Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGL047C31631014560.0
Sklu_2363.232330910111e-138
CAGL0J01661g3273109731e-132
YPR011C3263119501e-129
Kwal_14.22103152809311e-126
KLLA0D04290g1881645982e-77
KLLA0D04312g103843381e-39
Scas_717.203563123484e-38
YHR002W (LEU5)3573083422e-37
CAGL0K02915g3423073282e-35
AGL065C3353023132e-33
Sklu_2374.75133093047e-31
KLLA0E18788g3813252962e-30
CAGL0J05522g5193082905e-29
YNL083W5453092906e-29
AER419W4933112862e-28
YBR085W (AAC3)3072802764e-28
Kwal_26.79723583032784e-28
Kwal_23.30425423092801e-27
Scas_578.3*5243072801e-27
KLLA0C11363g5173112792e-27
KLLA0E12353g3052802677e-27
YBL030C (PET9)3182802652e-26
CAGL0F04213g3062802623e-26
KLLA0D15015g3172912581e-25
AER184W3052822581e-25
Kwal_27.124813042802562e-25
YMR056C (AAC1)3092822562e-25
Scas_718.243372812582e-25
Scas_667.43082802528e-25
YIL006W3732872488e-24
YEL006W3352912337e-22
Scas_709.93652892311e-21
ADL009W3792892214e-20
CAGL0J02002g3612912205e-20
Kwal_55.208683802932198e-20
YPR021C (AGC1)9022902201e-19
Kwal_23.39653073002132e-19
Scas_602.88852852165e-19
KLLA0E13453g9062852042e-17
Sklu_2359.69022862032e-17
AAR036W3172881983e-17
YKR052C (MRS4)3042851964e-17
Kwal_23.47313142941965e-17
ACR260W3112891958e-17
CAGL0M09020g3482601968e-17
KLLA0E15532g3262601941e-16
Scas_716.293162951941e-16
CAGL0G08910g2892861921e-16
KLLA0D14036g4313181942e-16
ADL049W9122841953e-16
Sklu_2037.23102961903e-16
CAGL0M05225g3812701915e-16
Sklu_2334.23192831886e-16
CAGL0K02365g9192841926e-16
YJL133W (MRS3)3142851887e-16
CAGL0K08250g2972841869e-16
Sklu_2431.53702641881e-15
Kwal_33.140503142891852e-15
YGR257C (MTM1)3662751852e-15
KLLA0E23705g3682671853e-15
YGR096W (TPC1)3142971833e-15
Kwal_27.120813692671844e-15
Scas_645.93912821835e-15
AEL253W3652941826e-15
Kwal_47.173218812851838e-15
Scas_582.73292831791e-14
AER366W2931411772e-14
Scas_721.273742651782e-14
AGL311C3623171772e-14
YJR095W (SFC1)3222841763e-14
KLLA0F04697g3071461754e-14
Scas_667.223062831744e-14
CAGL0G03135g3072961728e-14
Scas_691.43342951692e-13
Scas_379.23012821673e-13
CAGL0D01606g3052791665e-13
Kwal_47.182163333061632e-12
KLLA0E08877g2942991612e-12
AFR131C3442701622e-12
ADL264C3291711612e-12
AFL196W3612621613e-12
Sklu_1926.23052841603e-12
CAGL0B04543g3171721595e-12
YBR192W (RIM2)3772651605e-12
AFR146W2811761585e-12
KLLA0C13431g3281821561e-11
CAGL0F08305g3742781561e-11
YIL134W (FLX1)3112981551e-11
YMR166C3681671552e-11
CAGL0F07711g3681671552e-11
YOR222W (ODC2)3071621542e-11
Scas_718.53242951542e-11
Scas_662.123082931533e-11
KLLA0F03212g3052821524e-11
Scas_589.103161621514e-11
CAGL0L05742g3052901515e-11
KLLA0E18810g3771471525e-11
Scas_640.253062871507e-11
Scas_558.22891791499e-11
YPR128C (ANT1)3282881499e-11
YPR058W (YMC1)3072831481e-10
Kwal_26.86692962801471e-10
CAGL0F00231g3072841462e-10
Scas_328.12271701423e-10
Kwal_27.125993042801443e-10
Kwal_23.35293951781454e-10
CAGL0L02079g2971361444e-10
KLLA0B08503g3032681444e-10
YBR291C (CTP1)2991491434e-10
Sklu_1149.22961351426e-10
Kwal_26.79672971371418e-10
AGR383W2931561401e-09
Sklu_2398.43092711401e-09
YNL003C (PET8)2841831382e-09
Kwal_23.43543432761392e-09
YOR100C (CRC1)3271841392e-09
Kwal_33.129883032791373e-09
CAGL0K12210g3112841373e-09
Kwal_26.76533251851373e-09
CAGL0H10538g2971541363e-09
Scas_697.473281761364e-09
KLLA0B12826g3191861355e-09
CAGL0H03839g2822841355e-09
YOR130C (ORT1)2922951346e-09
YKL120W (OAC1)3242781339e-09
Sklu_2115.42992981321e-08
AAL014C2711821311e-08
Scas_669.63731391331e-08
ACR109W2992771321e-08
Kwal_0.2322741821311e-08
Sklu_2432.52881771312e-08
Sklu_1119.13072901312e-08
Kwal_55.213383232821302e-08
Scas_489.42971781293e-08
KLLA0A09383g3662861303e-08
YJR077C (MIR1)3112821293e-08
Sklu_2430.103242781294e-08
Kwal_33.155973052901284e-08
KLLA0E02772g2841871275e-08
Kwal_56.230113032751268e-08
Scas_632.92922871259e-08
KLLA0F17864g3072811259e-08
KLLA0D04950g2741791241e-07
Sklu_2435.23442551251e-07
Scas_673.173142821242e-07
KLLA0D09889g3641391232e-07
Sklu_1275.13112791223e-07
KLLA0D07073g2972771213e-07
CAGL0K11616g3202731213e-07
YBR104W (YMC2)3291801213e-07
Kwal_23.29133201711213e-07
Sklu_2442.82751791204e-07
Kwal_55.213353171741204e-07
Sklu_2127.52781821195e-07
Scas_721.1293231851205e-07
CAGL0K10362g3011901179e-07
KLLA0E02750g3042511152e-06
Scas_715.453052921133e-06
YLR348C (DIC1)2982781115e-06
ABL023W3092811091e-05
Kwal_27.114192983011091e-05
CAGL0J04114g3031601081e-05
CAGL0D04774g322811063e-05
YER053C3001541053e-05
AFR147C3152561054e-05
Scas_714.183051571044e-05
Kwal_33.154463052751045e-05
Kwal_47.192282811401036e-05
AER450C3082921028e-05
Scas_562.123001831019e-05
Sklu_2075.33451801029e-05
KLLA0E09680g3071811011e-04
CAGL0C02013g329146992e-04
YPL134C (ODC1)310286992e-04
CAGL0J09790g300182982e-04
ADR036C340227983e-04
Sklu_2433.8420173983e-04
AGL064W296124973e-04
KLLA0B14454g305282973e-04
Sklu_2117.2298178948e-04
AFR253W344135940.001
CAGL0G01166g295274920.001
Scas_687.15*328130920.002
Kwal_55.21106328300890.003
Sklu_2260.5302287880.004
KLLA0F13464g300178880.004
YDL198C (YHM1)300183880.004
KLLA0B11319g355249880.005
Kwal_23.5757307287850.009
Scas_705.932385850.011
CAGL0B03883g306187840.012
YDL119C307130840.014
Scas_702.1030280830.016
YFR045W285162790.053
Kwal_27.11626299132780.078
Scas_613.24177179750.12
AFR542W310145760.15
KLLA0A00979g343132750.21
CAGL0K07436g307133740.22
AGR191W298138740.23
Scas_671.1*123102670.72
YMR241W (YHM2)314134700.85
Kwal_34.15907312142681.2
Scas_696.9312135681.4
Sklu_2127.4323101644.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL047C
         (310 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...   565   0.0  
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         394   e-138
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   379   e-132
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   370   e-129
Kwal_14.2210                                                          363   e-126
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...   234   2e-77
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...   134   1e-39
Scas_717.20                                                           138   4e-38
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...   136   2e-37
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...   130   2e-35
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...   125   2e-33
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement      121   7e-31
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...   118   2e-30
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...   116   5e-29
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...   116   6e-29
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...   114   2e-28
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...   110   4e-28
Kwal_26.7972                                                          111   4e-28
Kwal_23.3042                                                          112   1e-27
