 837
            KDASDIVLSDDNFASILNAVEEGRRMSDNIQKF            +YL++GL F D++  
Sbjct: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGK 837

Query: 838  SVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGL 897
            SVFPL+PVEVLWIIVVTSC PAMGLGLEKAA D+M++PPNDSKAGIFTWE+IVDM VYG+
Sbjct: 838  SVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGV 897

Query: 898  VMAVCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVI 957
             MA  C+  FV+IIY   HGNLG NCN +YS+SC  VF  R+A FATMTWCALILAWEVI
Sbjct: 898  WMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVI 957

Query: 958  DMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGI 1017
            D+RRSFF M P+TD P  Q FKDI+ NKFLF+SV+FGF SVFPVVYIPVINT VFLH  I
Sbjct: 958  DLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPI 1017

Query: 1018 GYEWGIAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSST 1074
            G+EWGIA AFS+ FW+  E  K+ KR YYRNK RAINPE+DLEN+    PF+ YS++
Sbjct: 1018 GWEWGIAIAFSVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAYSTS 1074

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1362 bits (3525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1072 (61%), Positives = 811/1072 (75%), Gaps = 20/1072 (1%)

Query: 17   ERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMCN 76
            E   +H L   E A             +E+  RL+ VG+NTLG++  I+ +A++L Q+CN
Sbjct: 13   EFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 77   AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136
            AMI+VL+ISM I+ A++DWI+GGVI+FV+A+NV IG  QEY A KTMNSLK+LS+P+A V
Sbjct: 73   AMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 137  IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196
            IRNG+   + S  VVPGDI  V+VGDT+PADLRL+E  N +TDE+LLTGE+LPV+KD   
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 197  VF--EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDEN 254
            VF  E++T VGDRLNLAF+SS V KGRA GIV++T L SEIGKIA+SLQG   LISRD +
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 255  KSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNRE 314
            KS LQNT ++ K   G+FLGTNVGTPLHR                    MA+QKF V++ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 315  VAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTG 374
            VAIYAICVALSMIPSSLVVVLTITMS GA VM +RNVIVR+LDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 375  TLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIAN 434
            TLTQGKM+ +Q+W+P FGT+ ++ S+ PF+P  G+VSLIPRFSP+EY H+E+ DVGI+ N
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 435  FKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATR 494
            FK R     LP+ ++   F+ WL TATLANIATVFKD  +  W+AHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 495  MDHPHHALTTXXXXXXXXXXXXNDAARI-----------YEHAAEFPFDSSIKRMSAVYI 543
            MD PH+ALT             ND + +           +EH AEFPFDS++KRMS+VY 
Sbjct: 493  MDLPHNALT---GEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 544  NLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRV 603
            N  ++ T +++ KGAFE ++ CC+ W    G  +T PLT+ D+E I+KNV +LSNEGLRV
Sbjct: 550  NNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKIT-PLTDCDVETIRKNVYSLSNEGLRV 607

Query: 604  LAFATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGI 662
            L FA+K+   ++  +   + +T +R   ESDL+F GL+GIYDPPR ETAGAVKK H+AGI
Sbjct: 608  LGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 663  NVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLP 722
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VD MVMT +QFD L++EE+D LPVLP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 723  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 782
            LVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 783  IVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPL 842
            IVLSDDNFASILNAVEEGRRM+DNIQKF            +YL++GL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 843  SPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVC 902
            SPVEVLWIIVVTSC PAMGLGLEKAAPD+M++PPNDS+ GIFTWEVI+D   YG++M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 903  CLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRS 962
            C+  F   +Y    G LG +C+  Y+ SC+ V+  R+A FATMTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 963  FFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWG 1022
            FF M P+TD+P  + F+ IW N+FLFWS+IFGF S FPVVYIPVIN KVFLH  IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1023 IAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSST 1074
            +A AF++ FW+ AE +K  KRRY++ + RA N E+DLE    HDPFE YS++
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNSENDLERSSKHDPFEAYSTS 1078

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1359 bits (3518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1072 (61%), Positives = 812/1072 (75%), Gaps = 20/1072 (1%)

Query: 17   ERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMCN 76
            E   +H L   E A             +E+  RL+ VG+NTLG++  I+ +A++L Q+CN
Sbjct: 13   EFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 77   AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136
            AMI+VL+ISM I+ A++DWI+GGVI+FV+A+NV IG  QEY A KTMNSLK+LS+P+A V
Sbjct: 73   AMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 137  IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196
            IRNG+   + S  VVPGDI  V+VGDT+PADLRL+E  N +TDE+LLTGE+LPV+KD   
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 197  VF--EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDEN 254
            VF  E++T VGDRLNLAF+SS V KGRA GIV++T L SEIGKIA+SLQG   LISRD +
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 255  KSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNRE 314
            KS LQNT ++ K   G+FLGTNVGTPLHR                    MA+QKF V++ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 315  VAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTG 374
            VAIYAICVALSMIPSSLVVVLTITMS GA VM +RNVIVR+LDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 375  TLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIAN 434
            TLTQGKM+ +Q+W+P FGT+ ++ S+ PF+P  G+VSLIPRFSP+EY H+E+ DVGI+ N
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 435  FKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATR 494
            FK R     LP+ ++   F+ WL TATLANIATVFKD  +  W+AHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 495  MDHPHHALTTXXXXXXXXXXXXNDAARI-----------YEHAAEFPFDSSIKRMSAVYI 543
            MD PH+ALT             ND + +           +EH AEFPFDS++KRMS+VY 
Sbjct: 493  MDLPHNALT---GEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 544  NLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRV 603
            N  ++ T +++ KGAFE ++ CC+ W    G  +T PLT+ D+E I+KNV +LSNEGLRV
Sbjct: 550  NNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKIT-PLTDCDVETIRKNVYSLSNEGLRV 607

Query: 604  LAFATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGI 662
            L FA+K+   ++  +   + +T +R   ESDL+F GL+GIYDPPR ETAGAVKK H+AGI
Sbjct: 608  LGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 663  NVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLP 722
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VD MVMT +QFD L++EE+D LPVLP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 723  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 782
            LVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 783  IVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPL 842
            IVLSDDNFASILNAVEEGRRM+DNIQKF            +YL++GL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 843  SPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVC 902
            SPVEVLWIIVVTSC PAMGLGLEKAAPD+M++PP+DS+ GIFTWEVI+D   YG++M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 903  CLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRS 962
            C+  F   +Y    G LG +C+  Y+ SC+ V+  R+A FATMTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 963  FFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWG 1022
            FF M P+TD+P  + F+ IW N+FLFWS+IFGF S FPVVYIPVIN KVFLH  IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1023 IAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSST 1074
            +A AF++ FW+ AE +K  KRRY++ + RA NPE+DLE+    DPFE YS++
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYSTS 1078

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 1357 bits (3512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1072 (61%), Positives = 811/1072 (75%), Gaps = 20/1072 (1%)

Query: 17   ERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGINVRAILLKQMCN 76
            E   +H L A E A             +E   RL+ VG+NTLG++  I+ +A++L Q+CN
Sbjct: 13   EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCN 72

Query: 77   AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136
            AMI+VL+ISM+I+ A+ DWI+GGVI+FV+A+NV IG  QEY A KTMNSLK+LS+P+A V
Sbjct: 73   AMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHV 132

Query: 137  IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196
            IRNG+   + S  VVPGDI  V+VGDT+PADLRL+E  N +TDE+LLTGE+LPV+KD   
Sbjct: 133  IRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANL 192

Query: 197  VF--EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDEN 254
            VF  E++T VGDRLNLAF+SS V KGRA GIV++T L SEIGKIA+SLQG   LISRD +
Sbjct: 193  VFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPS 252

Query: 255  KSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNRE 314
            KS LQNT ++ K   G+FLGTNVGTPLHR                    MA+QKF V++ 
Sbjct: 253  KSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKR 312

Query: 315  VAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTG 374
            VAIYAICVALSMIPSSLVVVLTITMS GA VM +RNVIVR+LDSLEALGAVNDICSDKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 375  TLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIAN 434
            TLTQGKM+ +Q+W+P FGT+ ++ S+ PF+P  G+VSLIPRFSP+EY H+E+ DVGI+ N
Sbjct: 373  TLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 435  FKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATR 494
            FK R     LP+ ++   F+ WL TATLANIATVFKD  +  W+AHGDPTEIAIQVFAT+
Sbjct: 433  FKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATK 492

Query: 495  MDHPHHALTTXXXXXXXXXXXXNDAARI-----------YEHAAEFPFDSSIKRMSAVYI 543
            MD PH+ALT             ND + +           +EH AEFPFDS++KRMS+VY 
Sbjct: 493  MDLPHNALT---GEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYY 549

Query: 544  NLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRV 603
            N  ++ T +++ KGAFE ++ CC+ W    G  +T PLT+ D+E I+KNV +LSNEGLRV
Sbjct: 550  NNHNE-TYNIYGKGAFESIISCCSSWYGKDGVKIT-PLTDCDVETIRKNVYSLSNEGLRV 607

Query: 604  LAFATKTIPAEEA-ESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGI 662
            L FA+K+   ++  +   + +T +R   ESDL+F GL+GIYDPPR ETAGAVKK H+AGI
Sbjct: 608  LGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 663  NVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLP 722
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VD MVMT +QFD L++EE+D LPVLP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 723  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 782
            LVIARC+PQTKVRMI+ALHRR+KFC MTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 783  IVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPL 842
            IVLSDDNFASILNAVEEGRRM+DNIQKF            +YL++GL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 843  SPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVC 902
            SPVEVLWIIVVTSC PAMGLGLEKAAPD+M++PP+DS+ GIFTWEVI+D   YG++M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 903  CLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRS 962
            C+  F   +Y    G LG +C+  Y+ SC+ V+  R+A FATMTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 963  FFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWG 1022
            FF M P+TD+P  + F+ IW N+FLFWS+IFGF S FPVVYIPVIN KVFLH  IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1023 IAFAFSLVFWLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSST 1074
            +A AF++ FW+ AE +K  KRRY++ + RA NPE+DLE+    DPFE YS++
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYSTS 1078

>Scas_569.0d
          Length = 468

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/376 (71%), Positives = 315/376 (83%), Gaps = 1/376 (0%)

Query: 700  MVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPS 759
            MVMT +QFD LT E++D LPVLPLVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDSPS
Sbjct: 80   MVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPS 139

Query: 760  LKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXX 819
            LK ANVGIAMGINGSDVAKDASDIVLSDDNFASILNA+EEGRRMSDNIQKF         
Sbjct: 140  LKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENV 199

Query: 820  XXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDS 879
               +YL+ GL F D++  SVFPL+PVEVLWIIVVTSC PAMGLGLEKAAPD+M++PPNDS
Sbjct: 200  AQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDS 259

Query: 880  KAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRA 939
            K+GIFTWE+IVDM VYG++MA CC+G F +++Y    GNLG NCN  Y+++C  VF GR+
Sbjct: 260  KSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRGRS 319

Query: 940  ATFATMTWCALILAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVF 999
            + FA MTWCALILAWEV+D+RRSFF M+PETDTP  + F+DIWSNKFLFWS+IFGF S F
Sbjct: 320  SAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVSTF 379

Query: 1000 PVVYIPVINTKVFLHIGIGYEWGIAFAFSLVFWLVAEFWKFAKRRYYRN-KDRAINPESD 1058
            PV+YIPVIN KVFLH GI +EWGIAFAF+++FW+  E +KF KRRY+R   ++A NPESD
Sbjct: 380  PVIYIPVINDKVFLHKGITFEWGIAFAFTIIFWMGCELYKFMKRRYFRRMMNKAQNPESD 439

Query: 1059 LENRRLHDPFEKYSST 1074
            LE R   DPFE YS++
Sbjct: 440  LEKRTRRDPFEAYSTS 455

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 16 YERTDFHALPAHEVAXXXXXXXXXXXXAEEARARLEVVGDNTLGEEEGIN 65
          YE  +FH L + E A             E+ +AR   VG+N+LG++   N
Sbjct: 26 YEYNEFHTLQSQETANLLQTDASKGLDDEKFQARKSAVGENSLGDDMKSN 75

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score =  342 bits (878), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 267/894 (29%), Positives = 440/894 (49%), Gaps = 137/894 (15%)

Query: 43  AEEARARLEVVGDN--TLGEEEGINVRAILLKQMCNAMILVLIISMVIAL---AIKDWIS 97
           + EA  R  + G N  T+ ++E +  +  L   + + MIL+LI S V++L    I D +S
Sbjct: 61  SNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVS 119

Query: 98  GGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQ 157
             +  F+V   V++G  QEY + K++ +L  L      ++R G++  + ++ +VPGD+V 
Sbjct: 120 ITLAIFIV---VTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVH 176

Query: 158 VRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQD--------TPVGDRLN 209
            R+GD +PAD+R++EA++L  DE+ LTGE  PV K    + +           P+ +R  
Sbjct: 177 FRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSC 236

Query: 210 LAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTV--LTVKA 267
           +A+  + V +G   GIVV TG  +  G + E +   +      + K+ LQ T+  L    
Sbjct: 237 IAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIE------KPKTPLQLTMDKLGKDL 290

Query: 268 SVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNR---EVAIYAICVAL 324
           S+ SF+                              +     I  R   E+   ++ +A+
Sbjct: 291 SLVSFI--------------------------VIGMICLVGIIQGRSWLEMFQISVSLAV 324

Query: 325 SMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILK 384
           + IP  L +++T+T++ G   M+ R  IVRRL S+E LG+VN ICSDKTGTLT   M + 
Sbjct: 325 AAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVS 384

Query: 385 QLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSL 444
           +LW  +    + N+ NV                           + +  N K +  + +L
Sbjct: 385 KLWCLD---SMSNKLNV---------------------------LSLDKNKKTKNSNGNL 414

Query: 445 PKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH-GDPTEIAIQVFATRMDHPHHALT 503
              L     E    T T+ N+      S S+E     G+PT++A+       + P     
Sbjct: 415 KNYLT----EDVRETLTIGNLCN--NASFSQEHAIFLGNPTDVALLEQLANFEMP----- 463

Query: 504 TXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVL 563
                         D     +   E PF+S  K M+   +N  D N   V+ KGAFER+L
Sbjct: 464 --------------DIRNTVQKVQELPFNSKRKLMATKILNPVD-NKCTVYVKGAFERIL 508

Query: 564 KCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERL 623
           +  T +    G   T  LTE     I +  +++++EGLRV  FA  T+ ++ +  L E L
Sbjct: 509 EYSTSYLKSKGKK-TEKLTEAQKATINECANSMASEGLRVFGFAKLTL-SDSSTPLTEDL 566

Query: 624 TKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVG 683
            KD       L F GL+G+ DPPR     A+++  + G+++ M+TGD   TA  IA+++G
Sbjct: 567 IKD-------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIG 619

Query: 684 ILPHNLYHYPKEVVD--IMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALH 741
           I           V+D  + V++  + D ++D++L  +     + AR  P+ K+ ++ AL 
Sbjct: 620 I----------PVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALR 669

Query: 742 RREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801
           +R    AMTGDGVND+P+LK +++G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+
Sbjct: 670 KRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGK 729

Query: 802 RMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMG 861
            + +NIQ F              + L   F    KL   PL+ +++LWI ++    PA  
Sbjct: 730 GIFNNIQNFLTFQLSTSVAALSLVALSTAF----KLP-NPLNAMQILWINILMDGPPAQS 784

Query: 862 LGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDG 915
           LG+E    ++M+KPP      I T +V+  ++     + V  +  FV  + +DG
Sbjct: 785 LGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDG 838

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score =  340 bits (872), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 261/872 (29%), Positives = 429/872 (49%), Gaps = 128/872 (14%)

Query: 44  EEARARLEVVGDNTLGEEEGIN-VRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIA 102
           EE   R E+ G N   E++  + ++  L+  + + +IL+LI S V++ AI        I+
Sbjct: 72  EEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRLILLLIGSAVLSFAIGQIDDAVSIS 131

Query: 103 FVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGD 162
             + + V++G  QEY + K++ +L  L      +IR G +    ++++VPGD+V+ ++GD
Sbjct: 132 LAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGD 191

Query: 163 TVPADLRLVEALNLETDEALLTGEALPVAKD-----PAAVFEQDTPVGDRLNLAFASSTV 217
            +PAD+R++EA++L  DE+ LTGE  P+ KD     P     ++ PV +R  +A+  + V
Sbjct: 192 RIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDPEEYDNRNVPVSERSCIAYMGTLV 251

Query: 218 SKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNV 277
            +G   GIV+ TG  +  G I E +       S ++ K+ LQ T+          LGT +
Sbjct: 252 KEGHGKGIVIGTGTNTSYGAIFEMVN------SIEKPKTPLQETM--------DRLGTEL 297

Query: 278 GTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTI 337
               +                     M  Q           ++ +A++ IP  L +++T+
Sbjct: 298 S---YISFFIIAIISIVGIIRGNSLLMMFQ----------VSVSLAVAAIPEGLPIIVTV 344

Query: 338 TMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVN 397
           T++ G   M+ +N IVRRL S+E LG+VN IC+DKTGTLT   M + +L+  +      N
Sbjct: 345 TLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYEN 404

Query: 398 RSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWL 457
                              SP E   D E DV            N + +           
Sbjct: 405 A-----------------ISPEE---DSEFDV----------HDNDVKE----------- 423

Query: 458 HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXXXN 517
            T T+ANI    K S+       G+PT++A+    T+   P                   
Sbjct: 424 -TLTIANICNNAKYSEEHNLYI-GNPTDVALIEVLTKFGIP------------------- 462

Query: 518 DAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHV-FTKGAFERVLKCCTRWKLDPGTG 576
           D    +E   E  F+S  K M+   I    ++  HV + KGAFER+L   + + LD   G
Sbjct: 463 DQRDSHEKMEELSFNSKRKYMA---IKSSKESGEHVLYIKGAFERILDKSSYY-LDKA-G 517

Query: 577 VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIF 636
                 E    ++ +   + +++GLR +A A K  P +    + E      D +   L F
Sbjct: 518 EVREFDEHSKVMVLEAAHSCASDGLRTIACAFK--PTDSDNVISE------DDING-LTF 568

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEV 696
            GL G+ DPPR     +++K HR G+++ M+TGD   TA +IA+++G+   +        
Sbjct: 569 TGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDR------- 621

Query: 697 VDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVND 756
            +  VMT  +   LT++EL ++     + AR  P+ K+ ++ AL +R    AMTGDGVND
Sbjct: 622 -ESSVMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVND 680

Query: 757 SPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXX 816
           +P+LK A++GIAMGI+G+DVAK+ SD++L+DD+F+SIL A+EEG+ + +NI+ F      
Sbjct: 681 APALKLADIGIAMGISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLS 740

Query: 817 XXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPP 876
                    ++ +T +   KL   PL+P+++LWI ++    PA  LG+E    D+M+KPP
Sbjct: 741 ISVAT--LSLIAITTI--AKLPA-PLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPP 795

Query: 877 NDSKAGIFTWEVIVDMIVYGLVMAVCCL-GCF 907
              +  I    +++ +    L +A+C L G F
Sbjct: 796 RSREERILNMNILLRL----LYLAICILVGTF 823

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score =  338 bits (866), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 257/888 (28%), Positives = 431/888 (48%), Gaps = 132/888 (14%)

Query: 44  EEARARLEVVGDN--TLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           EEA  R +  G N  ++ ++E + V+  L   + + +IL+L+ S +I++ + +      I
Sbjct: 70  EEATKRRQYYGPNEISVDDDESL-VKKFLSNFVEDRLILLLMGSAIISVFLGNIDDAISI 128

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
              + + V++G  QEY + K++ +L  L      +IR G +  + +  +VPGD+V+ R+G
Sbjct: 129 TMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIG 188

Query: 162 DTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQD--------TPVGDRLNLAFA 213
           D +PAD+R++E  +L  DE+ LTGE  PV K   A+             PV +R N+A+ 
Sbjct: 189 DRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYM 248

Query: 214 SSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTV--LTVKASVGS 271
            + V +G   GIVV TG  +  G + E +       S ++ K+ LQ T+  L    S+ S
Sbjct: 249 GTLVKEGNGRGIVVGTGRETSFGNVFEMMS------SIEKPKTPLQLTMDKLGKDLSLAS 302