Scas_578.3*                                                           112   1e-27
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...   112   2e-27
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...   107   7e-27
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...   106   2e-26
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...   105   3e-26
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   103   1e-25
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...   103   1e-25
Kwal_27.12481                                                         103   2e-25
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...   103   2e-25
Scas_718.24                                                           103   2e-25
Scas_667.4                                                            101   8e-25
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...   100   8e-24
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    94   7e-22
Scas_709.9                                                             94   1e-21
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    90   4e-20
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    89   5e-20
Kwal_55.20868                                                          89   8e-20
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    89   1e-19
Kwal_23.3965                                                           87   2e-19
Scas_602.8                                                             88   5e-19
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    83   2e-17
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          83   2e-17
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    81   3e-17
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    80   4e-17
Kwal_23.4731                                                           80   5e-17
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    80   8e-17
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    80   8e-17
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    79   1e-16
Scas_716.29                                                            79   1e-16
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    79   1e-16
KLLA0D14036g complement(1203522..1204817) some similarities with...    79   2e-16
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    80   3e-16
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         78   3e-16
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    78   5e-16
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         77   6e-16
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    79   6e-16
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    77   7e-16
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    76   9e-16
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            77   1e-15
Kwal_33.14050                                                          76   2e-15
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    76   2e-15
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    76   3e-15
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    75   3e-15
Kwal_27.12081                                                          75   4e-15
Scas_645.9                                                             75   5e-15
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    75   6e-15
Kwal_47.17321                                                          75   8e-15
Scas_582.7                                                             74   1e-14
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    73   2e-14
Scas_721.27                                                            73   2e-14
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    73   2e-14
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    72   3e-14
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    72   4e-14
Scas_667.22                                                            72   4e-14
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    71   8e-14
Scas_691.4                                                             70   2e-13
Scas_379.2                                                             69   3e-13
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    69   5e-13
Kwal_47.18216                                                          67   2e-12
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    67   2e-12
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    67   2e-12
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    67   2e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    67   3e-12
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          66   3e-12
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    66   5e-12
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    66   5e-12
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    65   5e-12
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    65   1e-11
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    65   1e-11
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    64   1e-11
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    64   2e-11
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    64   2e-11
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    64   2e-11
Scas_718.5                                                             64   2e-11
Scas_662.12                                                            64   3e-11
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    63   4e-11
Scas_589.10                                                            63   4e-11
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    63   5e-11
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    63   5e-11
Scas_640.25                                                            62   7e-11
Scas_558.2                                                             62   9e-11
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    62   9e-11
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    62   1e-10
Kwal_26.8669                                                           61   1e-10
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    61   2e-10
Scas_328.1                                                             59   3e-10
Kwal_27.12599                                                          60   3e-10
Kwal_23.3529                                                           60   4e-10
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    60   4e-10
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    60   4e-10
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    60   4e-10
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         59   6e-10
Kwal_26.7967                                                           59   8e-10
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    59   1e-09