Query: 272 FLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSL 331
           F+   +   +                                E+   ++ +A++ IP  L
Sbjct: 303 FVVIGIICVVGIIQGRSWL-----------------------EMFQISVSLAVAAIPEGL 339

Query: 332 VVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEF 391
            +++T+T++ G   M+ R  IVRRL S+E LG+VN ICSDKTGTLT   M + ++W    
Sbjct: 340 PIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWC--L 397

Query: 392 GTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPR 451
           G++    + +  D   G                         N K     +         
Sbjct: 398 GSMANKLNVLSLDKNKG------------------------GNLKNYLTDD--------- 424

Query: 452 KFESWLHTATLANIATVFKDSDSKEWRAH-GDPTEIAIQVFATRMDHPHHALTTXXXXXX 510
             ++ L    L N A     S S+E   + G+PT++A+     + +              
Sbjct: 425 -VKTTLLCGNLCNNA-----SYSQEHAKYLGNPTDVALLEQLQKFELA------------ 466

Query: 511 XXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWK 570
                  D    Y    E  F+S  ++M A  I   +K T  +F KGAFER+L   + + 
Sbjct: 467 -------DVRSEYTKVKELSFNSK-RKMMATKIQDNEKKTT-LFIKGAFERILDKSSSYL 517

Query: 571 LDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFV 630
            + G      LT    E I    +TL++EGLRVLAFA + +    ++ + + +       
Sbjct: 518 TEKGK--IEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDI------- 568

Query: 631 ESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLY 690
            SDL+F GL+G+ DPPR     A+ +  + GI++ M+TGD   TA  IA+++GI      
Sbjct: 569 -SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI------ 621

Query: 691 HYPKEVVD--IMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCA 748
                V+D  + V++  + + +TD++L  +     + AR  P+ K+ ++ AL RR    A
Sbjct: 622 ----PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVA 677

Query: 749 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQ 808
           MTGDGVND+P+LK A++G++MG  G+DVAK+ASD++L+DD+F++IL A+EEG+ + +NIQ
Sbjct: 678 MTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQ 737

Query: 809 KFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAA 868
            F              + L   F+  +     PL+ +++LWI ++    PA  LG+E   
Sbjct: 738 NFLSFQLSTSIAALSLVALSTAFMLPN-----PLNAMQILWINILMDGPPAQSLGVEPVD 792

Query: 869 PDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDGH 916
            ++M+KPP      I T E++  +I     + +  +  FV  + +DG 
Sbjct: 793 HEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAEDGQ 840

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  325 bits (833), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 259/883 (29%), Positives = 419/883 (47%), Gaps = 124/883 (14%)

Query: 45  EARARLEVVGDNTLGEEEGINV-RAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAF 103
           E   R  + G N +  +E +++ +  L   + + +IL+LI S VI+  + +      IA 
Sbjct: 58  EIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNIDDSISIAL 117

Query: 104 VVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDT 163
            + + V++G  QEY + K++ +L  L      + R+G+   + ++ +VPGD+V+ +VGD 
Sbjct: 118 AIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDR 177

Query: 164 VPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQD--------TPVGDRLNLAFASS 215
           +PADLR+VE+++L  DE+ LTGE  PV K   AV  ++         PVGDR  + F  +
Sbjct: 178 IPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGT 237

Query: 216 TVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGT 275
            V +G   GIV+ TG  +  G + E + G       D+ K+ LQ  +             
Sbjct: 238 LVREGHGKGIVIATGKHTVFGSVFEMMSGI------DKPKTPLQTAM------------D 279

Query: 276 NVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVL 335
            +G  L                      +         E+   A+ +A++ IP  L +++
Sbjct: 280 KLGQDLSYMSFVLIGIICLIGIIQGRSWL---------EMFQIAVSLAVAAIPEGLPIIV 330

Query: 336 TITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVV 395
           T+T++ G   M+ R  IVRRL S+E LG+VN ICSDKTGTLT   M + ++W    G++ 
Sbjct: 331 TVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWC--LGSME 388

Query: 396 VNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFES 455
            N++N                               ++  K+R           P K E 
Sbjct: 389 -NKTNCL----------------------------ALSKVKER-----------PIKMEQ 408

Query: 456 WLHTATLANIATVFKDS--DSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXXXXXXX 513
               AT   I  +  +     +  +  G+PT+IAI      ++   H             
Sbjct: 409 --DVATTLRIGNICNNGTYSQEHLKYLGNPTDIAI------LESLQH------------- 447

Query: 514 XXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDP 573
              ND         E PF+S  K M+   I+  DK    V+ KGAFE++++    +    
Sbjct: 448 FGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVV--VYVKGAFEKIVEKSINYIGRD 505

Query: 574 GTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESD 633
           G    H L  +D  II      L++EGLR LAFA   + A   +        + D VE  
Sbjct: 506 GK--VHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDK-----EFNEDMVEG- 557

Query: 634 LIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYP 693
           L F GL+ + DPPR     A+++  +  ++V M+TGD   TA +IA+++GI        P
Sbjct: 558 LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI--------P 609

Query: 694 KEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDG 753
               +  V++  + D +TD++L  +     V AR  P+ K+ ++ AL +R    AMTGDG
Sbjct: 610 VINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDG 669

Query: 754 VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXX 813
           VND+P+LK A++G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F   
Sbjct: 670 VNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTF 729

Query: 814 XXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIME 873
                        L L  +        PL+ +++LWI ++    PA  LG+E    ++M 
Sbjct: 730 QLSTSVAA-----LSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMR 784

Query: 874 KPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDGH 916
           KPP      I T  V+  +++    + V  +  FV  + +DG 
Sbjct: 785 KPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQ 827

>Scas_707.48*
          Length = 741

 Score =  318 bits (815), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 241/782 (30%), Positives = 397/782 (50%), Gaps = 126/782 (16%)

Query: 43  AEEARARLEVVGDNTLGEEEGINV-RAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           AE +R +L V G N +  EE  ++ +  L   + + +IL+LI S V++  + +      I
Sbjct: 62  AEASRRKL-VYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSI 120

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
              + + VS+G  QEY + K++ +L  L      +IR G++  + ++ +VPGD+V  ++G
Sbjct: 121 TLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKIG 180

Query: 162 DTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQD--------TPVGDRLNLAFA 213
           D +PADLR++EA++L  DE+ LTGE  PV K    V +           P+ DR  +A+ 
Sbjct: 181 DRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYM 240

Query: 214 SSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFL 273
            + V +G   GIVV  G  +  G I E L       + ++ K+ LQN +  +   +  F 
Sbjct: 241 GTLVKEGHGKGIVVGIGKNTSFGAIFEMLS------NIEKPKTPLQNAMDKLGKDLSLFS 294

Query: 274 GTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVV 333
              +G                         +  + ++   E+   ++ +A++ IP  L +
Sbjct: 295 FIVIG------------------LICLVGILQGRSWL---EMFQISVSLAVAAIPEGLPI 333

Query: 334 VLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGT 393
           ++T+T++ G   M+ R  IVRRL S+E LG+VN ICSDKTGTLT   M   ++W  +   
Sbjct: 334 IVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLD--- 390

Query: 394 VVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKF 453
            + N++NV        +SL                        ++ +S SL   L     
Sbjct: 391 SMANKANV--------LSL------------------------EKSKSGSLKNYLT---- 414

Query: 454 ESWLHTATLANIATVFKDSDSKEWRAH-GDPTEIAIQVFATRMDHPHHALTTXXXXXXXX 512
           E    T T+ NI      S S+E   + G+PT+IA+    ++ D                
Sbjct: 415 EDVKSTLTIGNICN--NASFSQEHGKYLGNPTDIALLEQLSKFD---------------- 456

Query: 513 XXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLD 572
               +D    ++   E PF+S  K M+   +N   K +  V  KGAFE+VL  C+ +   
Sbjct: 457 ---LSDIRPTFKKVQEIPFNSKRKFMAVKIVNSEGKYSLCV--KGAFEKVLSQCSHYLNQ 511

Query: 573 PGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEA----ESLGERLTKDRD 628
            G   T  LT+   ++I +  ++L++EGLR+LAFA  T+P        ES+G        
Sbjct: 512 KGK--TEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPTLLTEESVG-------- 561

Query: 629 FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN 688
               DLIF GL+G+ DPPR     A+++  + G+++ M+TGD   TA  IA+++GI    
Sbjct: 562 ----DLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQIGI---- 613

Query: 689 LYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCA 748
               P     + V++  + + ++D++L  +     + AR  P+ K+ ++ AL +R    A
Sbjct: 614 ----PVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVA 669

Query: 749 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQ 808
           MTGDGVND+P+LK A++G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ
Sbjct: 670 MTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQ 729

Query: 809 KF 810
            F
Sbjct: 730 NF 731

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  316 bits (810), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 277/991 (27%), Positives = 456/991 (46%), Gaps = 161/991 (16%)

Query: 76   NAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSAR 135
            + +IL+LI S V++  + +      I   V + VS+G  QEY + K++ +L  L   S  
Sbjct: 101  DPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCH 160

Query: 136  VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195
            +IR G +  + ++ +VPGD+V  +VGD +PAD+R++E+ +L  DE+ LTGE  PV K   
Sbjct: 161  LIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCT 220

Query: 196  AVFEQD--------TPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQS 247
             V             P+G+R ++A+  + V +G   GIVV TG  +  G + E +     
Sbjct: 221  PVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN---- 276

Query: 248  LISRDENKSGLQNTVLTVKASVG--SFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMA 305
              S ++ K+ LQ  + T++  +    F+ + +                          + 
Sbjct: 277  --SIEKPKTPLQMAMDTLRRDLSYVRFVLSGI--------------------------IF 308

Query: 306  TQKFIVNR---EVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEAL 362
                I  R   E+   ++ +A++ IP  L +++T+T++ G   M+ R  IVRRL S+E L
Sbjct: 309  LLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETL 368

Query: 363  GAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQ 422
            G+VN ICSDKTGTLT   M   ++W    G++  N++NV        +SL          
Sbjct: 369  GSVNVICSDKTGTLTANHMTASKIWC--LGSMA-NKNNV--------LSL---------- 407

Query: 423  HDEEEDVGIIANFKQRWQSNSLPKGL-NPRKFESWLHTATLANIATVFKDSDSKEWRAH- 480
                          +   S  LP  L N + + S    ATL   +     S S E   + 
Sbjct: 408  --------------EAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYL 453

Query: 481  GDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSA 540
            G+PT+IA+     + D      TT                       E  F+S  K M A
Sbjct: 454  GNPTDIALLEVLQKFDLVDERPTTT-------------------RVDELTFNSKRKYM-A 493

Query: 541  VYINLRDKNTRHV-FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNE 599
            V ++    + +H+ + KGAFER+L+    +    G G    L++    +I     +L++E
Sbjct: 494  VKVDSPANSGKHIIYVKGAFERILERSASFI--GGAGKVEKLSDSHKSLINDCAKSLASE 551

Query: 600  GLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHR 659
            GLR LAFA       + E    +   D      +L F GL+G+ DPPR     A+++  +
Sbjct: 552  GLRTLAFA-------QLECSTNKPMNDSTI--QNLTFVGLIGMKDPPRSTVRPAIEELLQ 602

Query: 660  AGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLP 719
             G++V M+TGD   TA  IA+++GI        P    +I V+T  + D +TD++L  + 
Sbjct: 603  GGVHVIMITGDAENTAVNIARQIGI--------PVINPEISVLTGDRLDQMTDDQLAGVI 654

Query: 720  VLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 779
                + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G+AMG  G+DVAK+
Sbjct: 655  DHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKE 714

Query: 780  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSV 839
            ASD+VL+DD+F++IL A+EEG+ + +NIQ F              + +   F  ++    
Sbjct: 715  ASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN---- 770

Query: 840  FPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVM 899
             PL+ +++LWI ++    PA  LG+E    ++M KPP      I T +V+  +++    +
Sbjct: 771  -PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFI 829

Query: 900  AVCCLGCFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDM 959
                +  F+  + +DG         V   D+          TF    +  +  A      
Sbjct: 830  IGGTIYVFIKEMTEDGQ--------VTARDT--------TMTFTCFVFFDMFSALACRHA 873

Query: 960  RRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGY 1019
             +S F +              I++NK   ++V F        +YIP      F +I    
Sbjct: 874  TKSIFEI-------------GIFNNKMFNYAVGFSLLGQLCAIYIP-----FFQNIFKTE 915

Query: 1020 EWGIAFAFSLVFWLVAEFWKFAKRRYYRNKD 1050
               +     L+    + F     R+YY  K+
Sbjct: 916  RLSLGDLIYLIVISSSVFIADEVRKYYAKKN 946

>Kwal_14.1498
          Length = 939

 Score =  314 bits (805), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 248/857 (28%), Positives = 418/857 (48%), Gaps = 138/857 (16%)

Query: 78  MILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVI 137
           +IL+LI S VI+  + +      I   + + V++G  QEY + K++ +L  L      +I
Sbjct: 92  LILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLI 151

Query: 138 RNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAV 197
           R G++  + ++ +VPGD+V+ RVGD +PADLR++EA++L  +E+ LTGE  PV K  A V
Sbjct: 152 RCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATV 211

Query: 198 ---FEQDT-----PVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLI 249
              F ++      PV +R  +AF  + V +G   GIV+ T   +  GK+ E +   +   
Sbjct: 212 NKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIE--- 268

Query: 250 SRDENKSGLQNTV--LTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQ 307
              + K+ LQ  +  L    S  SF+   +                          +   
Sbjct: 269 ---KPKTPLQTAMDKLGKDLSFMSFIVIGI--------------------------ICLI 299

Query: 308 KFIVNR---EVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGA 364
             I  R   E+   ++ +A++ IP  L +++T+T++ G   M+ R  I+RRL S+E LG+
Sbjct: 300 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGS 359

Query: 365 VNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHD 424
           VN ICSDKTGTLT   M + ++W    G++  N+SN+                    + D
Sbjct: 360 VNVICSDKTGTLTANHMSVNKVWC--LGSMS-NKSNI-------------------LKLD 397

Query: 425 EEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPT 484
                        +  S S  K L      + L T  L N +T       +  +  G+PT
Sbjct: 398 -------------KATSGSFKKNLT-EDLRATLRTGNLCNNSTY----SHEHAKYLGNPT 439

Query: 485 EIAI----QVFATRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSA 540
           +IA+      F    + P                           + E  F+S  K M+ 
Sbjct: 440 DIALLEVLHKFGLEDERPQ-----------------------VTRSDEISFNSKRKFMA- 475

Query: 541 VYINLRDKNTRHVF-TKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNE 599
             + +++ N + V   KGA+E++L+  T + ++    V   L  +  + I  + D L+++
Sbjct: 476 --VKVKEANGKFVVHVKGAYEKILEKSTHF-INAENKVVK-LDSNLRQAITDSADALASD 531

Query: 600 GLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHR 659
           GLR LAFA      E +    ++LT+D D   + L F GL+G+ DPPR     AV++   
Sbjct: 532 GLRTLAFAQ----LELSNGNSKKLTED-DI--NGLTFAGLLGMNDPPRPSVKAAVERLSE 584

Query: 660 AGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLP 719
             +++ M+TGD   TA +IA+++GI        P    +  V+T  + D +++++L  + 
Sbjct: 585 GSVHIIMITGDAENTAVSIARQIGI--------PVVNPETAVLTGDKLDHMSEDQLASII 636

Query: 720 VLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 779
               + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G++MG  G+DVAK+
Sbjct: 637 DHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKE 696

Query: 780 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSV 839
           ASD+VL+DD+F++IL A+EEG+ + +NIQ F              + +   F    KL  
Sbjct: 697 ASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAF----KLP- 751

Query: 840 FPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVM 899
            PL+ +++LWI ++    PA  LG+E    ++M+KPP      I T  V   ++    ++
Sbjct: 752 NPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALI 811

Query: 900 AVCCLGCFVSIIYKDGH 916
            +  +  F+  + +DG 
Sbjct: 812 IIGTIYVFIKEMAEDGE 828

>Kwal_47.17547
          Length = 1240

 Score =  218 bits (555), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 225/887 (25%), Positives = 393/887 (44%), Gaps = 139/887 (15%)

Query: 94  DWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTP-SARVIRNGEDVVMASAQVVP 152
           DW+ G  I   V + + +G+  +Y      + L D        V+RNG++ +++   ++ 
Sbjct: 147 DWVEGVAIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILV 206

Query: 153 GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA--------------AVF 198
           GDI+ ++ GD VPAD  LV+  + E DE+ LTGE+  + K                 A  
Sbjct: 207 GDILSLQTGDVVPADCILVKG-SCECDESALTGESATIKKAAIDVCYEKYKQLSATDAAI 265

Query: 199 EQDTPVGDRLN--LAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKS 256
           +  TP  +++   +  + S +  G    +V   G+ S  G+   +L+ +       E   
Sbjct: 266 DIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALKVEAETTPLQERLD 325

Query: 257 GLQNTVLTVKASVGSFL-----------GTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMA 305
            L N++ +V  S  + L               G  LH                       
Sbjct: 326 SLANSI-SVYGSAAALLLFFILFMRFLANLKKGGELH-------------------DLTP 365

Query: 306 TQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAV 365
            QK      + I  I V +  +P  L + +T+ ++     M+    +VR L + E +G+ 
Sbjct: 366 AQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSA 425

Query: 366 NDICSDKTGTLTQGKM-----ILKQLWVPEFGTVVVNRSNVPFDPTVGD----------- 409
             +CSDKTGTLT+ +M      L   +  E  +V  + S    D  + +           
Sbjct: 426 TAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANECSEELKKDVL 485

Query: 410 VSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVF 469
            ++    + +E + +EE+ V     F +  +S   P   N +  +       + N A   
Sbjct: 486 TNITLNSTAFENKENEEDKVSNENPFHKPRKS-LFPWSRNNKSKKPATAKELVENAA--- 541

Query: 470 KDSDSKEWRAHGDPTEIAIQVFATR---MDHPHHALTTXXXXXXXXXXXXNDAARIYEHA 526
             +D  +    G  TE A+  FA +   M + HH                 D   I +  
Sbjct: 542 --ADQPKEPFLGSKTETALLAFAQKNLGMQNLHH------------YRDEPDCLGIEKIV 587

Query: 527 AEFPFDSSIKRMSAVYINLRDKNTRHVF-TKGAFERVLKCCTRWKLDPGTGVTHPLTEDD 585
              PF+SS K    V   ++ KN  H F  KGA E +L+ C + K    + +T  +++ D
Sbjct: 588 QIIPFESSRKWGGIV---VKYKNGLHRFYIKGAAELLLRRCMQ-KRASDSKLTL-ISQKD 642

Query: 586 LEIIQKNVDTLSNEGLRVLAFATKTIP--------------AEEAES----LGERLTKDR 627
            +   + +  L+ E LR ++ A +  P                EA S     G+ +++  
Sbjct: 643 FDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSD 702

Query: 628 DFVE------SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQE 681
              E      S ++  G+VGI DP R     +V++C +AG+ V M+TGD   TA AIA++
Sbjct: 703 SVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKK 762

Query: 682 VGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLP--LVIARCAPQTKVRMIDA 739
             IL       P+       M   +F  L+++E  ++ +LP   V+AR +P+ K  +++ 
Sbjct: 763 CSILSEEQAENPESS-----MEGPRFRKLSNKE--RVRILPNLRVLARSSPEDKRILVET 815

Query: 740 LHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 799
           L +     A+TGDG ND+P+LK A+VG +MGI G++VA++ASDI+L  D+F++I+NA++ 
Sbjct: 816 LKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKW 875

Query: 800 GRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFL----DEDKLSVFPLSPVEVLWIIVVTS 855
           GR +S +I+KF            +     LTF+      ++ SV  L+ V++LW+ ++  
Sbjct: 876 GRCVSTSIKKFIQFQLTVNVTAVV-----LTFVSAVASSEEASV--LTAVQLLWVNLIMD 928