Sklu_2398.4 , Contig c2398 9476-10405                                  59   1e-09
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    58   2e-09
Kwal_23.4354                                                           58   2e-09
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    58   2e-09
Kwal_33.12988                                                          57   3e-09
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    57   3e-09
Kwal_26.7653                                                           57   3e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    57   3e-09
Scas_697.47                                                            57   4e-09
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    57   5e-09
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    57   5e-09
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    56   6e-09
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    56   9e-09
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            55   1e-08
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    55   1e-08
Scas_669.6                                                             56   1e-08
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    55   1e-08
Kwal_0.232                                                             55   1e-08
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       55   2e-08
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             55   2e-08
Kwal_55.21338                                                          55   2e-08
Scas_489.4                                                             54   3e-08
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    55   3e-08
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    54   3e-08
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         54   4e-08
Kwal_33.15597                                                          54   4e-08
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    54   5e-08
Kwal_56.23011                                                          53   8e-08
Scas_632.9                                                             53   9e-08
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    53   9e-08
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    52   1e-07
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         53   1e-07
Scas_673.17                                                            52   2e-07
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    52   2e-07
Sklu_1275.1 , Contig c1275 314-1249                                    52   3e-07
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    51   3e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    51   3e-07
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    51   3e-07
Kwal_23.2913                                                           51   3e-07
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          51   4e-07
Kwal_55.21335                                                          51   4e-07
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         50   5e-07
Scas_721.129                                                           51   5e-07
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    50   9e-07
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    49   2e-06
Scas_715.45                                                            48   3e-06
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    47   5e-06
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    47   1e-05
Kwal_27.11419                                                          47   1e-05
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    46   1e-05
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    45   3e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    45   3e-05
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    45   4e-05
Scas_714.18                                                            45   4e-05
Kwal_33.15446                                                          45   5e-05
Kwal_47.19228                                                          44   6e-05
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    44   8e-05
Scas_562.12                                                            44   9e-05
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                44   9e-05
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    44   1e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    43   2e-04
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    43   2e-04
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    42   2e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    42   3e-04
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       42   3e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    42   3e-04
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    42   3e-04
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            41   8e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    41   0.001
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    40   0.001
Scas_687.15*                                                           40   0.002
Kwal_55.21106                                                          39   0.003
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         39   0.004
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    39   0.004
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    39   0.004
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    39   0.005
Kwal_23.5757                                                           37   0.009
Scas_705.9                                                             37   0.011
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    37   0.012
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    37   0.014
Scas_702.10                                                            37   0.016
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    35   0.053
Kwal_27.11626                                                          35   0.078
Scas_613.24                                                            33   0.12 
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    34   0.15 
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    33   0.21 
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    33   0.22 
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    33   0.23 
Scas_671.1*                                                            30   0.72 
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    32   0.85 
Kwal_34.15907                                                          31   1.2  
Scas_696.9                                                             31   1.4  
Sklu_2127.4 , Contig c2127 6322-7293                                   29   4.0  