Query: 856 CLPAMGLGLEKAAPDIMEKPPNDSKA---GIFTWEVIVDMIVYGLVM 899
            L A+ L  +K   +I+E+ P   +A    + TW++I+      L++
Sbjct: 929 TLAALALATDKPDENILERKPKGREAVLITVSTWKMILGQSTLQLIV 975

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  211 bits (538), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 239/932 (25%), Positives = 418/932 (44%), Gaps = 144/932 (15%)

Query: 45   EARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIK----------- 93
            E+  R +V G N + E +G +   ++ +   +  +++L ++ VI+ A+            
Sbjct: 130  ESLERTQVYGLNRIPERKGKSFLRLVWEAFNDKTMILLTVAAVISFALGLYETLGQPPEY 189

Query: 94   ----------DWISGGVIAFVVALNVSIGA---YQEYNACKTMNSLKDLSTPSARVIRNG 140
                      +W+ G  I   V + V +GA   YQ+      +N  KD       VIRNG
Sbjct: 190  DPEGNEIVKVEWVEGVAIMIAVVVVVLVGAINDYQKELQFAKLNKKKD--DRDVVVIRNG 247

Query: 141  EDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEA---LPVAKDPA-- 195
            ++ +++   ++ GD++ ++ GD VPAD  L+   + E DE+ LTGE+     VA  PA  
Sbjct: 248  DEHLISIHDLLVGDVISLQTGDVVPADAVLISG-SCECDESALTGESDTIKKVALKPALE 306

Query: 196  ---AVFEQDTP-------VGDRLN--LAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQ 243
                +FE+D         VG+++   L  + S +  G    ++   G  S  G+I  +L+
Sbjct: 307  KYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRIMMALK 366

Query: 244  GKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXX 303
             +       E  S L + +        S  G      L                      
Sbjct: 367  TESESTPLQERLSNLADNI--------SIYGCMAALVLFIILFIRFLTYLPNGKKYHDLP 418

Query: 304  MATQ--KFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEA 361
             A +  KF+    + I A+ V +  +P  L + +T+ ++     M+    +VR L + E 
Sbjct: 419  PAQKGSKFM---NIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACET 475

Query: 362  LGAVNDICSDKTGTLTQGKMILKQLWVPEFG-------------TVVVNRSNVP---FDP 405
            +G+   ICSDKTGTLT+ +M + + +    G             + VV RSN        
Sbjct: 476  MGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTD 535

Query: 406  TVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANI 465
             + ++SL    + +E +  + +D  +  N   + + +  P   N R       T+ L  I
Sbjct: 536  ILSNISL--NSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNR-------TSQL--I 584

Query: 466  ATVFKDSDSKEWRAHGDPTEIAIQVFATR---MDHPHHALTTXXXXXXXXXXXXNDAARI 522
            A   K++D +     G  TE A+  FA +   M   H   T                  I
Sbjct: 585  ADAMKENDEQFL---GSKTETALLAFAQKSLGMKDVHKLRTKPSDLG------------I 629

Query: 523  YEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLT 582
             +     PF+SS ++  A+ + L D      + KGA E +LK C+  +    + V  P+ 
Sbjct: 630  DKVVQVIPFESS-RKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIV--PMN 686

Query: 583  EDDLEIIQKNVDTLSNEGLRVLAFATKTI----PAEEAES-----------LGERLTKDR 627
            +D  +   K +  +++  LR ++   +      P E A+S           +G  L   +
Sbjct: 687  QDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDH-K 745

Query: 628  DFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH 687
            +     +    +VG+ DP R     +V++C RAG+ V M+TGD   TA+AI++   IL  
Sbjct: 746  NLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSE 805

Query: 688  NLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLP--LVIARCAPQTKVRMIDALHRREK 745
              Y+ P+       M    F  L  +++  L V+P   V+AR +P+ K  +++ L +  +
Sbjct: 806  EGYNDPE-----CAMEGPTFRKLPYKKM--LRVIPKLRVLARSSPEDKRILVETLKKMGE 858

Query: 746  FCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSD 805
              A+TGDG ND+P+LK A+VG +MGI+G++VA++ASDI+L  D+F +I+NA++ GR +S 
Sbjct: 859  VVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSV 918

Query: 806  NIQKFXXXXXXXXXXXXIYLMLGLTFL----DEDKLSVFPLSPVEVLWIIVVTSCLPAMG 861
            +I+KF            I     LTF+      ++ SV  L+ V++LW+ ++   L A+ 
Sbjct: 919  SIKKFIQFQLTVNITAVI-----LTFVSAVASAEETSV--LTAVQLLWVNLIMDTLAALA 971

Query: 862  LGLEKAAPDIMEKPPNDSKA---GIFTWEVIV 890
            L  +K    I+++ P    A    + TW++I+
Sbjct: 972  LATDKPDEFILDRKPKGRDAPLIAVSTWKMIL 1003

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  202 bits (514), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 217/845 (25%), Positives = 373/845 (44%), Gaps = 146/845 (17%)

Query: 136 VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195
           V+RNG+  V++   ++ GD++ ++ GD VP D  LVE    E DE+ +TGE+  + K   
Sbjct: 187 VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEG-KCECDESGITGESDTIKKVSL 245

Query: 196 AVFEQ-------DTP---VGDRLN--------LAFASSTVSKGRATGIVVRTGLRSEIGK 237
           A+  Q       D P   +G   N        +  + S +  G    +V   G  S  GK
Sbjct: 246 AMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGK 305

Query: 238 IAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXX 297
           +  +L+ +       E  + L + + ++  SV +FL   V                    
Sbjct: 306 MMLALKSEPETTPLQERLNTLADDI-SIYGSVAAFLLFVV--------LFLRFLSYLPKG 356

Query: 298 XXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLD 357
                  + +K     ++ I A+ V +  +P  L + +T+ ++     M+    +VR L 
Sbjct: 357 RLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLR 416

Query: 358 SLEALGAVNDICSDKTGTLTQGKMILKQ--LWVPEFGTVVVNRSNVPFDP--------TV 407
           + E +G+   +CSDKTGTLTQ KM++ +  L    F  +  + +    D         T+
Sbjct: 417 ACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSDALRQDMSQHTL 476

Query: 408 GDVSLIPRFSPWEYQHDEEEDVGIIANFKQR-------WQSNSLPKGLNPR-----KFES 455
            D+      +   +++ +  D  I  N   +       W  N+ PK   P+       E 
Sbjct: 477 NDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEF 536

Query: 456 WLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXX 515
           ++ + T A + ++ K S             + ++      D PHH               
Sbjct: 537 FIGSKTEAALLSLAKGS-------------LGLESLQALRDDPHHI-------------- 569

Query: 516 XNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGT 575
                 I       PF+SS ++ + + + L D N R  F KGA E + K C         
Sbjct: 570 -----GIASIVQMIPFESS-RKWAGLVVRLVDGNYR-FFIKGASETIFKSC--------- 613

Query: 576 GVTHPLTEDDLEII----QKN------VDTLSNEGLRVLAFATKTI-------PAEEAES 618
              H +   + ++I    QK+      ++ L+++ LR ++ A K         PAE  ++
Sbjct: 614 ---HYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDA 670

Query: 619 -----------LGERL---TKDRDFV----ESDLIFQGLVGIYDPPRVETAGAVKKCHRA 660
                      LG+       DR  +     S LI  G+VGI+DP R     +VK C ++
Sbjct: 671 SDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQS 730

Query: 661 GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEEL-DQLP 719
           G+ V M+TGD   T +AIA+  GIL  + Y   +       M    F  L+  ++ D  P
Sbjct: 731 GVTVRMITGDNITTGRAIARACGILSESEYADHE-----CAMEGPVFRKLSRRQMMDAAP 785

Query: 720 VLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 779
            L  V+AR +P+ K   +D L +  +  A+TGDG ND+P+L  A+VG +MGI+G+ VA++
Sbjct: 786 KLK-VLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVARE 844

Query: 780 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFXX-XXXXXXXXXXIYLMLGLTFLDEDKLS 838
           ASDI+L  D+F SI+NA++ GR +S +I+KF             +  +  +T  +E+ + 
Sbjct: 845 ASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPV- 903

Query: 839 VFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKA---GIFTWEVIVDMIVY 895
              L+ V++LW+ ++   L A+ L  +K  P I+E+ P    +    + TW++I+   V 
Sbjct: 904 ---LTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVL 960

Query: 896 GLVMA 900
            L++A
Sbjct: 961 QLIIA 965

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score =  174 bits (440), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 129/393 (32%), Positives = 204/393 (51%), Gaps = 41/393 (10%)

Query: 530 PFDSSIKRMSAVYINLRDKNTR---HVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
           PF+SS K    V      KN +     F KGA E V K C+  +    T     + ED+ 
Sbjct: 614 PFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDT--LEEINEDNK 671

Query: 587 EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDF-----------VESDLI 635
           +     +  L+++ LR ++ A K     E +S      +D+D             +  LI
Sbjct: 672 KETDDEIKNLASDALRAISVAHKDFC--ECDSWPPEQLRDKDSPNIAALDLLFNSQKGLI 729

Query: 636 FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKE 695
             GL+GI DP R     +V++C RAG+ V M+TGD   TAKAIA+   IL  ++      
Sbjct: 730 LDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYS 789

Query: 696 VVDIMVMTATQFDSLTDEELDQLPVLP--LVIARCAPQTKVRMIDALHRREKFCAMTGDG 753
                 M  T+F  LT  E  ++ +LP   V+AR +P+ K  +++ L       A+TGDG
Sbjct: 790 A-----MEGTEFRKLTKNE--RIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDG 842

Query: 754 VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXX 813
            ND+P+LK A+VG +MGI+G++VA++ASDI+L  D+F++I+NA++ GR +S +I+KF   
Sbjct: 843 TNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQF 902

Query: 814 XXXXXXXXXIYLMLGLTFL----DEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAP 869
                    I     LTF+      D+ SV  L+ V++LWI ++   L A+ L  +K  P
Sbjct: 903 QLIVNITAVI-----LTFVSSVASSDETSV--LTAVQLLWINLIMDTLAALALATDKPDP 955

Query: 870 DIMEKPP---NDSKAGIFTWEVIVDMIVYGLVM 899
           +IM++ P   + S   + TW++I+      L++
Sbjct: 956 NIMDRKPRGRSTSLISVSTWKMILSQATLQLIV 988

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 123/316 (38%), Gaps = 41/316 (12%)

Query: 94  DWISGGVI---AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQV 150
           DWI G  I    FVV L  +   YQ+      +N  K+       VIRN ++++++   V
Sbjct: 153 DWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKE--NRKIIVIRNDQEILISIHHV 210

Query: 151 VPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDP---------------- 194
           + GD++ ++ GD VPAD  ++     E DE+ +TGE+  + K P                
Sbjct: 211 LVGDVISLQTGDVVPADCVMISG-KCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDS 269

Query: 195 ---------AAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGK 245
                      V E    + D   +  + S +  G   G++   G+ S  G+   SL  +
Sbjct: 270 HNHSKPLDIGDVNEDGNKIAD--CMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAE 327

Query: 246 QSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMA 305
                   + S L + +        S  G      L                        
Sbjct: 328 PESTPLQLHLSQLADNI--------SVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDP 379

Query: 306 TQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAV 365
            QK      + I +I V +  +P  L + +T+ ++     M+    +VR L S E +G+ 
Sbjct: 380 AQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSA 439

Query: 366 NDICSDKTGTLTQGKM 381
             +CSDKTGTLT+  M
Sbjct: 440 TAVCSDKTGTLTENVM 455

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 120/391 (30%), Positives = 198/391 (50%), Gaps = 35/391 (8%)

Query: 529 FPFDSSIKRMSAVYINLRDKNTRH-----VFTKGAFERVLKCCTRWKL-DPGTGVTHPLT 582
            PF+SS ++ SA+ + L            ++ KGA E V K CT   + + G       +
Sbjct: 564 IPFESS-RKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKS 622

Query: 583 EDDLEIIQKNVDTLSNEGLRVLAFATKTI------------PAEEAESLGERLTKDRDFV 630
           +DD+E   + + +L+ + LR ++ A                P    E+L  +L   +   
Sbjct: 623 KDDIE---EQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPH 679

Query: 631 ESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLY 690
              L    +VGI DP R     +V +C +AG+ V M+TGD   TAKAIA+  GIL     
Sbjct: 680 LEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS--- 736

Query: 691 HYPKEVVD-IMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAM 749
              K + D    M    F  L+D E  ++     V+AR +P+ K  ++ AL    +  A+
Sbjct: 737 ---KSLNDSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAV 793

Query: 750 TGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQK 809
           TGDG ND+P+LK A+VG +MGI G++VA++ASDI+L  D+F++I+NA++ GR ++ +I+K
Sbjct: 794 TGDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKK 853

Query: 810 FXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAP 869
           F            + L    + +  D  SV  L+ V++LW+ ++   L A+ L  +K  P
Sbjct: 854 F-IQFQLIVNVTAVLLTFVTSVISSDVKSV--LTAVQLLWVNLIMDTLAALALATDKPDP 910

Query: 870 DIMEKPPNDSKAGIF---TWEVIVDMIVYGL 897
           +IM++ P      +    TW++I+   +  L
Sbjct: 911 NIMDRKPKGRSTPLITPSTWKMIIGQAILQL 941

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 126/310 (40%), Gaps = 31/310 (10%)

Query: 94  DWISGGVIAFVVALNVSIGAYQEYNACKTMNSL-KDLSTPSARVIRNGEDVVMASAQVVP 152
           DWI G  I   V + V + A  +Y        L +        V+R+  + +++   ++ 
Sbjct: 118 DWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLV 177

Query: 153 GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA-VFEQDTPVGDR---- 207
           GD+++++ GD VPAD  LV     ETDE+ LTGE+  + K P A   E  +  G R    
Sbjct: 178 GDLLKLQTGDVVPADCVLVRG-ECETDESALTGESNTIKKLPLADALEYHSAHGGRDIGD 236

Query: 208 ----------------LNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISR 251
                             +  + S V  G A+ IV   G+ S  GK   SL+        
Sbjct: 237 TSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLK-------E 289

Query: 252 DENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIV 311
           D   + LQ  +  +  ++ S  G      L                         +K   
Sbjct: 290 DSEDTPLQMRLSQLTDNI-SVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSK 348

Query: 312 NREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSD 371
             ++ I AI V +  +P  L + +T+ ++     M+    +VR L S E +G+   +CSD
Sbjct: 349 FMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSD 408

Query: 372 KTGTLTQGKM 381
           KTGTLT+  M
Sbjct: 409 KTGTLTENIM 418

>Scas_297.1
          Length = 800

 Score =  125 bits (315), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 137/235 (58%), Gaps = 13/235 (5%)

Query: 669 GDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEE-LDQLPVLPLVIAR 727
           GD   TA+AIA+   IL    Y  P+  ++       +F +LT +E +  LP L  V+AR
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAIE-----GPKFRTLTKQERIKMLPNL-RVMAR 54

Query: 728 CAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSD 787
            +P+ K  +++ L       A+TGDG ND+P+LK A+VG +MGI+G++VA++ASDI+L  
Sbjct: 55  SSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMT 114

Query: 788 DNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEV 847
           D+FA+I++A++ GR +S +I+KF            I   +  +   ED+ SV  L+ V++
Sbjct: 115 DDFAAIVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVS-SIASEDETSV--LTAVQL 171

Query: 848 LWIIVVTSCLPAMGLGLEKAAPDIME-KPPNDSKAGIF--TWEVIVDMIVYGLVM 899
           LWI ++   L A+ L  +K  P+IM+ KP   S   IF  TW++I+      L++
Sbjct: 172 LWINLIMDTLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIV 226

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 70/137 (51%), Gaps = 22/137 (16%)

Query: 136 VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195
           VIRN ++++ +   ++ GDI+ ++ GD +PAD  LVE    E DE+ +TGE+  + K   
Sbjct: 602 VIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVEG-QCEVDESSITGESDTIKK--V 658

Query: 196 AVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIG-KIAESLQGKQSLISRDEN 254
            VF          N       +++G++   ++  G ++  G KI + +     LIS  + 
Sbjct: 659 KVF----------NALKTFDVINEGKSNDQILDIGFKTPNGDKIPDCM-----LISGSKL 703

Query: 255 KSGLQNTVLTVKASVGS 271
            SGL   ++T   SVG+
Sbjct: 704 LSGLGKAIIT---SVGT 717

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 168/357 (47%), Gaps = 58/357 (16%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + +E E + V+ ++       +  V+  + ++A  + DW+  GVI
Sbjct: 90  SDEVLKRRKKYGLNQMADEKESLVVKFVMF--FVGPIQFVMEAAAILAAGLSDWVDFGVI 147

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN  +G  QE+ A   ++ LK     +A VIR+G+ V + + +VVPGDI+Q+  G
Sbjct: 148 CGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDG 207

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
             +P D R+V E   L+ D++ +TGE+L V          D   GD+    F+SSTV +G
Sbjct: 208 TVIPTDGRIVTEDCFLQIDQSAITGESLAV----------DKHYGDQ---TFSSSTVKRG 254

Query: 221 RATGIVVRTGLRSEIGKIAESLQ---GKQSLISRDENKSGLQNTVLTVKASV----GSFL 273
               +V  TG  + +G+ A  +    G Q   +   N  G+   VL +   +      F 
Sbjct: 255 EGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACFY 314

Query: 274 GTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVV 333
            TN    + R                                  Y + + +  +P  L  
Sbjct: 315 RTNGIVRILR----------------------------------YTLGITIIGVPVGLPA 340

Query: 334 VLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
           V+T TM+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 341 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 397

 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 141/318 (44%), Gaps = 41/318 (12%)

Query: 517 NDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTG 576
            DA   Y+     PFD   K+++AV  +   +  R V  KGA   VLK            
Sbjct: 437 KDALTKYKVLEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTVEE-------- 486

Query: 577 VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIF 636
             HP+ ED  E  +  V  L++ G R L  A K       E   E L             
Sbjct: 487 -DHPIPEDVHENYENKVAELASRGFRALGVARK-----RGEGHWEIL------------- 527

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEV 696
            G++   DPPR +TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  
Sbjct: 528 -GVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLG 585

Query: 697 VDIMV-MTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVN 755
           +     M  ++      E  D         A   PQ K R+++ L  R    AMTGDGVN
Sbjct: 586 LGGGGDMPGSELADFV-ENADGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDGVN 637

Query: 756 DSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXX 815
           D+PSLKKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +     
Sbjct: 638 DAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRI 696

Query: 816 XXXXXXXIYLMLGLTFLD 833
                  I+L L +  LD
Sbjct: 697 ALSLHLEIFLGLWIAILD 714

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 102/355 (28%), Positives = 170/355 (47%), Gaps = 54/355 (15%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + EE E + V+ ++       +  V+  + ++A  + DW+  GVI
Sbjct: 119 SDEVARRRKKYGLNQMAEENESLIVKFLMF--FVGPIQFVMEAAAILAAGLSDWVDVGVI 176

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN S+G  QE+ A   ++ LK     +A VIR+G+ + + + +VVPG+I+Q+  G
Sbjct: 177 CALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLESG 236

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
              PAD R+V E   L+ D++ +TGE+L   K            GD +   F+SSTV  G
Sbjct: 237 TIAPADGRIVTEDCFLQIDQSAITGESLAAEKH----------YGDEV---FSSSTVKTG 283

Query: 221 RATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTP 280
            A  +V  TG  + +G+ A +L G+          SG++     V   +G  L   V   
Sbjct: 284 EAFMVVTATGDNTFVGR-AAALVGQ---------ASGVEGHFTEVLNGIGIILLVLVIAT 333

Query: 281 LHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAI-----YAICVALSMIPSSLVVVL 335
           L                      +        R V I     Y + + +  +P  L  V+
Sbjct: 334 L----------------------LLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVV 371

Query: 336 TITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
           T TM+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 372 TTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 426

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 141/318 (44%), Gaps = 41/318 (12%)

Query: 517 NDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTG 576
            DA   Y+     PFD   K+++AV  +   +  R V  KGA   VLK            
Sbjct: 466 KDALTKYKVLEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTVEE-------- 515

Query: 577 VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIF 636
             HP+ ED  E  +  V  L++ G R L  A K       E   E L             
Sbjct: 516 -DHPIPEDVHENYENKVAELASRGFRALGVARK-----RGEGHWEIL------------- 556

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEV 696
            G++   DPPR +TA  + +    G+ + MLTGD  G AK   +++G L  N+Y+  +  
Sbjct: 557 -GVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG-LGTNIYNAERLG 614

Query: 697 VDIMV-MTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVN 755
           +     M  ++      E  D         A   PQ K R+++ L  R    AMTGDGVN
Sbjct: 615 LGGGGDMPGSELADFV-ENADGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDGVN 666

Query: 756 DSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXX 815
           D+PSLKKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +     
Sbjct: 667 DAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRI 725

Query: 816 XXXXXXXIYLMLGLTFLD 833
                  I+L L +  L+
Sbjct: 726 ALSLHLEIFLGLWIAILN 743

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  120 bits (302), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 167/352 (47%), Gaps = 48/352 (13%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + +E E + V+ ++       +  V+  + ++A  + DW+  GVI
Sbjct: 74  SDEVAHRRKKYGLNQMADERESMIVKFVMF--FVGPIQFVMEAAAILAAGLSDWVDFGVI 131

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN  +G  QE+ A   ++ LK      A VIR+G+ V + + +VVPGDI+Q+  G
Sbjct: 132 CGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANEVVPGDILQLEDG 191

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
             +PAD RLV E   L+ D++ +TGE+L V          D   GD+    F+SSTV +G
Sbjct: 192 TIIPADGRLVTENCFLQVDQSAITGESLAV----------DKGYGDQ---TFSSSTVKRG 238

Query: 221 RATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTP 280
            A  +V  TG  + +G+ A       +L+++     G    VL     +           
Sbjct: 239 EAFMVVTATGDNTFVGRAA-------ALVNKASGGQGHFTEVLNGIGIL----------- 280

Query: 281 LHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMI--PSSLVVVLTIT 338
                                   A   +  +  V I    + +++I  P  L  V+T T
Sbjct: 281 -----------LLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTT 329

Query: 339 MSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
           M+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 330 MAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 381

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/319 (29%), Positives = 142/319 (44%), Gaps = 41/319 (12%)

Query: 517 NDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTG 576
            DA   Y+     PFD   K+++AV  +   +  R V  KGA   VLK            
Sbjct: 421 KDALTKYKVIEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTVEE-------- 470

Query: 577 VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIF 636
             HP+ ED  E  +  V  L++ G R L  A K       E   E L             
Sbjct: 471 -DHPIPEDVHENYENKVAELASRGFRALGVARK-----RGEGHWEIL------------- 511

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEV 696
            G++   DPPR +TA  V +  R G+ V MLTGD  G AK   +++G L  N+Y+  +  
Sbjct: 512 -GVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLG 569

Query: 697 VDIMV-MTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVN 755
           +     M  ++      E  D         A   PQ K ++++ L  R    AMTGDGVN
Sbjct: 570 LGGGGDMPGSELADFV-ENADGF-------AEVFPQHKYKVVEILQNRGYLVAMTGDGVN 621

Query: 756 DSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXX 815
           D+PSLKKA+ GIA+    SD A+ A+DIV      ++I++A++  R++   +  +     
Sbjct: 622 DAPSLKKADTGIAVE-GASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRI 680

Query: 816 XXXXXXXIYLMLGLTFLDE 834
                  ++L L +  L+ 
Sbjct: 681 ALSLHLELFLGLWIIILNH 699

>Scas_688.1
          Length = 913

 Score =  119 bits (299), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 101/350 (28%), Positives = 164/350 (46%), Gaps = 44/350 (12%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + EE E + V+ I+       +  V+  + ++A  + DW+  GVI
Sbjct: 85  SDEVARRRKKYGLNQMSEENESLVVKFIMF--FVGPIQFVMEAAAILAAGLSDWVDFGVI 142

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN  +G  QE+ A   +  LK     SA VIR+G+ V + + +VVPGDI+Q+  G
Sbjct: 143 CGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEVVPGDILQLEDG 202

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
             +PAD R+V E   ++ D++ +TGE+L            D   GD+    F+SSTV +G
Sbjct: 203 VIIPADGRIVTEDCFVQIDQSAITGESLAA----------DKHYGDQ---TFSSSTVKRG 249

Query: 221 RATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTP 280
            A  ++  TG  + +G+ A                       L  KAS G    T V   
Sbjct: 250 EAFMVITATGDNTFVGRAA----------------------ALVNKASGGQGHFTEV--- 284

Query: 281 LHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMS 340
           L+                           IV   +  Y + + +  +P  L  V+T TM+
Sbjct: 285 LNGIGIILLVLVIVTLLLVWTASFYRTDGIVR--ILRYTLGITIVGVPVGLPAVVTTTMA 342

Query: 341 AGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
            GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 343 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 392

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 136/304 (44%), Gaps = 39/304 (12%)

Query: 530 PFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           PFD   K+++AV  +   +  R +  KGA   VLK              HP+ ED  E  
Sbjct: 445 PFDPVSKKVTAVVES--PEGERIICVKGAPLFVLKTVEE---------DHPIPEDIHENY 493

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVE 649
           +  V  L++ G R L  A K       E   E L              G++   DPPR +
Sbjct: 494 ENKVAELASRGFRALGVARK-----RGEGHWEIL--------------GVMPCMDPPRDD 534

Query: 650 TAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDS 709
           T   V +  R G+ V MLTGD  G AK   +++G L  N+Y+  +       +  +    
Sbjct: 535 TGETVAEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNVYNAER-------LGLSGGGD 586

Query: 710 LTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAM 769
           +   EL          A   PQ K R+++ L  R    AMTGDGVND+PSLKKA+ GIA+
Sbjct: 587 MPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAV 646

Query: 770 GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLGL 829
               +D A+ A+DIV      ++I++A++  R++   +  +            I+L L +
Sbjct: 647 E-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHLEIFLGLWI 705

Query: 830 TFLD 833
             L+
Sbjct: 706 AILN 709

>Kwal_47.17522
          Length = 899

 Score =  119 bits (297), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 168/352 (47%), Gaps = 48/352 (13%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + EE E + V+ ++       +  V+  + ++A  ++DW+  GVI
Sbjct: 71  SDEVTKRRKKYGLNQMAEESESLVVKFLMF--FIGPIQFVMEAAAILAAGLEDWVDFGVI 128

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN  +G  QEY A   ++ LK     SA V+R+G  V + + +VVPGDI+Q+  G
Sbjct: 129 LGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEVVPGDIMQLEDG 188

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
             + AD RLV E   L+ D++ +TGE+L V          D   GD     F+SSTV +G
Sbjct: 189 VVICADGRLVTEECFLQIDQSAITGESLAV----------DKHYGDT---TFSSSTVKRG 235

Query: 221 RATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTP 280
               IV  TG  + +G+ A       +L+++     G    VL             +GT 
Sbjct: 236 EGFMIVTATGDNTFVGRAA-------ALVNQAAGDQGHFTEVL-----------NGIGTI 277

Query: 281 LHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAI--YAICVALSMIPSSLVVVLTIT 338
           L                           +  +R V I  Y + + +  +P  L  V+T T
Sbjct: 278 LLVLVIVTLLLVWTACF-----------YRTDRIVRILRYTLGITIIGVPVGLPAVVTTT 326

Query: 339 MSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
           M+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 327 MAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 378

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 139/306 (45%), Gaps = 41/306 (13%)

Query: 530 PFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           PFD   K+++AV  +   +  R +  KGA   VLK              HP+ ED  E  
Sbjct: 431 PFDPVSKKVTAVVES--PEGERIICVKGAPLFVLKTVEE---------DHPIPEDVHENY 479

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVE 649
           +  V  L++ G R L  A K       E   E L              G++   DPPR +
Sbjct: 480 ENKVAELASRGFRALGVARK-----RGEGHWEIL--------------GVMPCMDPPRDD 520

Query: 650 TAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV-MTATQFD 708
           TA  V +  R G+ V MLTGD  G AK   +++G L  N+Y+  +  +     M  ++  
Sbjct: 521 TAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGGDMPGSELA 579

Query: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
               E  D         A   PQ K  +++ L +R    AMTGDGVND+PSLKKA+ GIA
Sbjct: 580 DFV-ENADGF-------AEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIA 631

Query: 769 MGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLG 828
           +    +D A+ A+DIV      ++I++A++  R++   +  +            I+L L 
Sbjct: 632 VE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLW 690

Query: 829 LTFLDE 834
           +  L++
Sbjct: 691 IAILNQ 696

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 148/312 (47%), Gaps = 41/312 (13%)

Query: 80  LVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRN 139
            V+  + ++A  +++WI  G+I  ++ LN ++G  QE+ A   +  LK     SA VIR+
Sbjct: 107 FVMEAAAILAAGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRD 166

Query: 140 GEDVVMASAQVVPGDIVQVRVGDTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVF 198
           G  V + + +VVPGDI+Q+  G  +PAD R+V E   ++ D++ +TGE+L V        
Sbjct: 167 GSLVEIPANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAV-------- 218

Query: 199 EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGL 258
             D   GD     F+SSTV +G    IV  TG  + +G+ A                   
Sbjct: 219 --DKRYGDA---TFSSSTVKRGEGFMIVTATGDSTFVGRAA------------------- 254

Query: 259 QNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIY 318
               L  KAS GS   T V   L+                           IV   +  Y
Sbjct: 255 ---ALVNKASAGSGHFTEV---LNGIGTILLILVILTLLVVYVACFYRSIDIVT--ILRY 306

Query: 319 AICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQ 378
            + + +  +P  L  V+T TM+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT+
Sbjct: 307 TLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTK 366

Query: 379 GKMILKQLWVPE 390
            K+ L + +  E
Sbjct: 367 NKLSLHEPYTVE 378

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 137/306 (44%), Gaps = 41/306 (13%)

Query: 530 PFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           PFD   K+++A+  +   +  R V  KGA   VLK              H + ED  E  
Sbjct: 431 PFDPVSKKVTAIVES--PEGERIVCVKGAPLFVLKTVEE---------NHLIPEDVKENY 479

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVE 649
           +  V  L++ G R L  A K       E   E L              G++   DPPR +
Sbjct: 480 ENKVAELASRGYRALGVARK-----RGEGHWEIL--------------GVMPCMDPPRDD 520

Query: 650 TAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV-MTATQFD 708
           TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  +     M  ++  
Sbjct: 521 TAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGGDMPGSELA 579

Query: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
               E  D         A   PQ K  +++ L +R    AMTGDGVND+PSLKKA+ GIA
Sbjct: 580 DFV-ENADGF-------AEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIA 631

Query: 769 MGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLG 828
           +    +D A+ A+DIV      ++I++A++  R++   +  +            I+L L 
Sbjct: 632 VE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLW 690

Query: 829 LTFLDE 834
           +  L++
Sbjct: 691 IAILNQ 696

>Scas_710.41
          Length = 904

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 162/348 (46%), Gaps = 42/348 (12%)

Query: 44  EEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAF 103
           +E   R +  G N + +EE  N     L      +  V+  + ++A  + DW+  GVI  
Sbjct: 78  DEVVRRRKKYGLNQM-KEENENFIVKFLMYFVGPIQFVMEAAAILAAGLSDWVDFGVICG 136

Query: 104 VVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDT 163
           ++ LN S+G  QE+ A   +  LK     +ARVIR+G    + + ++VPGDI+++  G  
Sbjct: 137 LLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANEIVPGDILELDEGTI 196

Query: 164 VPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRA 222
           +PAD RLV E   L+ D++ +TGE+L V K+           GD   + F+SSTV  G +
Sbjct: 197 IPADGRLVTENRFLQVDQSAITGESLAVDKN----------YGD---VTFSSSTVKTGTS 243

Query: 223 TGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLH 282
             +V  TG  + +G+ A       +L+       G    +L            ++GT L 
Sbjct: 244 VMVVTATGDNTFVGRAA-------ALVGEASGGQGHFTDIL-----------NDIGTILL 285

Query: 283 RXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAG 342
                                +   +F +   + I  + V L         V+T TM+ G
Sbjct: 286 VLVIITLLLVWTACFYRTDGIVMILRFTLG--ITIIGVPVGLP-------AVVTTTMAVG 336

Query: 343 AKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPE 390
           A  ++ +  IV++L ++E+L  V  +CSDKTGTLT+ K+ L + +  E
Sbjct: 337 AAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE 384

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 135/305 (44%), Gaps = 41/305 (13%)

Query: 530 PFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           PFD   K+++AV  +   +    V  KGA   VLK              HP+ ED  E  
Sbjct: 437 PFDPVSKKVTAVVKSPEGETITCV--KGAPLFVLKTVEE---------DHPVPEDVHENY 485

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVE 649
           +  V  L++ G R L  A K       E   E L              G++   DPPR +
Sbjct: 486 ENKVAELASRGFRSLGVARK-----RGEGYWEIL--------------GVMPCMDPPRDD 526

Query: 650 TAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV-MTATQFD 708
           TA  + +    G+ V MLTGD  G AK  ++++G L  N+Y+  K  +     M  ++  
Sbjct: 527 TARTIAEARTLGLRVKMLTGDAVGIAKETSRQLG-LGVNIYNAEKLGLGGGGDMPGSELA 585

Query: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
               E  D         A   PQ K ++++ L  R    AMTGDGVND+PSLKKA+ GIA
Sbjct: 586 DFV-ENADGF-------AEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIA 637

Query: 769 MGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLG 828
           +    +D A+ A+DIV      ++I++ ++  R++   +  +            I+  L 
Sbjct: 638 VE-GATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLW 696

Query: 829 LTFLD 833
           +  L+
Sbjct: 697 IAILN 701

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 137/305 (44%), Gaps = 41/305 (13%)

Query: 530 PFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           PFD   K+++A+  +   +  R +  KGA   VLK              HP+ ED  E  
Sbjct: 431 PFDPVSKKVTAIVES--PEGERIICVKGAPLFVLKTVEE---------EHPIPEDVRENY 479

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVE 649
           +  V  L++ G R L  A K       E   E L              G++   DPPR +
Sbjct: 480 ENKVAELASRGFRALGVARK-----RGEGHWEIL--------------GVMPCMDPPRDD 520

Query: 650 TAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV-MTATQFD 708
           TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  +     M  ++  
Sbjct: 521 TAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGGDMPGSELA 579

Query: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
               E  D         A   PQ K  +++ L +R    AMTGDGVND+PSLKKA+ GIA
Sbjct: 580 DFV-ENADGF-------AEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIA 631

Query: 769 MGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXXXXXXXXXXIYLMLG 828
           +    +D A+ A+DIV      ++I++A++  R++   +  +            I+L L 
Sbjct: 632 VE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLW 690

Query: 829 LTFLD 833
           +  L+
Sbjct: 691 IAILN 695

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 107/197 (54%), Gaps = 17/197 (8%)

Query: 43  AEEARARLEVVGDNTLGEE-EGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVI 101
           ++E   R +  G N + EE E + V+ ++       +  V+  + ++A  ++DW+  GVI
Sbjct: 71  SDEVTKRRKKYGLNQMSEETENLFVKFLMF--FIGPIQFVMEAAAILAAGLEDWVDFGVI 128

Query: 102 AFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVG 161
             ++ LN ++G  QEY A   ++ LK     SA VIR+G  V + S +VVPGDI+Q+  G
Sbjct: 129 CGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEVVPGDILQLEDG 188

Query: 162 DTVPADLRLV-EALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG 220
             +PAD RLV E   ++ D++ +TGE+L V          D   GD     F+SSTV +G
Sbjct: 189 VVIPADGRLVTEDCFIQIDQSAITGESLAV----------DKRFGDS---TFSSSTVKRG 235

Query: 221 RATGIVVRTGLRSEIGK 237
            A  IV  TG  + +G+
Sbjct: 236 EAFMIVTATGDSTFVGR 252

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%)

Query: 318 YAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLT 377
           Y + + +  +P  L  V+T TM+ GA  ++ +  IV++L ++E+L  V  +CSDKTGTLT
Sbjct: 306 YTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 365

Query: 378 QGKMILKQLWVPE 390
           + K+ L + +  E
Sbjct: 366 KNKLSLHEPYTVE 378

>Scas_665.30
          Length = 1439

 Score = 99.8 bits (247), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 170/820 (20%), Positives = 319/820 (38%), Gaps = 162/820 (19%)

Query: 66   VRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNS 125
            V  +L  ++ +   +  I S+++    + +   G I  +  L++     +     +T  S
Sbjct: 262  VAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVE---TRRTQKS 318

Query: 126  LKDLS--TPSARVIRNGEDVVMASAQVVPGDIVQVRVGD--TVPADLRLVEALNLETDEA 181
            L D+S      RV R+     + SA +VPGDI ++        P D  L+   +   +E+
Sbjct: 319  LADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSG-DCIVNES 377

Query: 182  LLTGEALPVAKDPA---AVFE-----QDTPVGDRLN--LAFASSTVSKGR-------ATG 224
            +LTGE++PV+K PA    + +     Q+T +   L+    F  +T+ + R       A  
Sbjct: 378  MLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALA 437

Query: 225  IVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRX 284
            +VVRTG  +  G +  S+   +    +    S     V+ + A  G              
Sbjct: 438  MVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFG-------------- 483

Query: 285  XXXXXXXXXXXXXXXXXXXMATQKFIV----NREVAIYAICVALSMIPSSLVVVLTITMS 340
                               ++  +FI      R + + A+ +   ++P +L   LTI   
Sbjct: 484  -----------------FSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTG 526

Query: 341  AGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKM--ILKQLWVPEFGTVVVNR 398
                 +  + +       +   G ++ +C DKTGTLT+  +  +  QL VP       + 
Sbjct: 527  FALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPS------SH 580

Query: 399  SNVPFDPTVGDV-SLIPRFS------PWEYQHDEEEDVGIIANFKQRWQSNSL---PKGL 448
            ++  F   V DV  L P+FS      P +Y+  +   + ++     R   N L   P   
Sbjct: 581  NSFQFADLVQDVHKLFPKFSLNDCSSPRDYRA-KNFFISLLTCHSLRVVDNELIGDPLDF 639

Query: 449  NPRKFESWLHTATLANIATVFKDSD---SKEWRAHGDPTEIAIQVFATRMDHPHHALTTX 505
               +F  W +          F++ +   + E R H +     I +    + HP+ A    
Sbjct: 640  KMFQFTKWSYEED-------FQEKEFHSTYEERRHDNALPENIDIIPAVV-HPNSA---- 687

Query: 506  XXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKC 565
                       ND          F F S ++RMS + +   +++    FTKGA E + + 
Sbjct: 688  ---DPENTFIDNDPHNFLGIIRSFEFLSELRRMSVI-VKPSNEDVYWAFTKGAPEVITQI 743

Query: 566  CTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTK 625
            C +  L                  ++ ++  +++G RV+A A + +P        +++++
Sbjct: 744  CNKATLPAN--------------FEEMLNYYTHKGYRVIACAGRVLP-RNTWLYSQKVSR 788

Query: 626  DRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL 685
            +   VES++ F G +   +  + ETA  ++    A I   M TGD   TA ++ ++  ++
Sbjct: 789  EE--VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI 846

Query: 686  PHNLYHYPK-EVVDIMVMTATQFDSL--TDEELDQLPVLPL------------------- 723
                 + P  E +D    T+  +  +   D+ LD   +LP+                   
Sbjct: 847  KSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRI 906

Query: 724  ----------------------VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 761
                                  + AR +P  K  +++ L R        GDG ND  +LK
Sbjct: 907  IFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALK 966

Query: 762  KANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801
             A+VGI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 967  AADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR 1003

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 159/808 (19%), Positives = 318/808 (39%), Gaps = 146/808 (18%)

Query: 69   ILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKD 128
            IL  ++ +   +  ++S+++    + +   G I  +  L++     +     +T+  +  
Sbjct: 477  ILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSH 536

Query: 129  LSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDT--VPADLRLVEALNLETDEALLTGE 186
             +    RV+R G    + S+++VPGDI ++   +   +P D  L+   +   +E++LTGE
Sbjct: 537  FNC-EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSG-DCIVNESMLTGE 594