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/310 (90%), Positives = 282/310 (90%)

Query: 1   MGQPENYIQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQVQSSTTAYNGGLVHA 60
           MGQPENYIQTVYKND              SRTVVSPVERVKILLQVQSSTTAYNGGLVHA
Sbjct: 1   MGQPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHA 60

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXX 120
           VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWER  
Sbjct: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLV 120

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG 180
                       TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG
Sbjct: 121 GGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG 180

Query: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTV 240
           LRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTV
Sbjct: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTV 240

Query: 241 VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300
           VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA
Sbjct: 241 VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300

Query: 301 VQWFVYELIS 310
           VQWFVYELIS
Sbjct: 301 VQWFVYELIS 310

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 232/309 (75%), Gaps = 2/309 (0%)

Query: 3   QPENYIQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVK 62
           QP +Y++++ KND              SRTVVSP ERVKILLQVQ+STTAYN G+V AV+
Sbjct: 10  QP-SYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVR 68

Query: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXX 121
           QVY+EEG  GLFRGNG+NC+RIFPYSAVQ+ VYE CK   FHV G  G EQL++W+R   
Sbjct: 69  QVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFS 128

Query: 122 XXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGL 181
                      TYPLDLVRTRLSIQTANL KL +S+AH+I +PPG+ +LL R ++EEGG+
Sbjct: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188

Query: 182 RGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVV 241
           +G YRGV+PTSLGVVP+VALNFA+YE+ K  +P   D       KL+IGA+SGG+AQTV 
Sbjct: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVT 248

Query: 242 YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
           YPFDLLRRRFQVL MG +ELGFRY SV DAL TIG+ EG RGYYKGLTANL KV+P+ AV
Sbjct: 249 YPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308

Query: 302 QWFVYELIS 310
            W VYE++ 
Sbjct: 309 SWLVYEVVC 317

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  379 bits (973), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 226/310 (72%), Gaps = 4/310 (1%)

Query: 3   QPENYIQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVK 62
           + EN ++   K D              SRTVVSP ERVKILLQVQSSTTAYN GL  A+ 
Sbjct: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69

Query: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGH-EQLRSWERXXX 121
           QVYKEE +KGLFRGNG+NC+R+FPYSAVQ+ V+E CK  +FHV   G  EQL +W+R   
Sbjct: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFS 129

Query: 122 XXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGL 181
                      TYPLDLVRTRLS+QTANL+KL +S+A DI +PPG+ +LL + + EEGG+
Sbjct: 130 GALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGI 189

Query: 182 RGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSV---AAAKLAIGAVSGGIAQ 238
            G YRGV+PTSLG+VP+VALNFA+YE+LK  +P D +  S    +  KL++GA+SGG+AQ
Sbjct: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQ 249