Query: 187  ALPVAKDPAA------VFE--QDTPVGDRLN--LAFASSTVSKGR-------ATGIVVRT 229
            ++PV+K PA+      +F+  Q T +   L+    F  +T+ + +       A  + VRT
Sbjct: 595  SVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRT 654

Query: 230  GLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVK----ASVGSFLGTNVGTPLHRXX 285
            G  +  G +  S+   +         SG +    + K     ++ +F G ++        
Sbjct: 655  GFSTTKGSLIRSMVFPK--------PSGFKFYSDSFKYIGFMAIIAFFGFSISC------ 700

Query: 286  XXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKV 345
                              +   K    R + + A+ +   ++P +L   LTI  S     
Sbjct: 701  -------------INFIKLGLDK----RTMILRALDIITIVVPPALPATLTIGTSFALNR 743

Query: 346  MSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDP 405
            +  + +       +   G ++ +C DKTGTLT+  + +  + V    +    R+   F  
Sbjct: 744  LKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRV----SCAATRNKASFSD 799

Query: 406  TVGDV-SLIPRFS------PWEYQHDEEEDVGIIANFKQRWQSNSL---PKGLNPRKFES 455
             + D   + P+FS      P +Y+      + ++     R     L   P      +F  
Sbjct: 800  LISDTHDIFPKFSLKDCSNPDDYKR-RNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTG 858

Query: 456  WLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXX 515
            W +     N        +  E +   +  +I   +      HP+ +              
Sbjct: 859  WSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIV-----HPNDS-------DERNKFV 906

Query: 516  XNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGT 575
             ND   I      F F S ++RMS + +   ++N    +TKGA E ++  C     +P T
Sbjct: 907  QNDPNNILGIIRSFEFLSELRRMSVI-VKPNNENVYWAYTKGAPEVIIDIC-----NPAT 960

Query: 576  GVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLI 635
                P   DD+      ++  ++ G RV+A A KT+P +      +++ ++   VES++ 
Sbjct: 961  ---LPSDYDDI------LNFYTHSGYRVIACAGKTLP-KNTWLYSQKVRREE--VESNME 1008

Query: 636  FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK- 694
            F G +   +  +  T+  + K   A I   M TGD   TA ++ +E  ++  +  + P  
Sbjct: 1009 FLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTV 1068

Query: 695  EVVDIMVMTATQFDSLTDEE--LDQLPVLPL----------------------------- 723
               D+ V     ++ +++ E  LD   + P+                             
Sbjct: 1069 AYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEE 1128

Query: 724  ----------VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGING 773
                      + AR +P  K  +++ L + +      GDG ND  +LK A+VGI++    
Sbjct: 1129 YVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAE 1188

Query: 774  SDVAKDASDIVLSDDNFASILNAVEEGR 801
            + VA   +  +    +   +L+ ++EGR
Sbjct: 1189 ASVAAPFTSKIF---DITCVLDVIKEGR 1213

>Kwal_26.9207
          Length = 1469

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 175/832 (21%), Positives = 326/832 (39%), Gaps = 156/832 (18%)

Query: 49   RLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALN 108
            R+   G N +  ++  ++  IL  ++ +   +  I S+++ LA   +     I F++++ 
Sbjct: 476  RMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNYYYYAACI-FIISML 533

Query: 109  VSIGAYQEYNACKTMNSLKDLSTPSA--RVIRNGEDVVMASAQVVPGDIVQVR--VGDTV 164
              I    E    KT   L ++S      RV R+G  V ++S+++VPGD+ ++      T 
Sbjct: 534  SIIDTLVETK--KTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTF 591

Query: 165  PADLRLVEALNLETDEALLTGEALPVAKDPAA---VFE-----QDTPVGDRL--NLAFAS 214
            P D  L+   +   +E++LTGE++PV+K PA+   +++     Q T + + L  +  F  
Sbjct: 592  PCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNG 650

Query: 215  STVSKGRATG-------IVVRTGLRSEIGKIAES-LQGKQSLISRDENKS---GLQNTVL 263
            + + + R  G       +VVRTG  +  G +  S +  K S     E+     G    + 
Sbjct: 651  TKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIA 710

Query: 264  TVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVA 323
                S+       +G                             K ++ R + I  I V 
Sbjct: 711  LAGFSISCINFIRLGL--------------------------AYKVMILRALDIITIVV- 743

Query: 324  LSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMIL 383
                P +L   L+I  S     +  + +       +   G ++ +C DKTGTLT+  + +
Sbjct: 744  ----PPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDV 799

Query: 384  KQLWVPE--------FGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANF 435
              + V E        FG ++ N   +    ++ D       SP +++      V ++   
Sbjct: 800  LGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCG-----SPIDFK-SRNFLVSLLTCH 853

Query: 436  KQRWQSNSL---PKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGD--PTEIAIQV 490
              R     L   P      +F +W +     +    FK     E R +    P    I  
Sbjct: 854  SLRVVDGELLGDPLDFKMFQFTNWSYAEDFQD----FKFHSLNEERNNKSTLPENAGI-- 907

Query: 491  FATRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNT 550
             A  + HP+   T             ND   +      F F S ++RMS + +    +N 
Sbjct: 908  -APAVVHPNAEST-------ENKFTENDPHNLLGVIRSFEFVSELRRMSVI-VKPYGENV 958

Query: 551  RHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKT 610
               FTKGA E + + C +  L        P   +  +I+Q+     ++ G RV+A A KT
Sbjct: 959  FWGFTKGAPEVISEICNKSTL--------PANYE--QILQQ----YTHNGYRVIACAGKT 1004

Query: 611  IPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGD 670
            +P +      ++++++   VES++ F G V   +  +  T   +     AGI   M TGD
Sbjct: 1005 LP-KRTWRFAQKVSREE--VESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGD 1061

Query: 671  FPGTAKAIAQEVGILPHNLYHYPK---------EVV------------------------ 697
               TA ++ +E G++  +    P+         +++                        
Sbjct: 1062 NVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSS 1121

Query: 698  --------DIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAM 749
                    D+  +     + L +  ++ + +   + AR +P  K  ++  L   +     
Sbjct: 1122 DYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGF 1181

Query: 750  TGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801
             GDG ND  +LK A+VG+++    + VA   +  V      + IL+ ++EGR
Sbjct: 1182 CGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCILDVIKEGR 1230

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 174/883 (19%), Positives = 330/883 (37%), Gaps = 163/883 (18%)

Query: 64   INVR-----AILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYN 118
            IN+R      IL  ++ +   +  + S+++    + +     I  +  L++     ++  
Sbjct: 479  INLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKK 538

Query: 119  ACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDT--VPADLRLVEALNL 176
              + +  +        RV+R+     ++S+++VPGDI +V   +   +P D  L+ + + 
Sbjct: 539  VSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSS-DC 596

Query: 177  ETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKG---------------- 220
              +E++LTGE++PV+K PA   E    + D       SS VSK                 
Sbjct: 597  IVNESMLTGESVPVSKFPATE-ETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPG 655

Query: 221  --RATGIVVRTGLRSEIGKIAESLQGKQSL---ISRDENKS-GLQNTVLTVKASVGSFLG 274
               A  +VVRTG  +  G +  S+   +       RD  K  G  + +      V     
Sbjct: 656  QTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQF 715

Query: 275  TNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVV 334
              +G                            +K ++ R + I  I V     P +L   
Sbjct: 716  IKLG--------------------------LDKKTMILRALDIITIVV-----PPALPAT 744

Query: 335  LTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTV 394
            LTI  +     +  + +       L   G ++ +C DKTGTLT+  + +  + + E   V
Sbjct: 745  LTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGV 804

Query: 395  VVNRSNVPFDPTVGDV-SLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKF 453
               +    F   + D+  + P+FS          D     +FK R    SL    + R  
Sbjct: 805  RGQK----FGELLSDIRQVFPKFS--------LNDCSSPLDFKSRNFFMSLLTCHSLRSV 852

Query: 454  ESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQ-VFATRMD---HPHH-----ALTT 504
            +  L    L      FK      W    D  + A   ++  R +    P +     A+  
Sbjct: 853  DGNLLGDPLD-----FKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVH 907

Query: 505  XXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLK 564
                        ND          F F S ++RMS + +   + +    FTKGA E + +
Sbjct: 908  PDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVI-VKTNNDDVYWSFTKGAPEVISE 966

Query: 565  CCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLT 624
             C +            L  D  E+++      ++ G RV+A A KT+P +      ++++
Sbjct: 967  ICNK----------STLPADFEEVLR----CYTHNGYRVIACAGKTLP-KRTWLYSQKVS 1011

Query: 625  KDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGI 684
            ++   VES+L F G +   +  + ET+  +K    A I   M TGD   TA ++ +E G+
Sbjct: 1012 REE--VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069

Query: 685  LPHNLYHYPK---------------------EVVDIMVMTATQF---------------- 707
            +  +  + P                      +++D   +   +                 
Sbjct: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129

Query: 708  -------------DSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGV 754
                         + + +E L+++ +   + AR +P  K  ++  L + +      GDG 
Sbjct: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189

Query: 755  NDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFXXXX 814
            ND  +LK A+VGI++    + VA   +  +    N + +L+ + EGR  +  +  F    
Sbjct: 1190 NDCGALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGR--AALVTSFACFQ 1244

Query: 815  XXXXXXXXIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCL 857
                     ++ + + +     L  F    +++L I+ +  C+
Sbjct: 1245 YMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICM 1287

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 178/837 (21%), Positives = 313/837 (37%), Gaps = 177/837 (21%)

Query: 49   RLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALN 108
            R    G N++  ++   V  IL  +  +   +  I S+++ LA   +   G I  +  L+
Sbjct: 457  RTLAFGKNSVNLKQK-TVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLS 515

Query: 109  VSIGAYQEYNACKTMNSLKDLS--TPSARVIRNGEDVVMASAQVVPGDIVQVRVGDTV-- 164
            + I    E    K    L D+S      RV ++     + S+ +VPGD+ ++     V  
Sbjct: 516  I-IDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVL 572

Query: 165  PADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVS------ 218
            P D  L+   +   +E++LTGE++PV+K  A        + D     F SS VS      
Sbjct: 573  PCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQD-----FKSSQVSSFVSKS 626

Query: 219  ----------------KGRATGIVVRTGLRSEIGKIAESLQGKQSL---ISRDENKS-GL 258
                            +G A  +V+RTG  +  G +  S+   + +      D  K  G 
Sbjct: 627  FLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGF 686

Query: 259  QNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIY 318
               +     S+       +G                             K ++ R + I 
Sbjct: 687  MTLIAMFGFSISCIQFIRLGLEY--------------------------KVMILRALDII 720

Query: 319  AICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLT- 377
             I V     P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT 
Sbjct: 721  TIVV-----PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTE 775

Query: 378  QGKMILK-QLWVPEFGTVVVNRSNVPFD-------PTVGDVSLIPRFSPWEYQHDEEEDV 429
            +G  +L      PE  + ++  S++  D        T+ D +    F    +       V
Sbjct: 776  EGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFL------V 829

Query: 430  GIIANFKQRWQSNSL---PKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEI 486
             ++     +     L   P  L   +F  W +           +  +S +++   D T I
Sbjct: 830  SLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYE----------EGYESWKFKNAEDKTGI 879

Query: 487  AIQVFATRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLR 546
            +  V      HP                  ND   +      F F S ++RMS +    +
Sbjct: 880  SPAVV-----HP----------TSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFK 924

Query: 547  DKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAF 606
            + NT   FTKGA E +   C     +P T     + +D  E++       ++ G R++A 
Sbjct: 925  E-NTYWSFTKGAPEVIADIC-----NPAT-----IPKDFHELLHH----YTHNGFRIIAC 969

Query: 607  ATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHM 666
            A KT+P + +    ++++++   VE +L F G +   +  +  T  A+K+   A I   M
Sbjct: 970  AGKTLP-KSSWLYSQKVSREE--VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVM 1026

Query: 667  LTGDFPGTAKAIAQEVGILPHNLYHYP------KEVVDIM----------VMTATQFDSL 710
             TGD   TA ++ ++ G++       P      +E   ++          V+ A     L
Sbjct: 1027 CTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPL 1086

Query: 711  TDEE---------------LDQLPVLP-----------LVIARCAPQTKVRMIDALHRRE 744
             D E                    +LP            + AR +P  K  +++ L + +
Sbjct: 1087 NDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLD 1146

Query: 745  KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801
                  GDG ND  +LK AN+GI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 1147 YNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGR 1200

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 125/512 (24%), Positives = 197/512 (38%), Gaps = 117/512 (22%)

Query: 325 SMIPSSLVVVLTITMSAGA-KVMSTRNV---IVRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A K+   + +   IVR     E LG +  + SDKTGTLTQ  
Sbjct: 456 TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 515

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440
           M LK++     GTV                                E + I+ +F Q   
Sbjct: 516 MQLKKI---HLGTVSYTN----------------------------ETMDIVTDFIQSMN 544

Query: 441 S---NSLP----KGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFAT 493
           S   NS P    K ++ R  +     A   N+   F+D +     A   P EIAI  F  
Sbjct: 545 SRTSNSTPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAA--SPDEIAIVKFTE 602

Query: 494 RMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAE--FPFDSSIKRMSAVYINLRDKNTR 551
            +      L+             + +    E+  +  FPF+S  KRM  +          
Sbjct: 603 SV-----GLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVI---------- 647

Query: 552 HVFTKGAFERVLKCCTRWKLDPG--TGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATK 609
            +F K   E        W L  G  T ++  +  +D   +++    ++ EGLR L    K
Sbjct: 648 -IFDKLKQEY-------WFLQKGADTVMSSIVVRNDW--LEEETSNMATEGLRTLVIGRK 697

Query: 610 TIPAEEAESLGERLTKD---------------RDFVESDLIFQGLVGIYDPPRVETAGAV 654
            +     E   +  ++                R F+E+DL   GL G+ D  + +   ++
Sbjct: 698 KLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSI 757

Query: 655 KKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD--------IMVMTATQ 706
           +    AGI + MLTGD   TA+ ++    ++    Y +    V+        +  +   Q
Sbjct: 758 ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQ 817

Query: 707 FDSLT--------------DEELDQLPVLPLVIA-RCAPQTKVRMIDALHRR--EKFCAM 749
              L               DE  D +  LP V+A RC PQ K  +   + +   ++ C +
Sbjct: 818 NSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI 877

Query: 750 TGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 781
            GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 878 -GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 905

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 167/728 (22%), Positives = 271/728 (37%), Gaps = 171/728 (23%)

Query: 144 VMASAQVVP------GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD---- 193
           V+  AQ+VP      GD++++  G  +PADL L+++ +  + E+ +  + L    D    
Sbjct: 254 VLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQS-SEPSGESFIKTDQLDGETDWKLR 312

Query: 194 PAAVFEQDTPVGDRLN-LAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRD 252
            A    Q+    D LN ++  +S+  K                        GK +     
Sbjct: 313 VACSLTQNLSTDDLLNKISITASSPEKS------------------IHRFLGKLTYKDSS 354

Query: 253 ENKSGLQNTVL--TVKASVGS------FLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXM 304
            N   + NT+   TV ASVGS      + GT+    ++                     +
Sbjct: 355 SNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKIL 414

Query: 305 ATQKFIVNREVAIYA--------------ICVALSMIPSSLVVVLTITMSAGAKVM---- 346
               F+++  +  +A              + +  ++IP SL V L +  S  A+ +    
Sbjct: 415 CACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDA 474

Query: 347 STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPT 406
           +  + IVR     E LG +  + SDKTGTLTQ  M LK+L     GTV            
Sbjct: 475 TIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTV------------ 519

Query: 407 VGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNS----LP-----KGLNPRKFESWL 457
                         Y  D    + I+ ++ Q   S+S    +P     K L  R  +  +
Sbjct: 520 -------------SYTMDT---MDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVV 563

Query: 458 HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXXXXXXXXXXN 517
             A   N+   F+D +     A   P EIAI  F   +      L+              
Sbjct: 564 TLAICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESV-----GLSLFKRDRHSVSLFHQ 616

Query: 518 DAARIYEH--AAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGT 575
            +A  +E+     FPF+S  KRM  +   + DK       KG           W +  G 
Sbjct: 617 HSATNFEYDILQVFPFNSDTKRMGII---VYDK------VKGE---------HWFMQKGA 658

Query: 576 GVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------LTKD- 626
                      + + + V  ++ EGLR L    K +  +  E   +         L +D 
Sbjct: 659 DTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDE 718

Query: 627 ------RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQ 680
                 +  +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ ++ 
Sbjct: 719 TMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSI 778

Query: 681 EVGILPHNLYHY-------PKEVVDIMVMTATQFDS--LTDEE-------------LDQL 718
              ++    Y +       P+  ++ +        S  L D E              D +
Sbjct: 779 SAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIV 838

Query: 719 PVLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGING 773
             LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G
Sbjct: 839 VDLPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVG 893

Query: 774 SDVAKDAS 781
            +  K AS
Sbjct: 894 KE-GKQAS 900

>Scas_583.14*
          Length = 875

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 133/306 (43%), Gaps = 70/306 (22%)

Query: 529 FPFDSSIKRMSAVYINLRDKNTRHVFT--KGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
           F F S++KR S+V  + +DK    +FT  KGA E +                     + L
Sbjct: 234 FQFSSALKRSSSVASH-KDK----LFTAVKGAPETI--------------------RERL 268

Query: 587 EIIQKNVD----TLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGI 642
            ++ KN D    + +  G RVLA A+K++P   ++ L +    DRD +E+ L F G +  
Sbjct: 269 AVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDL---DRDEIETGLTFNGFLVF 325

Query: 643 YDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN-------------- 688
           + P + +    +K  + +     M+TGD P TA  +A+EV I+                 
Sbjct: 326 HCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGK 385

Query: 689 -LYHYPKEVVDI-------------------MVMTATQFDSLTDE-ELDQLPVLPLVIAR 727
            L+   +E + I                   + +T    + L D  +L  L     V AR
Sbjct: 386 LLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYAR 445

Query: 728 CAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSD 787
            +P  K  +++ L        M GDG ND  +LK+A+VG+A+ +NG++ +  A      D
Sbjct: 446 VSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTEESMTAMAQKRRD 504

Query: 788 DNFASI 793
           +N  S+
Sbjct: 505 ENMKSM 510

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 122/508 (24%), Positives = 193/508 (37%), Gaps = 105/508 (20%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A+ +    S  + IVR     E LG +  + SDKTGTLTQ  
Sbjct: 470 TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 529

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440
           M L+++     GTV           T+  + ++  +             G+     +   
Sbjct: 530 MQLRKI---HLGTV---------SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSR--- 574

Query: 441 SNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRM----- 495
                K ++ R  +  +  AT  N+   F+D++     A   P EIAI  F  R+     
Sbjct: 575 -----KEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLF 627

Query: 496 DHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFT 555
               H+LT                   Y+    FPF S  KRM  +   +RD+    +  
Sbjct: 628 KRDRHSLTLFHEYSGVNLQ--------YDILHVFPFTSDTKRMGII---VRDRTKNEI-- 674

Query: 556 KGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEE 615
                        W L  G            + +++ V  ++ EGLR L  A K +    
Sbjct: 675 -------------WFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRL 721

Query: 616 AESLGER--------LTKD-------RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRA 660
            E   +         L +D       +  +E +L   GL G+ D  + +   +++    A
Sbjct: 722 YEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNA 781

Query: 661 GINVHMLTGDFPGTAKAIAQEVGILPHNLY-----------------HYPKEVVDIMVMT 703
           G+ + MLTGD   TA+ +     ++    Y                  Y K   +  ++ 
Sbjct: 782 GVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLI 841

Query: 704 -----ATQFDSLTDEELDQLPVLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDG 753
                A        E  + +  LP+VIA RC PQ K  +  AL  RE    + C + GDG
Sbjct: 842 DGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDG 898

Query: 754 VNDSPSLKKANVGIAMGINGSDVAKDAS 781
            ND   ++ A+VG+  GI G +  K AS
Sbjct: 899 GNDVSMIQCADVGV--GIVGKE-GKQAS 923

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 123/509 (24%), Positives = 191/509 (37%), Gaps = 106/509 (20%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A  +    +    IVR     E LG +  + SDKTGTLTQ  
Sbjct: 447 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 506

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440
           M LK+          V+  NV +     D+         E ++D   ++G          
Sbjct: 507 MQLKK----------VHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLG---------P 547

Query: 441 SNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHH 500
            ++  K       +     A   N+   F+D D   ++A   P EIAI  F   +     
Sbjct: 548 RSTTRKDAATHVIDLITTLAICHNVTPTFED-DELTYQA-ASPDEIAIVKFTESV----- 600

Query: 501 ALTTXXXXXXXXXXXXNDAARI--YEHAAEFPFDSSIKRMSA-VYINLRDKNTRHVFTKG 557
            L+               +  I  Y+    FPF+S  KRM   VY   +D+         
Sbjct: 601 GLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQ--------- 651

Query: 558 AFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE 617
                      W L  G          + + +++    ++ EGLR L    K +  +  E
Sbjct: 652 ----------YWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYE 701

Query: 618 SLGERLTK------DRD---------FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGI 662
              +   +      +R+         ++E DL   GL G+ D  + +   +++    AGI
Sbjct: 702 QFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGI 761

Query: 663 NVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLT----------- 711
            + MLTGD   TA+ ++    ++    Y +   VV  +      F+ L            
Sbjct: 762 KIWMLTGDKVETARCVSISAKLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLL 818

Query: 712 --------------DEELDQLPVLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGD 752
                          E  D +  LP VIA RC PQ K  +  AL  RE    + C + GD
Sbjct: 819 IDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADV--ALIIRELTGKRVCCI-GD 875

Query: 753 GVNDSPSLKKANVGIAMGINGSDVAKDAS 781
           G ND   ++ A+VG+  GI G +  K AS
Sbjct: 876 GGNDVSMIQCADVGV--GIVGKE-GKQAS 901

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 120/505 (23%), Positives = 193/505 (38%), Gaps = 97/505 (19%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A  +    +    IVR     E LG +  + SDKTGTLTQ  
Sbjct: 453 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 512

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDV--SLIPRFSPWEYQHDEEEDVGIIANFKQR 438
           M LK++     GTV      +     V D   SL+        ++D   +  +  +    
Sbjct: 513 MQLKKI---HLGTVSYTSETLDI---VSDYVQSLVSS------KNDSLNNSKVALS---- 556

Query: 439 WQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHP 498
               +  K ++ R  +  L  A   N+   F+D D   ++A   P EIAI  F   +   
Sbjct: 557 ----TTRKDMSFRVRDMILTLAICHNVTPTFED-DELTYQA-ASPDEIAIVKFTESV--- 607

Query: 499 HHALTTXXXXXXXXXXXXNDAARI--YEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTK 556
              L+               + +   YE    FPF+S  KRM  +   +RD+        
Sbjct: 608 --GLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGII---VRDEQLDEY--- 659

Query: 557 GAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEA 616
                       W +  G         +  + +++    ++ EGLR L    K +  +  
Sbjct: 660 ------------WFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIY 707

Query: 617 ESLGER--------LTKDRD-------FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAG 661
           E   +         L +D+        ++E DL   GL G+ D  + +   +++    AG
Sbjct: 708 EQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAG 767

Query: 662 INVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLT---------- 711
           I + MLTGD   TA+ ++    ++    Y +    V        Q + L           
Sbjct: 768 IKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLID 827

Query: 712 ------------DEELDQLPVLPLVIA-RCAPQTKVRMIDALHRR--EKFCAMTGDGVND 756
                        E  D +  LP VIA RC PQ K  +   + +   ++ C + GDG ND
Sbjct: 828 GESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGND 886

Query: 757 SPSLKKANVGIAMGINGSDVAKDAS 781
              ++ A+VG+  GI G +  K AS
Sbjct: 887 VSMIQCADVGV--GIVGKE-GKQAS 908

>Scas_704.38
          Length = 1161

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 122/507 (24%), Positives = 195/507 (38%), Gaps = 101/507 (19%)

Query: 325 SMIPSSLVVVLTITMSAGAKVMSTRNVI----VRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A  +   + I    VR     E LG +  + SDKTGTLTQ  
Sbjct: 463 TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 522

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440
           M LK++     GTV      +       D  +    S               AN   +  
Sbjct: 523 MQLKKI---HLGTVSYTSETLDIVSDYVDALVNSSNS---------------ANPSGKSV 564

Query: 441 SNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHH 500
            ++  K L+ R  +  +  A   N+   F+D D   ++A   P EIAI  F   +     
Sbjct: 565 PSTSRKDLSARVRDMVVTLAICHNVTPTFED-DELTYQA-ASPDEIAIVKFTESVGL--- 619

Query: 501 ALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFE 560
           +L              + +   YE    FPF+S  KRM  +          H   K  + 
Sbjct: 620 SLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIV---------HDEQKDEY- 669

Query: 561 RVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLG 620
                   W +  G         ++ + +++    ++ EGLR L    K +    + ++ 
Sbjct: 670 --------WFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKL----SRNIY 717

Query: 621 ERLTKDRD-------------------FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAG 661
           ++  KD D                   ++E DL   GL G+ D  + +   +++    AG
Sbjct: 718 DQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAG 777

Query: 662 INVHMLTGDFPGTAKAIAQEVGILPHNLYHY-------PKEVVDIMVMTATQFDS--LTD 712
           I + MLTGD   TA+ ++    ++    Y +       P+  ++ +        +  L D
Sbjct: 778 IKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLID 837

Query: 713 EE-------------LDQLPVLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGV 754
            E              D +  LP V+A RC PQ K  +  AL  RE    + C + GDG 
Sbjct: 838 GESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADV--ALVIREFTGKRVCCI-GDGG 894

Query: 755 NDSPSLKKANVGIAMGINGSDVAKDAS 781
           ND   ++ A+VG+  GI G +  K AS
Sbjct: 895 NDVSMIQCADVGV--GIVGKE-GKQAS 918

>Kwal_23.5789
          Length = 1133

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 126/514 (24%), Positives = 192/514 (37%), Gaps = 120/514 (23%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGK 380
           ++IP SL V L +  S  A  +    +    IVR     E LG +  + SDKTGTLTQ  
Sbjct: 439 TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 498

Query: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440
           M LK+L     GTV           T+  + ++  +               +        
Sbjct: 499 MELKKL---HLGTVSY---------TMDTMDIVTDY---------------VRAMSDNLN 531

Query: 441 SNSLP----KGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFA---- 492
           S+++P    K L  R  +  L  A    +   F+D +     A   P EIAI  F     
Sbjct: 532 SSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAA--SPDEIAIVKFTESVG 589

Query: 493 -TRMDHPHHALTTXXXXXXXXXXXXNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTR 551
            T      H++T                   Y+    FPF+S  KRM  V          
Sbjct: 590 LTLFRRDRHSITLLHDQSGTNFE--------YDILHVFPFNSDNKRMGIV---------- 631

Query: 552 HVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTI 611
            +F K   E        W L  G  V         + +++    L+ EGLR L    K +
Sbjct: 632 -IFDKQKDEY-------WFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRL 683

Query: 612 PAEEAESLGERLTKDRD-------------------FVESDLIFQGLVGIYDPPRVETAG 652
               ++ L +  TKD +                    +E DL   GL G+ D  + +   
Sbjct: 684 ----SKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKS 739

Query: 653 AVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLY-------HYPKEVVDIMVMTAT 705
           +++    AGI + MLTGD   TA+ ++    ++    Y       + P+  +  + +   
Sbjct: 740 SIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKI 799

Query: 706 QFDS--LTDEELDQLPV-------------LPLVIA-RCAPQTKVRMIDALHR--REKFC 747
             +S  L D E   L +             LP VIA RC PQ K  +   +     ++ C
Sbjct: 800 NTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVC 859

Query: 748 AMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 781
            + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 860 CI-GDGGNDVSMIQSADVGV--GIVGKE-GKQAS 889

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 103/231 (44%), Gaps = 43/231 (18%)

Query: 584 DDLEIIQKNVD----TLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGL 639
           + L  I KN D    + +  G RVLA A+K++P      + +    +RD VES+L F G 
Sbjct: 612 ERLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDDL---NRDDVESELTFNGF 668

Query: 640 VGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL-------------- 685
           +  + P + +    +K  + +     M+TGD P TA  +A+EVGI+              
Sbjct: 669 LIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSD 728

Query: 686 -PHNLYHYPKEVVDI-------------------MVMTATQFDSLTDE-ELDQLPVLPLV 724
               L+   +E V I                   + +T    ++L    +L  L     V
Sbjct: 729 DNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWV 788

Query: 725 IARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
            AR +P  K  +++ L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 789 YARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 838

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/345 (20%), Positives = 135/345 (39%), Gaps = 62/345 (17%)

Query: 70  LLKQMCNAMILVLIISMVIALAIKD--WISGGVIAFVVALNVSIGAYQEYNACKTMNSLK 127
           L K+   A + V  +   +AL + D  W       F++    +   +Q   A K   ++ 
Sbjct: 192 LFKEHAVAPLFVFQV-FCVALWLLDEFWYYSLFNLFMIISMEAAAVFQRLTALKEFRTM- 249

Query: 128 DLSTPSARVIRNGEDVVMASAQVVPGDIVQV-RVGD--TVPADLRLVEALNLETDEALLT 184
            +   +  V RN + V + + +++P D+V + R  +   +P DL L++   +  +EA+L+
Sbjct: 250 GIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAI-VNEAMLS 308

Query: 185 GEALPVAK-----------------DPAAVFE------QDTPVGDRLNLAFASSTVSKGR 221
           GE+ P+ K                 D  AV        Q TP   + ++         G 
Sbjct: 309 GESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIP----PPPDGG 364

Query: 222 ATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPL 281
           A  IV +TG  +  G +   +      +S D  ++ +    L + A + S+     GT +
Sbjct: 365 ALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVWVEGTKM 424

Query: 282 HRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSA 341
            R                           +  ++ +  I +  S++P  L + LT+ +++
Sbjct: 425 GR---------------------------IQSKLILDCILIITSVVPPELPMELTMAVNS 457

Query: 342 GAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
               ++   V       +   G ++  C DKTGTLT   ++ + L
Sbjct: 458 SLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL 502

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 128/283 (45%), Gaps = 60/283 (21%)

Query: 529 FPFDSSIKRMSAVYINLRDKNTRHV-FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLE 587
           F F S++KR S + ++    N +H    KGA E +     R +L             D +
Sbjct: 581 FQFSSALKRSSTIAVH----NKQHYSAVKGAPETI-----RERLSQ--------VPTDYD 623

Query: 588 IIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPR 647
            + K   + +  G RVLA A+K +P+   + + E+L  +R+ VESDL F+G +  + P +
Sbjct: 624 QVYK---SFTRAGSRVLALASKKLPSMSIKQI-EKL--EREAVESDLEFKGFLVFHCPLK 677

Query: 648 VETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH-------------------- 687
            +    +K  + +     M+TGD P TA  +A+EV I+                      
Sbjct: 678 DDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRN 737

Query: 688 ------NLYHYPKEVVDIMVMTATQFDSLTDE---------ELDQLPVLPLVIARCAPQT 732
                 N ++  K+  +   + A    ++T           +L++L     V AR +P  
Sbjct: 738 IEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRHTWVYARVSPAQ 797

Query: 733 KVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
           K  ++++L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 798 KEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 839

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 118/304 (38%), Gaps = 56/304 (18%)

Query: 111 IGAYQEYNACKTMNSLKDLSTPSAR-----VIRNGEDVVMASAQVVPGDIVQVRVGD--- 162
           I A +  +  + + +LK+  T   +     V R+ +  ++ + +++P D++ V   D   
Sbjct: 228 IFAMEAVSVFQRLTTLKEFKTMGIKPYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDS 287

Query: 163 TVPADLRLVEALNLETDEALLTGEALPVAK-----------------DPAAVFEQDTPVG 205
            +  D+ LV+   +  +EA+L+GE+ P+ K                 D  +V    T V 
Sbjct: 288 ALSCDMILVDGTCI-VNEAMLSGESTPLLKESVKLRSSEEKLQVEGLDKNSVLHGGTKVL 346

Query: 206 DRLNLAFASSTVSK---GRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTV 262
                   SS++     G A  +V +TG  +  G +   +      +S    ++      
Sbjct: 347 QVTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALYFILF 406

Query: 263 LTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICV 322
           L + A   S+     GT + R                           V  ++ +  I +
Sbjct: 407 LLIFAIAASWYVWVEGTRMGR---------------------------VQSKLILDCILI 439

Query: 323 ALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMI 382
             S++PS L + LT+ ++    V+S   V       +   G ++  C DKTGTLT   ++
Sbjct: 440 ITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLV 499

Query: 383 LKQL 386
            + L
Sbjct: 500 FEGL 503

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 136/321 (42%), Gaps = 74/321 (23%)

Query: 529  FPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEI 588
            F F S+++RMS + +    +N    FTKGA E + + C++  L        PL  + L  
Sbjct: 916  FEFLSNLRRMSVI-VKPFSENVFMSFTKGAPEVIFELCSKQTL--------PLDYEAL-- 964

Query: 589  IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648
                +   ++ G RV+A A K +   ++    ++++++   +ES+L F G +   +  + 
Sbjct: 965  ----LHHYTHNGYRVIACAGKKL-TRQSWLYSQKVSREE--IESNLEFLGFIIFENKLKG 1017

Query: 649  ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIM--VMTATQ 706
             T   ++  HRA I   M TGD   TA ++ +E G++       P+  V ++  + T+ +
Sbjct: 1018 TTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVES-----PRVFVSVINDIDTSQE 1072

Query: 707  FDSLT-------DEELDQLPVLPL------------------------------------ 723
             D +T        + LD + + PL                                    
Sbjct: 1073 GDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILL 1132

Query: 724  ---VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 780
               + AR +P  K  +++ L          GDG ND  +LK A++GI++    + VA   
Sbjct: 1133 KTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPF 1192

Query: 781  SDIVLSDDNFASILNAVEEGR 801
            +  +      + +L+ ++EGR
Sbjct: 1193 TSRLF---EISCVLDVMKEGR 1210

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 92/214 (42%), Gaps = 24/214 (11%)

Query: 49  RLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFVVALN 108
           R+   G N++   +    + IL  +  +   +  I S+++ +    +     I  +  L+
Sbjct: 458 RMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLS 516

Query: 109 VSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVR--VGDTVPA 166
           V     +   + + ++ L        RV R+G    + S+ +VPGDI ++       +P 
Sbjct: 517 VIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPC 575

Query: 167 DLRLVEALNLETDEALLTGEALPVAKDPAAVFE---------QDTPVGDRLNLAF----- 212
           D  L+    L  +E++LTGE++PV+K  AA  E          DT +   ++ +F     
Sbjct: 576 DSILISGDCL-VNESMLTGESVPVSK-VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGT 633

Query: 213 ----ASSTVSKGRATGIVVRTGLRSEIGKIAESL 242
                 +T  +  A G+V RTG  +  G +  S+
Sbjct: 634 KLIRVRATAGQSIALGMVARTGFSTTKGSLVRSM 667

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 124/300 (41%), Gaps = 64/300 (21%)

Query: 531 FDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQ 590
           F+S+ KRMSA++  + D + + +F KGA   +L+     +LD      +P  +  L    
Sbjct: 701 FNSTRKRMSAIF-RMPDGSIK-LFCKGADTVILE-----RLD---SEFNPYVQSTL---- 746

Query: 591 KNVDTLSNEGLRVLAFATKTIPAEEAESLG--------------ERLTKDRDFVESDLIF 636
           ++++  + EGLR L  A++TIP +E E                 E L +  + +E DL F
Sbjct: 747 RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFF 806

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYPK 694
            G   I D  +      +     AG+ V +LTGD   TA  I     +L    NL    +
Sbjct: 807 LGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNE 866

Query: 695 EVV-DIMVMTATQFDSLTDEELDQ--LPVLPLVI-------------------------- 725
           E   D      ++ +++   ++ Q  +  L LVI                          
Sbjct: 867 ETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKA 926

Query: 726 ---ARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780
               R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 927 VICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 100 VIAFVVALNVSIGAYQEYNACKTMN-SLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQV 158
           V+  V A+  S+   +  NA K +N SL D+        R+GE V      +  GDI++V
Sbjct: 260 VVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE-----RSGEFVRKKWIDIAVGDIIRV 314

Query: 159 RVGDTVPADL 168
           R  + +PADL
Sbjct: 315 RSEEAIPADL 324

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 352 IVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
           +VR    +E LG +  I SDKTGTLT+  M  K +
Sbjct: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV 579

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 123/287 (42%), Gaps = 35/287 (12%)

Query: 109 VSIGAYQEYNA-CKTMNSLKDL--STPSARVIRNGEDVVMASAQVVP----GDIVQVRVG 161
           +SIG Y E  A  KT  +L  L   TPS+ +I + +D  +     +     GDI  V+ G
Sbjct: 384 ISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPG 443

Query: 162 DTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGR 221
             +P+D  + + ++ E DE+L+TGE   V K+  +V    T  G  L + F  ++V  G 
Sbjct: 444 AKIPSDGIVTKGIS-EVDESLMTGETNLVVKEIGSVVTGGTINGSGL-IYFEVTSV--GD 499

Query: 222 ATGIVVRTGLRSEIGKIAESLQGKQSLISR--DENKSGLQNTVLTVKASVGSFLGTNVGT 279
            T +       + I K+ ++ Q K++ I R  D   S    TVL +     S L   V T
Sbjct: 500 DTKL-------ANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLIL-----SLLTFIVWT 547

Query: 280 PLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITM 339
            L R                    M  Q   +   V I A   AL +   + ++V     
Sbjct: 548 SLTRSEKIISKLSIFGETSESRFYMCLQ---IATSVVIVACPCALGLATPTAIMV----- 599

Query: 340 SAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
             G  V S   V+++  D LE    VN    DKTGTLT G M ++Q 
Sbjct: 600 --GTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF 644

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 63/147 (42%), Gaps = 36/147 (24%)

Query: 642 IYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV 701
           + D  + +    ++        V M+TGD   +A  +A+ V I P+N+Y           
Sbjct: 761 LLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY----------- 809

Query: 702 MTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 761
                                   +   P  K + ++ L    +  A  GDG+NDS +L 
Sbjct: 810 ------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALV 845

Query: 762 KANVGIAMGINGSDVAKDASDIVLSDD 788
            +++GIA+  +G++VA +A+ IV+ +D
Sbjct: 846 TSDLGIAIS-SGTEVAIEAAGIVILND 871

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 118/282 (41%), Gaps = 58/282 (20%)

Query: 529 FPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEI 588
           F F S++KR S+V  +       +   KGA E +     R +L      T P   D++  
Sbjct: 578 FQFSSALKRSSSVATH---DGKLYSAVKGAPETI-----RERL-----FTIPANYDEI-- 622

Query: 589 IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648
                 + +  G RVLA A+K +   E  S  +    DR+  E DL F G +  + P + 
Sbjct: 623 ----YKSFTRSGSRVLALASKKL---EKMSQSQIEDADREHFERDLEFNGFLIFHCPLKH 675

Query: 649 ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN---------------LYHYP 693
           +    ++  + +     M+TGD P TA  +A+EVGI+                  ++   
Sbjct: 676 DAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNV 735

Query: 694 KEVVDI-------------------MVMTATQFDSLT-DEELDQLPVLPLVIARCAPQTK 733
           +E +                     + +T    ++L    +L  L     + AR +P  K
Sbjct: 736 EETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQK 795

Query: 734 VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
             +++ L        M GDG ND  +LK+A+VG+A+ +NG++
Sbjct: 796 EFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTE 836

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/341 (20%), Positives = 137/341 (40%), Gaps = 54/341 (15%)

Query: 70  LLKQMCNAMILVLIISMVIALAIKD--WISGGVIAFVVALNVSIGAYQEYNACKTMNSLK 127
           L K+   A + V  +   +AL + D  W       F++    +   +Q   A K   ++ 
Sbjct: 190 LFKEHAVAPLFVFQV-FCVALWLLDEYWYLSLFNLFMILSMEAASVFQRLTALKEFRTM- 247