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           T+ YPFDLLRRRFQVL MG +ELGF Y SV DAL TIG+ EG +GYYKGLTANL KVVP+
Sbjct: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309

Query: 299 MAVQWFVYEL 308
            AV W VYEL
Sbjct: 310 TAVSWLVYEL 319

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  370 bits (950), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/311 (60%), Positives = 225/311 (72%), Gaps = 5/311 (1%)

Query: 3   QPENYIQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVK 62
           QP N I+   K D              SRTVVSP ERVKILLQVQSSTT+YN G+  +++
Sbjct: 10  QP-NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68

Query: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXX 121
           QVY EEG KGLFRGNG+NC+RIFPYSAVQ+ VYE CK ++FHV G +G EQL + +R   
Sbjct: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128

Query: 122 XXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGL 181
                      TYPLDL++TRLSIQTANL+ L+RSKA  I +PPGI +LL   +R EGGL
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 182 RGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAA---KLAIGAVSGGIAQ 238
           RG YRGV+PTSLGVVP+VALNFA+YE+L+    +  DA     +   KL IGA+SGG+AQ
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQ 248

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           T+ YPFDLLRRRFQVL MG +ELGFRY SV DAL TIGR EG+ GYYKGL ANL KVVP+
Sbjct: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308

Query: 299 MAVQWFVYELI 309
            AV W VYE++
Sbjct: 309 TAVSWLVYEVV 319

>Kwal_14.2210
          Length = 315

 Score =  363 bits (931), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/280 (65%), Positives = 215/280 (76%), Gaps = 2/280 (0%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           SRTVVSP ERVKILLQVQSST AYN GL  AVKQVY EEGV GL RGNG+NC+RIFPYSA
Sbjct: 31  SRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCIRIFPYSA 90

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           VQ+ VYEFCK + F   Q+    + +W R              TYPLDLVRTRLSIQTAN
Sbjct: 91  VQFLVYEFCKKQWFQ--QNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTAN 148

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
           LA+LH++KA    +PPG+ ELLR+ + +EGG+ G YRGV+PTS+GVVP+VALNFA+YE+L
Sbjct: 149 LARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQL 208

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
           +  IP  +D  S +  KL+IGA+SGG+AQT+ YPFDLLRRRFQVL MGQSELGF Y SV 
Sbjct: 209 REYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVP 268

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           DAL TIGR EG +GYYKGLTANL KVVP+ AV W VYE +
Sbjct: 269 DALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 82/187 (43%), Gaps = 23/187 (12%)

Query: 36  PVERVKILLQVQSSTTA-----------YNGGLVHAVKQVYKEEG-VKGLFRGNGINCLR 83
           P++ V+  L +Q++  A              G+   +++ Y +EG + GL+RG     + 
Sbjct: 134 PLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIG 193

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
           + PY A+ +AVYE  +    ++  S      S  +              TYP DL+R R 
Sbjct: 194 VVPYVALNFAVYEQLRE---YIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRF 250

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
            +     ++L     H    P  ++     I R EG  +G+Y+G+      VVP  A+++
Sbjct: 251 QVLAMGQSEL---GFHYKSVPDALIT----IGRTEG-FKGYYKGLTANLFKVVPSTAVSW 302

Query: 204 ALYERLK 210
            +YE ++
Sbjct: 303 VVYETVR 309

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           S A      G ++G +++TVV PF+    R ++L   QS        +  A+  +  +EG
Sbjct: 15  SDAGIAFCAGGIAGAVSRTVVSPFE----RVKILLQVQSSTHAYNHGLFRAVKQVYLEEG 70

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           + G  +G   N +++ P  AVQ+ VYE 
Sbjct: 71  VPGLLRGNGLNCIRIFPYSAVQFLVYEF 98

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score =  234 bits (598), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 113/164 (68%), Positives = 131/164 (79%), Gaps = 1/164 (0%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           SRTVVSP ERVKILLQVQSST+AYN G+++AV QVYKEEGV GLFRGNG+NC+RIFPYSA
Sbjct: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84

Query: 90  VQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
           VQ+ VYE+CK  +FHV G  G EQL +W+R              TYPLDLVRTRLSIQTA
Sbjct: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           NLAKL +SKA DI +PPG+ ELL + F+EEGG+RG YRG+YPTS
Sbjct: 145 NLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPTS 188