Query: 128 DLSTPSARVIRNGEDVVMASAQVVPGDIVQV-RVGD--TVPADLRLVEALNLETDEALLT 184
            +   +  V+R+G+ V M + +++P D+V V R  +   +P DL LV+   +  +EA+L+
Sbjct: 248 GVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVDGTCI-VNEAMLS 306

Query: 185 GEALPVAKDPAAVF----EQDTPVGDRLNLAFASSTVSK---------------GRATGI 225
           GE+ P+ K+   +     E      D++++    + V +               G A  I
Sbjct: 307 GESTPLLKESIRLRPGNEELQIEGTDKISVLHGGTKVLQVTTPEKTGKVPSPPDGGAIAI 366

Query: 226 VVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXX 285
           V +TG  +  G +   +      +  D  ++      L + A V S+     GT + R  
Sbjct: 367 VTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFILFLLIFAVVASWYVWVEGTKMGR-- 424

Query: 286 XXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKV 345
                                    V  ++ +  I +  S++P  L + LT+ +++    
Sbjct: 425 -------------------------VQSKLILDCILIITSVVPPELPMELTMAVNSSLSA 459

Query: 346 MSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
           +S   V       +   G ++  C DKTGTLT   ++ + L
Sbjct: 460 LSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL 500

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 117/282 (41%), Gaps = 58/282 (20%)

Query: 529 FPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEI 588
           F F SS+KR +++       N      KGA E +     R +L+     + P   DD+  
Sbjct: 578 FQFSSSLKRSASI---ASQSNRFFAAVKGAPETI-----RERLN-----SVPSDYDDI-- 622

Query: 589 IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648
                 + +  G RVLA A K +P      +      DRD +E+ L F   +  + P + 
Sbjct: 623 ----YKSFTRSGSRVLALAYKDLPKMSNSQID---NIDRDEIETGLTFGAFLVFHCPLKD 675

Query: 649 ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL---------PHNLYHYPKEVVDI 699
           +    +K  + +     M+TGD P TA  +A+EVGI+         P +   +   + D+
Sbjct: 676 DAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHALVMRDV 735

Query: 700 MVMTATQF----DSLTDEELDQLPVLPL----------------------VIARCAPQTK 733
                  F    D+  ++E+ Q   L +                      + AR +P  K
Sbjct: 736 NETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRHTWIYARVSPSQK 795

Query: 734 VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
             ++  L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 796 EFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 836

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 119/307 (38%), Gaps = 63/307 (20%)

Query: 111 IGAYQEYNACKTMNSLKDLST----PSA-RVIRNGEDVVMASAQVVPGDIVQV-RVGD-- 162
           I A +  +  + + +LK+  T    P A  V R+G+ V M + ++ P D+V + R  +  
Sbjct: 227 IVAMEATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDS 286

Query: 163 TVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASS------- 215
            +P DL L++   +  +EA+L+GE+ P+ K+   +     P  D+L L            
Sbjct: 287 AIPCDLLLIDGSCI-VNEAMLSGESTPLLKESIKL----RPANDQLQLDGVDKNAVLHGG 341

Query: 216 ----------------TVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQ 259
                           T   G A  +V +TG  +  G +   +      +     ++   
Sbjct: 342 TKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYF 401

Query: 260 NTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYA 319
              L + A V S+     GT + R                           +  ++ +  
Sbjct: 402 ILFLLIFAIVASWYVWKEGTRMGR---------------------------IQSKLILDC 434

Query: 320 ICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQG 379
           I +  S++P  L + LT+ +++    +S   V       +   G ++  C DKTGTLT  
Sbjct: 435 ILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAE 494

Query: 380 KMILKQL 386
            ++ + L
Sbjct: 495 DLVFEGL 501

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 124/312 (39%), Gaps = 70/312 (22%)

Query: 522 IYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPL 581
           +YE      F+S+ KRMSA++    D + R +  KGA   +L+             ++P 
Sbjct: 685 VYELLNICEFNSTRKRMSAIF-RFPDNSIR-LLCKGADTVILERLA--------ATSNPY 734

Query: 582 TEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGERLTKDR 627
               L    ++++  + EGLR L  A++TIP  E E              +  E L K  
Sbjct: 735 VAATL----RHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVA 790

Query: 628 DFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH 687
           + +E  L+  G   I D  +      +    +AGI V +LTGD   TA  I     +L  
Sbjct: 791 EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE 850

Query: 688 NLYHYPKEVVDIMVMTAT------QFDSLTDEELDQ--LPVLPLVI-------------- 725
           ++      +V+     +T      +  ++ D ++ Q  +  L LVI              
Sbjct: 851 DMNLL---IVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLE 907

Query: 726 ---------------ARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM 769
                           R +P  K  ++  + RR K   +  GDG ND   ++ A+VG+ +
Sbjct: 908 EFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI 967

Query: 770 -GINGSDVAKDA 780
            G+ G   A+ A
Sbjct: 968 SGMEGMQAARSA 979

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 352 IVRRLDSLEALGAVNDICSDKTGTLTQGKMILK 384
           +VR    +E LG +  I SDKTGTLTQ  M  K
Sbjct: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFK 569

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 69/150 (46%), Gaps = 38/150 (25%)

Query: 638 GLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVV 697
           GL  I D  + ++   V+   R G   +M+TGD    AK +A+EVGI   N+Y       
Sbjct: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------- 809

Query: 698 DIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRRE--KFCAMTGDGVN 755
                                       +  +P  K  ++  +  +E     A+ GDG+N
Sbjct: 810 ----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIN 841

Query: 756 DSPSLKKANVGIAMGINGSDVAKDASDIVL 785
           D+P+L  +++GIA+   G+++A +A+DIV+
Sbjct: 842 DAPALALSDLGIAIS-TGTEIAIEAADIVI 870

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 309 FIVNREVAIYAIC------VALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEAL 362
           F  N +   + IC      V +   P +L +     +  G  V +   V+++  + LE  
Sbjct: 559 FTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKF 618

Query: 363 GAVNDICSDKTGTLTQGKMILKQL 386
            ++     DKTGTLT G M++K+ 
Sbjct: 619 NSITTFVFDKTGTLTTGFMVVKKF 642

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 13/70 (18%)

Query: 154 DIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD------------PAAVFEQD 201
           DIV+++ G  +PAD  ++     E DE+L+TGE++ V K             P   + + 
Sbjct: 435 DIVEIKPGMKIPAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRT 493

Query: 202 TPVGDRLNLA 211
           T VG+   LA
Sbjct: 494 TTVGEETKLA 503

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 59/202 (29%)

Query: 596  LSNEGLRVLAFATKTIPAEEAESLGERLT----KDRDFVESDLIFQGLV-GIYDPPRVET 650
            L++E L++LA         E ++ G+ L     K R +  +D  +  ++    D  R E 
Sbjct: 885  LTSEQLKLLA---------EWKARGKSLMVTAIKSRSYFGNDNFYPVMMCAAKDEIRPEA 935

Query: 651  AGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSL 710
               +K+  R+GI   M++GD   TA+A+AQE+                            
Sbjct: 936  KDVIKELRRSGIECWMISGDNEVTARAVAQEL---------------------------- 967

Query: 711  TDEELDQLPVLPLVIARCAPQTKVRMIDALHR-------REKFCAMTGDGVNDSPSLKKA 763
               ++D       VIA   P+ K   +  +           K  AM GDG+ND+P+L  A
Sbjct: 968  ---DIDN------VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAA 1018

Query: 764  NVGIAMGINGSDVAKDASDIVL 785
            +VGIA+  +GS++A  + D VL
Sbjct: 1019 DVGIALA-SGSELAMTSCDFVL 1039

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 153 GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA-AVFEQDTPVGDRLNLA 211
           GD +++  G + P D  ++E    E DE+ LTGE++P+ +     +F     VG    +A
Sbjct: 575 GDYIKISPGQSPPLDSIILEG-ETEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIA 633

Query: 212 FASSTVSKGRATGIV--VRTGL--RSEIGKIAESLQG 244
             SS   +     IV  VR G   R+ I ++A+ L G
Sbjct: 634 KVSSFDGESLLDQIVNTVRDGQLNRAPIERLADILTG 670

>Scas_615.9
          Length = 942

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 39/182 (21%)

Query: 605 AFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINV 664
           A  T ++    +++  +  TK    +   L+  G   I D  + + A  ++       ++
Sbjct: 665 ALMTDSMFDSNSDNTSDDFTKSYVSINDTLV--GKFEIRDSVKEDVADIIQYLQGLHYDI 722

Query: 665 HMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLV 724
           +M+TGD  G A  +AQ+VGI  +N+Y                                  
Sbjct: 723 YMVTGDSHGAAMKVAQQVGIAANNVY---------------------------------- 748

Query: 725 IARCAPQTKVRMIDALHRRE-KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 783
            +   P  K  ++++L        A  GDG+NDSP L  +++G+A+   G+D+A +A+DI
Sbjct: 749 -SGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADI 806

Query: 784 VL 785
           V+
Sbjct: 807 VV 808

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 121/287 (42%), Gaps = 35/287 (12%)

Query: 109 VSIGAYQEYNA-CKTMNSLKDLS--TPSARVIRNGEDVVMASAQVVP------GDIVQVR 159
           +S G   E  A  +T +SL  L   TPS  +I   ++ + +S   +        DI++++
Sbjct: 329 ISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK 388

Query: 160 VGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSK 219
            G  +PAD  +++  + E DE+L+TGE++ V K   +                A S    
Sbjct: 389 PGMKIPADGIIIQGES-EIDESLMTGESILVHKQKGS-------------QVIAGSLNGP 434

Query: 220 GRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGT 279
           G      +  G  +++ +I ++++  Q       NK+ +QN    + AS+  F+ T +  
Sbjct: 435 GHFYFKAINIGDDTKLAQIIQTMKSAQ------LNKAPIQNNADYL-ASI--FVPTILCL 485

Query: 280 PLHRXXXXXXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITM 339
            +                          KF  + ++AI  I VA    P +L +     +
Sbjct: 486 SIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVAC---PCALGLATPTAI 542

Query: 340 SAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
             G  + +   V+++  D LE    +  I  DKTGT+T G+M +++ 
Sbjct: 543 MVGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRF 589

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 96/236 (40%), Gaps = 49/236 (20%)

Query: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE-----------SLGERLTKDRDF---VE 631
            LE   +++++ S EGLR L FA K I  E+ E           SL ER  K  +    +E
Sbjct: 958  LEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIE 1017

Query: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN--- 688
             +L   G   I D  +   + A++K  RAGI + MLTGD   TA  I     ++ H+   
Sbjct: 1018 DELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLI-HDYST 1076

Query: 689  ---LYHYPKEVVDIMVMTATQFDS------------LTDEELDQLPVL------------ 721
               L    + ++  M   + + DS             T    +  P L            
Sbjct: 1077 VVILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTD 1136

Query: 722  PLVIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
             +V  R +P  K  M+  +   +K       GDG ND   ++ A++G+  GI G +
Sbjct: 1137 SVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGV--GIAGKE 1190

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----------STRNVIVRRLDSLEALGAVNDICSDKTG 374
           ++IP SL V + +   A +++M          S     VR    LE LG V+ I SDKTG
Sbjct: 473 TIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTG 532

Query: 375 TLTQGKMILKQL 386
           TLT  KM+ ++L
Sbjct: 533 TLTDNKMLFRKL 544

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 94/243 (38%), Gaps = 63/243 (25%)

Query: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE-----------SLGERLTKDRD---FVE 631
            LE     +D  S EGLR L ++ K IPAEE +           SL  R T+  +    +E
Sbjct: 937  LEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIE 996

Query: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYH 691
            +DL   G   I D  +     A++K  RAGI + MLTGD     +  A  +G     +Y 
Sbjct: 997  TDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGD----KRETAINIGYACKLIYD 1052

Query: 692  YPKEVV-----DIMVMTATQFDSLTDEELD--------------QLPVL----------- 721
            Y   V+     D ++   T       EELD               L V            
Sbjct: 1053 YSTVVILKKNDDNLISKMTAL----GEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFI 1108

Query: 722  -------PLVIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGIN 772
                    ++  R +P  K  ++  +  + K       GDG ND   ++ A++G+  GI 
Sbjct: 1109 ELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGV--GIT 1166

Query: 773  GSD 775
            G +
Sbjct: 1167 GKE 1169

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----------STRNVIVRRLDSLEALGAVNDICSDKTG 374
           ++IP SL V   I  +  +K+M          S      R    LE LG V+ I SDKTG
Sbjct: 479 TLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIFSDKTG 538

Query: 375 TLTQGKMILKQL 386
           TLT  KMI ++ 
Sbjct: 539 TLTDNKMIFRKF 550

>Kwal_26.7070
          Length = 1315

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 122/301 (40%), Gaps = 66/301 (21%)

Query: 531 FDSSIKRMSAVYINLRDKNTR-HVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589
           F+S+ KRMSA++   R  N    +F KGA   +L+     +L  G    +P  E  L   
Sbjct: 697 FNSTRKRMSAIF---RLPNGEIKLFCKGADTVILE-----RLKAGE---NPYIEATL--- 742

Query: 590 QKNVDTLSNEGLRVLAFATKTIPAEE-----------AESLGERLTKDRD---FVESDLI 635
            ++++  + EGLR L  A++T+   E           + +L +R  K  D    +E DL 
Sbjct: 743 -RHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLF 801

Query: 636 FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYP 693
             G   I D  +      +     AGI V +LTGD   TA  I     +L    NL    
Sbjct: 802 LLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN 861

Query: 694 KEVVDIMVMTATQ-FDSLTDEELDQ--LPVLPLVI------------------------- 725
           +E  +      T+   +++D ++ Q  +  L LVI                         
Sbjct: 862 EEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCK 921

Query: 726 ----ARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGIAM-GINGSDVAKD 779
                R +P  K  ++  + R+ +      GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 922 AVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 981

Query: 780 A 780
           A
Sbjct: 982 A 982

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 352 IVRRLDSLEALGAVNDICSDKTGTLTQGKMILK 384
           +VR    +E LG +  I SDKTGTLT+  M  K
Sbjct: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 572

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 121/300 (40%), Gaps = 64/300 (21%)

Query: 531 FDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQ 590
           F+S+ KRMSA++    D + + +  KGA   +L+  +       TG  +      ++   
Sbjct: 679 FNSTRKRMSAIF-RFPDDSIK-LLCKGADSVILERLSE------TGNFY------VDATT 724

Query: 591 KNVDTLSNEGLRVLAFATKTIPAEEAESL--------------GERLTKDRDFVESDLIF 636
           ++++  + EGLR L  ATK IP +E  +                E+L    + +ES L  
Sbjct: 725 RHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTL 784

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYPK 694
            G   I D  +      ++    AGI + +LTGD   TA  I     +L    NL    +
Sbjct: 785 IGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISE 844

Query: 695 EVVDIM------VMTATQFDSLTDEELDQLPVL--------------------------P 722
           E  +         + A    SL++ +++ L ++                           
Sbjct: 845 ETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKA 904

Query: 723 LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780
           ++  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 905 VICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 90/228 (39%), Gaps = 47/228 (20%)

Query: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDR--------------DFVE 631
            +E   +++D  + EGLR L ++ K I  +E E+   R +  +              + +E
Sbjct: 938  IERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEIIE 997

Query: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIA---------QEV 682
             DL   G +GI D  +     A+ K  RAGI + MLTGD   TA  I            V
Sbjct: 998  RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTV 1057

Query: 683  GILPHNLYHYPKEVVDIM----------VMTATQFDSLTDEELDQLPVLPLVIARC---- 728
             IL  N  +   ++  I            +      +LT  E   L ++ L I  C    
Sbjct: 1058 IILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFE-GNLTLMTLFIELCTKTD 1116

Query: 729  -------APQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGI 767
                   +P  K  M+  + + +K       GDG ND   ++ A++G+
Sbjct: 1117 SVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGV 1164

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 46/108 (42%), Gaps = 28/108 (25%)

Query: 307 QKFIVNREV----AIYA--------------ICVALSMIPSSLVVVLTITMSAGAKVM-- 346
           Q+F  NREV    A Y               I +  ++IP SL V + I     +++M  
Sbjct: 415 QRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEIIKDMQSRLMEW 474

Query: 347 --------STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQL 386
                   +      R    LE LG V+ I SDKTGTLT  +MI ++ 
Sbjct: 475 DIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKF 522

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 37/202 (18%)

Query: 589 IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648
           I  N+   +   +  +    K +  +E+ S     T    +V  D    G   I D  + 
Sbjct: 694 ISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKE 753

Query: 649 ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFD 708
           +    V+     GI   M+TGD   +A  +AQ++GI  ++++                  
Sbjct: 754 DAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVF------------------ 795

Query: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGI 767
                            +   P+ K  ++  L     +  A  GDG+NDSP+L +A++GI
Sbjct: 796 -----------------SEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGI 838

Query: 768 AMGINGSDVAKDASDIVLSDDN 789
           ++  +G+D+A +A+DIV+ D +
Sbjct: 839 SIS-SGTDIAIEAADIVILDSD 859

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 104/262 (39%), Gaps = 47/262 (17%)

Query: 131 TPSAR--VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEAL 188
           TPS+   V+ +G    ++   + P DIV+V  G  +PAD  ++     E DE+L+TGE++
Sbjct: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN-ETEVDESLITGESM 463

Query: 189 PVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQ-- 246
            V K           VG ++      S    G      +R G  +++  I  +++  Q  
Sbjct: 464 LVEK----------IVGSQV---IGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLS 510

Query: 247 -SLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXXXXXXXXXXXXXXXXXXMA 305
            + I +  +K         +  S  +F+                              M 
Sbjct: 511 KAPIQKYADKMAGIFVPFVISLSAITFI----------------------TWMLVSYTMK 548

Query: 306 TQKFIVNREVAIYAICVALSM------IPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSL 359
           T   I N E   + +C+ +S+       P +L +     +  G  V ++  V+++  D L
Sbjct: 549 TPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVL 608

Query: 360 EALGAVNDICSDKTGTLTQGKM 381
           E   A+     DKTGTLT G+M
Sbjct: 609 EKCSALQTFLFDKTGTLTTGRM 630

>Kwal_23.3556
          Length = 1597

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 94/251 (37%), Gaps = 47/251 (18%)

Query: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLG--------------ERLTKDRDFVE 631
            LE   + ++  S  GLR L ++ K IP+E+ E                 E++    + VE
Sbjct: 957  LERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVE 1016

Query: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN--- 688
            + L   G   I D  +   A A+ K  RAGI + MLTGD   TA  I     ++ H+   
Sbjct: 1017 TSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLI-HDYST 1075

Query: 689  --LYHYPKEVVDIMVMTATQ-------------FDSLTDEELDQLPVL------------ 721
              +     E +   +   +Q              D  T    +  P L            
Sbjct: 1076 VVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTD 1135

Query: 722  PLVIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 779
             ++  R +P  K  M+  +   +K       GDG ND   ++ A++G+ +       A  
Sbjct: 1136 SVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASR 1195

Query: 780  ASDIVLSDDNF 790
            +SD  ++   F
Sbjct: 1196 SSDYSIAQFRF 1206

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 16/83 (19%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----------STRNVIVRRLDSLEALGAVNDICSDKTG 374
           ++IP SL V + I  +  +K+M          +      R    LE LG V+ I SDKTG
Sbjct: 474 TLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTG 533

Query: 375 TLTQGKMILKQL------WVPEF 391
           TLT  KM+ + L      W+ +F
Sbjct: 534 TLTDNKMVFRALSVCGSSWIHDF 556

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 63/147 (42%), Gaps = 35/147 (23%)

Query: 639  LVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD 698
             + + D  R E    V+  H  GI   M++GD    A A+A EVGI         K V+ 
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI---------KHVIA 1063

Query: 699  IMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSP 758
                             D LP             K++ I     +    AM GDG+ND+P
Sbjct: 1064 -----------------DVLPE--------GKAEKIQWIRETSGQGVAIAMVGDGMNDAP 1098

Query: 759  SLKKANVGIAMGINGSDVAKDASDIVL 785
            ++  A+VGI++  +GSD+A  + D VL
Sbjct: 1099 AIAAADVGISLA-SGSDLAMISCDFVL 1124

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 318 YAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGA-VNDICSDKTGTL 376
           +AI V +   P  + +     +  GA + +   ++ R   +   +G+ V  +C DKTGTL
Sbjct: 807 FAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTL 866

Query: 377 TQG 379
           T+G
Sbjct: 867 TKG 869

>Kwal_55.21575
          Length = 989

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 41/161 (25%)

Query: 639 LVG---IYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKE 695
           LVG   I D  + + A  V+     G  V M+TGD   +A  +A E+GI  +N+Y     
Sbjct: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY----- 793

Query: 696 VVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVN 755
                         LT  + +QL                 + D      K  A  GDG+N
Sbjct: 794 ------------SELTPADKNQL-----------------VQDLQDGGRKNVAFIGDGIN 824

Query: 756 DSPSLKKANVGIAMGINGSDVAKDASDIVL---SDDNFASI 793
           DSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 825 DSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 109 VSIGAYQEYNA-CKTMNSLKDLST--PS-ARVIRNGEDVVMASAQVVPGDIVQVRVGDTV 164
           +S+G   E  A  KT NSL  L +  PS   +I NG+   +    +  GD V+++ G  +
Sbjct: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441

Query: 165 PADLRLVEALNLETDEALLTGEALPVAK 192
           P D  ++E  + E DE+L+TGE+L V +
Sbjct: 442 PTDGVIIEGES-EVDESLITGESLMVPR 468

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 308 KFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVND 367
           KF +  E+ I  I VA    P +L +     +  G  + +   V+++  D LE   ++  
Sbjct: 561 KFFICLEMTISVIVVAC---PCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLET 617

Query: 368 ICSDKTGTLTQGKMILKQLWVP 389
              DKTGTLT G M ++Q +VP
Sbjct: 618 FLFDKTGTLTTGHMTVEQ-FVP 638

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 121/310 (39%), Gaps = 65/310 (20%)

Query: 531 FDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQ 590
           F+S+ KRMSA++    D + + +F KGA   +L+     +LD             +E   
Sbjct: 698 FNSTRKRMSAIF-RFPDGSIK-LFCKGADTVILE-----RLDDEANQY-------VEATM 743

Query: 591 KNVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGERLTKDRDFVESDLIF 636
           ++++  ++EGLR L  A + I   E E              +  E+L +  + +E +LI 
Sbjct: 744 RHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLIL 803

Query: 637 QGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYPK 694
            G   I D  +      +     AGI + +LTGD   TA  I     +L    NL    +
Sbjct: 804 IGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINE 863

Query: 695 EVVD------IMVMTATQFDSLTDEELDQLPVL--------------------------P 722
           E  D      +  + A     L+  ++  L ++                           
Sbjct: 864 ETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKA 923

Query: 723 LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780
           ++  R +P  K  ++  + R+     +    G ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 924 VICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSA 983

Query: 781 SDIVLSDDNF 790
            DI L    F
Sbjct: 984 -DIALGQFKF 992

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 352 IVRRLDSLEALGAVNDICSDKTGTLTQGKMILK 384
           +VR    +E LG +  I SDKTGTLT+  M  K
Sbjct: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFK 573

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 34/158 (21%)

Query: 644  DPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHY--PKEVVDIM- 700
            D  R +    +    + GI++H+L+GD  G  +++A  +GI   N+  +  P E  + + 
Sbjct: 1024 DSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIK 1083

Query: 701  -VMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPS 759
             ++     DS +  +       P+V+                    FC   GDG ND+  
Sbjct: 1084 DIVEGRNCDSSSQSKR------PVVV--------------------FC---GDGTNDAIG 1114

Query: 760  LKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 797
            L +A +G+ +   GS+VAK A+D+V+      +IL  +
Sbjct: 1115 LTQATIGVHIN-EGSEVAKLAADVVMLKPKLNNILTMI 1151

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%)

Query: 314 EVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKT 373
           +  IYAI V +   P  + + + I     + V + R VI +  +S+E     + +  DKT
Sbjct: 846 QAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKT 905

Query: 374 GTLTQGKM 381
           GTLT+GK+
Sbjct: 906 GTLTEGKL 913

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 125 SLKDLSTPSARVI-RNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALL 183
           S++ L   SA ++ + G++  +    +  GDI +V     +P D  ++   + E DEAL+
Sbjct: 688 SVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVISGSS-EVDEALI 746

Query: 184 TGEALPVAKDPAAV 197
           TGE++PV K   ++
Sbjct: 747 TGESMPVPKKCQSI 760

>Scas_89.1
          Length = 271

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (44%), Gaps = 33/182 (18%)

Query: 627 RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILP 686
           +  +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ ++    ++ 
Sbjct: 28  KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS 87

Query: 687 HNLYHY-------PKEVVDIMVMTATQFDS--LTDEE-------------LDQLPVLPLV 724
              Y +       P+  ++ +        S  L D E              D +  LP V
Sbjct: 88  RGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAV 147

Query: 725 IA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 779
           IA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G +  K 
Sbjct: 148 IACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQ 201

Query: 780 AS 781
           AS
Sbjct: 202 AS 203

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 730 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 789
           P+ K  ++  L ++  + A  GDG+NDS +L ++++GI++  N SD+  DA+ IV+ D +
Sbjct: 638 PEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHS 696

Query: 790 FA----SILNAVEEGRRMSDNIQ 808
            A     IL A++  R   + ++
Sbjct: 697 SAPPLTRILYAIDLARATFNRVK 719

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 109 VSIGAYQEYNA-CKTMNSLKDL--STPSARVIR-NGEDVVMASAQVVPGDIVQVRVGDTV 164
           + +G   E  A  +  +SL  +  S PS   IR +G D  +    +  GD+V +R G  +
Sbjct: 225 ICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKL 284

Query: 165 PADLRLVEALNLETDEALLTGEALPVAKDPAA 196
           PAD  ++E    E DE+L+TGE+  V K P +
Sbjct: 285 PADGTVLEG-EAEVDESLMTGESTLVPKYPGS 315

>Scas_669.3
          Length = 1638

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 59/131 (45%), Gaps = 21/131 (16%)

Query: 584  DDLEIIQKNV---DTLSNEGLRVLAFATKTIPAEEAESLGER-------LTKDR------ 627
            +D  +I+K +   D  S EGLR L ++ K +  +E +   +R       LT  +      
Sbjct: 987  NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV 1046

Query: 628  -DFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILP 686
             + +E DL   G   I D  +   + A++K  RAGI + MLTGD   TA  I     +  
Sbjct: 1047 GEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKL-- 1104

Query: 687  HNLYHYPKEVV 697
              +Y Y   V+
Sbjct: 1105 --IYDYSTVVI 1113

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM--------STRNVIV--RRLDSLEALGAVNDICSDKTG 374
           ++IP SL V + I  +  +K+M        S  N     R    LE LG V+ + SDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 375 TLTQGKMILKQL 386
           TLT  KMI ++ 
Sbjct: 556 TLTDNKMIFRKF 567

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 90/236 (38%), Gaps = 63/236 (26%)

Query: 593  VDTLSNEGLRVLAFATKTIPAEEAESLGERLTK------DRDF--------VESDLIFQG 638
            +D  S EGLR L +A K I   + E+  +R  +      DR          +E  L   G
Sbjct: 1025 IDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLG 1084

Query: 639  LVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD 698
            +  I D  +   + A++K  RAGI + MLTGD   TA  I     ++        K+   
Sbjct: 1085 VTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLI--------KDYST 1136

Query: 699  IMVMTATQFDSLT-----DEELDQLPVLPLVI---------------------------- 725
            ++++T T  + ++      +E+D   +   V+                            
Sbjct: 1137 VVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTD 1196

Query: 726  ----ARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGSD 775
                 R +P  K  M+  +   +        GDG ND   ++ A++G+  GI G +
Sbjct: 1197 SVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGV--GIAGKE 1250

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 325 SMIPSSLVVVLTITMSAGAKVM----------STRNVIVRRLDSLEALGAVNDICSDKTG 374
           ++IP SL V + I     +K+M          +      R    LE LG V+ I SDKTG
Sbjct: 510 TVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTG 569

Query: 375 TLTQGKMILKQL 386
           TLT  KMI ++ 
Sbjct: 570 TLTDNKMIFRKF 581

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 72/177 (40%), Gaps = 28/177 (15%)

Query: 531  FDSSIKRMSA-VYINLRDKNTRH---VFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
            F+S+ KRMS  V I   D+N++    +  KGA   +     R + DP            L
Sbjct: 849  FNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDPKL----------L 898

Query: 587  EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVES 632
            E    +++  + EGLR L  A + I  +E  +  ER              L +  D +E 
Sbjct: 899  ERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADAIER 958

Query: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689
             L+  G   I D  +     ++     AGI + +LTGD   TA  I     +L  ++
Sbjct: 959  QLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDM 1015

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 73/177 (41%), Gaps = 27/177 (15%)

Query: 531  FDSSIKRMSA-VYINLRDKNTRH---VFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
            F+SS KRMS  V I   D N +    +  KGA   +       +LD  TG+     E  L
Sbjct: 849  FNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYS-----RLDK-TGLNE---ESLL 899

Query: 587  EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLG--------------ERLTKDRDFVES 632
            E    +++  + EGLR L  A + +  EE E                 E L K  D +E 
Sbjct: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959

Query: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689
             LI  G   I D  +     ++     AGI + +LTGD   TA  I     +L +++
Sbjct: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1016

>YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine
           phosphatase, involved in synthesis of serine from
           3-phosphoglycerate [930 bp, 309 aa]
          Length = 309

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 28/168 (16%)

Query: 614 EEAESLGER-LTKDRDFVES----DLIFQGLV--GIYDPPRVE---TAGAVKKC---HRA 660
           E+   + ER +  + DF ES      + QGL    +YD  + +   T G  + C   H+ 
Sbjct: 119 EQVHEITERAMNNELDFKESLRERVKLLQGLQVDTLYDEIKQKLEVTKGVPELCKFLHKK 178

Query: 661 GINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPV 720
              + +L+G F   A  I  ++G+             D       + D  TD +L    +
Sbjct: 179 NCKLAVLSGGFIQFAGFIKDQLGL-------------DFCKANLLEVD--TDGKLTGKTL 223

Query: 721 LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
            P+V  +C  +T +++ +  +   +   M GDG ND P++  A  GIA
Sbjct: 224 GPIVDGQCKSETLLQLCNDYNVPVEASCMVGDGGNDLPAMATAGFGIA 271

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 75/181 (41%), Gaps = 36/181 (19%)

Query: 531  FDSSIKRMSAVYINL-----RDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDD 585
            F+SS KRMS + I +     +D+    +  KGA   +     R             T++D
Sbjct: 887  FNSSRKRMSCI-IKIPGSTPKDEPKALLICKGADSVIYSRLDR-------------TQND 932

Query: 586  LEIIQK---NVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGERLTKDRD 628
              +++K   +++  + EGLR L  A + +   E E              +  E L K  D
Sbjct: 933  ATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTD 992

Query: 629  FVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHN 688
             +E +LI  G   I D  +     ++     AGI + +LTGD   TA  I     +L ++
Sbjct: 993  VIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNND 1052

Query: 689  L 689
            +
Sbjct: 1053 M 1053

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 107/288 (37%), Gaps = 65/288 (22%)

Query: 153 GDIVQVRVGDTVPADLRL-----------VEALNLETDEALLTGEALPVAK--------- 192
           GDIV+V   D +PAD+ L           VE  NL+ +  L   ++L  +K         
Sbjct: 449 GDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDIT 508

Query: 193 ---------DPAAVFE--------QDTPVGDRLN-------LAFASSTVSKGR-ATGIVV 227
                     P A           QDT  G+  N       L     T+   + A G+V+
Sbjct: 509 RTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVI 568

Query: 228 RTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRXXXX 287
            TG  ++I   A     K+S ISR+ N S + N VL     +  F    V    ++    
Sbjct: 569 FTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLF---ILCFTAGIVNGVYYKQKPR 625

Query: 288 XXXXXXXXXXXXXXXXMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMS 347
                                F V       A+ +  S++P SL + + I  +A A  + 
Sbjct: 626 SRDYFEFGTIGGSASTNGFVSFWV-------AVILYQSLVPISLYISVEIIKTAQAIFIY 678

Query: 348 TRNVIVR-RLDS---------LEALGAVNDICSDKTGTLTQGKMILKQ 385
           T  ++   +LD           + LG +  I SDKTGTLTQ  M  K+
Sbjct: 679 TDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 726

>Scas_636.16
          Length = 1554

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 68/174 (39%), Gaps = 28/174 (16%)

Query: 531 FDSSIKRMSAVYINL-----RDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDD 585
           F+SS KRMS + + L     +D+    +  KGA   +    +R    PG        E  
Sbjct: 821 FNSSRKRMSCI-VKLPPATEKDEPRALLICKGADSVIYSRLSR---KPGYN-----DETL 871

Query: 586 LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVE 631
           LE    +++  + EGLR L    + I   E +   E+              L    D +E
Sbjct: 872 LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931

Query: 632 SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL 685
            DL+  G   I D  +     ++     AGI + +LTGD   TA  I     +L
Sbjct: 932 RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 985

>Scas_505.4
          Length = 1025

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 130/346 (37%), Gaps = 62/346 (17%)

Query: 723  LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780
            +V  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 589  VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

Query: 781  SDIVLSDDNFASILNAVEEG---RRMSDNIQKFXXXXXXXXXXXXIYLMLGLTFLDEDKL 837
             DI +    F   L  V      +R+S  I  +             + +    F  +  +
Sbjct: 649  -DIAVGQFRFLKKLLLVHGSWSYQRISVAIL-YSFYKNTALYMTQFWFVFANAFSGQSIM 706

Query: 838  SVFPLSPVEVLWIIVVTSCLPAMGLGL--EKAAPDIMEKPPNDSKAG----IFTWEVIVD 891
              + +S   V + +      P   +G+  +  +  ++E+ P   K G     F+  +   
Sbjct: 707  ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761

Query: 892  MIVYGLVM-AVCCLGCFVSIIYKDG-----HGNLGTNCN---VEYSDSCKSVFSGRAATF 942
             IV G    AV  +G    + Y+ G     HG +  + +     Y+ S   V  G+AA  
Sbjct: 762  WIVNGFYHSAVVYIGTM--LFYRYGMALNMHGEVADHWSWGIAVYTSSILIVL-GKAA-L 817

Query: 943  ATMTWCALILAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFG-FTSVFPV 1001
             T  W    L           FA+                   F+FW + F  + SVFP 
Sbjct: 818  VTNQWTKFTL-----------FAI----------------PGSFIFWMIFFPIYASVFPY 850

Query: 1002 VYIPVINTKVFLH-IGIGYEWGIAFAFSLVFWLVAEF-WKFAKRRY 1045
              I      V  H  G G  W +      VF L+ +F WK+ +R Y
Sbjct: 851  ANISREYFGVVKHTYGSGTFW-LTLIVLPVFALMRDFVWKYYRRMY 895

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 71/177 (40%), Gaps = 26/177 (14%)

Query: 531  FDSSIKRMSAVY----INLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
            F+SS KRMS +     +N  D+    +  KGA   +    +R     G+      +E  L
Sbjct: 842  FNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSR---QSGSN-----SEAIL 893

Query: 587  EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVES 632
            E    +++  + EGLR L  A + +   E E   E+              L    D +E 
Sbjct: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953

Query: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689
            +LI  G   I D  +      ++    AGI + +LTGD   TA  I     +L + +
Sbjct: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEM 1010

>CAGL0B03245g 316192..317667 highly similar to sp|P38353 Saccharomyces
            cerevisiae YBR283c SSH1, hypothetical start
          Length = 491

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 952  LAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIP 1005
            +A ++ID+ R+F  + PE + P+ ++  D      +F ++I+ F   FP+V +P
Sbjct: 1    MAIKLIDLARTFLPLLPEVEVPFEKITFDDKVVYTIFSALIYLFAQ-FPLVGLP 53

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 583  EDDLEIIQK---NVDTLSNEGLRVLAFATKTIPAEE-----------AESLG---ERLTK 625
            E+D  +++K   +++  + EGLR L  A + +   E           A SL    E+L  
Sbjct: 883  ENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEI 942

Query: 626  DRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL 685
              D +E DLI  G   I D  +     ++     AGI + +LTGD   TA  I     +L
Sbjct: 943  VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 1002

Query: 686  PHNL 689
             +++
Sbjct: 1003 NNDM 1006

>Sklu_786.1 YGR208W, Contig c786 410-1348
          Length = 312

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 49/119 (41%), Gaps = 20/119 (16%)

Query: 655 KKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDI----MVMTATQFDSL 710
           K   R G  + +L+G F   A               +Y KE++ +        AT+ D  
Sbjct: 170 KGLGRTGCKLAVLSGGFTPFA---------------NYMKEILHLDYARANFLATEIDPT 214

Query: 711 TDEE-LDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 768
           T EE L    +  +V  +C  +T +++        +   M GDG ND P++  A  GIA
Sbjct: 215 TGEEVLSGHTIGDIVDGQCKAKTLLQLAKEYDVPVESTVMVGDGGNDLPAMGVAGFGIA 273

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 14/118 (11%)

Query: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVE 631
            LE    +++  + EGLR L  A + +  +E +   E+              + K  D +E
Sbjct: 935  LEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIE 994

Query: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689
             +L   G   I D  +     ++     AGI + +LTGD   TA  I     +L + +
Sbjct: 995  RELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEM 1052

>YGR276C (RNH70) [2221] chr7 complement(1043824..1045485)
           Ribonuclease H (70 kDa), endonuclease that degrades RNA
           in RNA-DNA hybrids [1662 bp, 553 aa]
          Length = 553

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 518 DAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRH 552
           D A IY H A  PF  S+K +S  ++N   +N  H
Sbjct: 326 DTAIIYHHKAGDPFKPSLKYLSETFLNKSIQNGEH 360

>Scas_576.8
          Length = 1591

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 71/177 (40%), Gaps = 26/177 (14%)

Query: 531  FDSSIKRMSAVY----INLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586
            F+S+ KRMS +      N  D+    +  KGA   +       +L    G     +E+ L
Sbjct: 858  FNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYS-----RLGTKNGAN---SENLL 909

Query: 587  EIIQKNVDTLSNEGLRVLAFATKT--------------IPAEEAESLGERLTKDRDFVES 632
            E    +++  + EGLR L  A +               I A    +  E+L    D +E 
Sbjct: 910  EKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIER 969

Query: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689
            +L   G   I D  +     ++    +AGI + +LTGD   TA  I     +L +++
Sbjct: 970  ELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1026

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of
           the ATP-binding cassette (ABC) superfamily [4779 bp,
           1592 aa]
          Length = 1592

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 845 VEVLWIIV--VTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVC 902
           + +LW++V  + + LP +   L K   +I++ P   S      W  I+ M +  L +A+C
Sbjct: 340 IGMLWVLVNSIVNLLPTI---LMKRFLEIVDNPNRSSSCMNLAWLYIIGMFICRLTLAIC 396

Query: 903 -CLGCFVS 909
              G FVS
Sbjct: 397 NSQGQFVS 404

>YJR089W (BIR1) [2980] chr10 (587632..590496) Protein involved in
           chromosome segregation, contains a BIR domain that is
           common to inhibitors of apoptosis [2865 bp, 954 aa]
          Length = 954

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 554 FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPA 613
           F +G  E+       +K+D    +      D L+ I  N  TL+N+    LAF  K +PA
Sbjct: 832 FNEGNNEKEPNAAEWFKIDENRHLVKNYFHDLLKYINNNDATLANDKDGDLAFLIKQMPA 891

Query: 614 EE 615
           EE
Sbjct: 892 EE 893

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 31,799,800
Number of extensions: 1305226
Number of successful extensions: 3388
Number of sequences better than 10.0: 89
Number of HSP's gapped: 3317
Number of HSP's successfully gapped: 206
Length of query: 1076
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 964
Effective length of database: 12,718,893
Effective search space: 12261012852
Effective search space used: 12261012852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)