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 24/166 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P + V+  L +Q++  A  H           GI+  + ++++EEG + G +RG     + 
Sbjct: 31  PFERVKILLQVQSSTSAYNH-----------GIINAVGQVYKEEG-VAGLFRGNGLNCVR 78

Query: 195 VVPFVALNFALYERLKALIPH-DYDAGS---VAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
           + P+ A+ F +YE  K  I H D   G    +   +L+ GA+ GG++    YP DL+R R
Sbjct: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138

Query: 251 FQVLTMGQSELGFRYA---SVADALW-----TIGRQEGLRGYYKGL 288
             + T   ++L    A   +    +W     T   + G+RG Y+G+
Sbjct: 139 LSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 4/78 (5%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G V+G +++TVV PF+    R ++L   QS        + +A+  + ++EG+ G ++G  
Sbjct: 18  GGVAGAVSRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 290 ANLVKVVPAMAVQWFVYE 307
            N V++ P  AVQ+ VYE
Sbjct: 74  LNCVRIFPYSAVQFVVYE 91

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score =  134 bits (338), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
           KLA+GA+SGG+AQT+VYPFDLLRRRFQVL MG +ELGFRY SV+DAL TIG+ EG +GYY
Sbjct: 13  KLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYY 72

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
           KGLTANL KV+P+ AV W VYE+I
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYEVI 96

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 59 HAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK 99
           A+  + K EG KG ++G   N  ++ P +AV + VYE  +
Sbjct: 57 DALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIR 97

 Score = 28.1 bits (61), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 10/78 (12%)

Query: 134 YPLDLVRTRLSIQTANLAKL-HRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           YP DL+R R  +      +L  R K+        + + L  I + EG  +G+Y+G+    
Sbjct: 29  YPFDLLRRRFQVLAMGGNELGFRYKS--------VSDALITIGKTEGP-KGYYKGLTANL 79

Query: 193 LGVVPFVALNFALYERLK 210
             V+P  A+++ +YE ++
Sbjct: 80  FKVIPSTAVSWLVYEVIR 97

>Scas_717.20
          Length = 356

 Score =  138 bits (348), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 152/312 (48%), Gaps = 43/312 (13%)

Query: 30  SRTVVSPVERVKILLQVQSST-TAYNGGLV---HAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+++P++R+KIL Q  +   T Y G LV    A K ++  +G++G F+G+ +  +RIF
Sbjct: 46  AKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIF 105

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+AV++  YE  +  +        E    W R              TYPLDL+R RL+ 
Sbjct: 106 PYAAVKFVAYEQIRNTLI----PSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAY 161

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGW-------YRGVYPTSLGVVPF 198
            T +           I + P    L       +G +  W       YRG  PT LG++P+
Sbjct: 162 VTEHKRISLLGLVKTIYKEPASTTL-----EAKGYIPNWFAHWCNFYRGYTPTVLGMIPY 216

Query: 199 VALNFALYERLKALIPHDYDAG-SVAA---------------------AKLAIGAVSGGI 236
             ++F  ++ L  ++ H   A  SV A                     A+L  G ++G  
Sbjct: 217 AGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMA 276

Query: 237 AQTVVYPFDLLRRRFQVLTMGQSEL-GFRYASVADALWTIGRQEGLRGYYKGLTANLVKV 295
           +QT  YPF+++RRR QV T+  S++   R+ S+++    I ++ G RG++ GL+   +KV
Sbjct: 277 SQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKV 336

Query: 296 VPAMAVQWFVYE 307
            P +A  +FVYE
Sbjct: 337 TPMVACSFFVYE 348

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 75/190 (39%), Gaps = 42/190 (22%)

Query: 56  GLVHAVKQVYKEEGVKGL----------------FRGNGINCLRIFPYSAVQYAVYEFCK 99
            L+  VK +YKE     L                +RG     L + PY+ V +  ++   
Sbjct: 169 SLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLH 228

Query: 100 TRVFH----------VGQSGHEQ---------LRSWERXXXXXXXXXXXXXXTYPLDLVR 140
             + H          + +S  E+         LR+W                 YP +++R
Sbjct: 229 DVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIR 288

Query: 141 TRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVA 200
            RL + T ++++++  +   I         + +I  +E G RG++ G+    + V P VA
Sbjct: 289 RRLQVSTLSVSQMYDHRFQSISE-------IAKIIYKERGWRGFFVGLSIGYIKVTPMVA 341

Query: 201 LNFALYERLK 210
            +F +YER+K
Sbjct: 342 CSFFVYERMK 351

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 77/156 (49%), Gaps = 16/156 (10%)

Query: 166 GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK-ALIP-HDYDAGSVA 223
           G+ E  + I+  +G +RG+++G   T + + P+ A+ F  YE+++  LIP  +Y++    
Sbjct: 76  GLKEAAKHIWLNDG-IRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYES---H 131

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQ--SELGFRYASVADALWTIGRQEGL 281
             +L  G+++G  +    YP DL+R R   +T  +  S LG       +   T    +G 
Sbjct: 132 WRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGY 191

Query: 282 --------RGYYKGLTANLVKVVPAMAVQWFVYELI 309
                     +Y+G T  ++ ++P   V +F ++L+
Sbjct: 192 IPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLL 227

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G +SG  A+T++ P D ++  FQ      ++       + +A   I   +G+RG+++G +
Sbjct: 39  GGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHS 98

Query: 290 ANLVKVVPAMAVQWFVYELI 309
             L+++ P  AV++  YE I
Sbjct: 99  VTLMRIFPYAAVKFVAYEQI 118

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score =  136 bits (342), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 153/308 (49%), Gaps = 35/308 (11%)

Query: 30  SRTVVSPVERVKILLQVQSST-TAYNG---GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+++P++R+KIL Q  +   T Y G   GLV A K ++  +GV+G F+G+    LRIF
Sbjct: 47  AKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIF 106

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+AV++  YE  +  +        E    W R              TYPLDLVR RL+ 
Sbjct: 107 PYAAVKFVAYEQIRNTLI----PSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAY 162

Query: 146 QTANL-AKLHRSKAHDIRRPPGIVELLRRIFREEGGLR--GWYRGVYPTSLGVVPFVALN 202
           +T +   KL R     I + P    L++  +          +YRG  PT LG++P+  ++
Sbjct: 163 ETEHKRVKLGRI-IKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVS 221

Query: 203 F----ALYERLKALIPHDYDAGSVAA------------------AKLAIGAVSGGIAQTV 240
           F     L++ LK+     Y    ++                   A+L  G ++G  +QT 
Sbjct: 222 FFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTA 281

Query: 241 VYPFDLLRRRFQVLTMGQSEL-GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299
            YPF+++RRR QV  +    +   ++ S+++    I ++ G+RG++ GL+   +KV P +
Sbjct: 282 AYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMV 341

Query: 300 AVQWFVYE 307
           A  +FVYE
Sbjct: 342 ACSFFVYE 349

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G +SG  A+T++ P D ++  FQ      ++       + +A   I   +G+RG+++G +
Sbjct: 40  GGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHS 99

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A L+++ P  AV++  YE I
Sbjct: 100 ATLLRIFPYAAVKFVAYEQI 119

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 82/213 (38%), Gaps = 44/213 (20%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGI------------- 79
           +  P++ V++ L  ++       G +  +K++YKE     L + + I             
Sbjct: 149 ITYPLDLVRVRLAYETEHKRVKLGRI--IKKIYKEPASATLIKNDYIPNWFCHWCNFYRG 206

Query: 80  ---NCLRIFPYSAVQYAVYE----------FCKTRVFHVGQSGHEQ---------LRSWE 117
                L + PY+ V +  ++          F    V  + +    +         LR+W 
Sbjct: 207 YVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWA 266

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                           YP +++R RL +   +   ++  K   I       E+   IF+E
Sbjct: 267 ELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSIS------EIAHIIFKE 320

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            G +RG++ G+    + V P VA +F +YER+K
Sbjct: 321 RG-VRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score =  130 bits (328), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 151/307 (49%), Gaps = 33/307 (10%)

Query: 30  SRTVVSPVERVKILLQVQSST-TAYNG---GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+++P++R+KIL Q  +   + Y G   GL  A K ++  +G++G F+G+ +  LRIF
Sbjct: 32  AKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIF 91

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+AV++  YE  ++ +        E    W R              TYPLDL R RL+ 
Sbjct: 92  PYAAVKFVAYEQIRSILI----PSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAY 147

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREE--GGLRGWYRGVYPTSLGVVPFVALNF 203
            T +     R     I   P    L   +   +       +YRG  PT LG++P+  ++F
Sbjct: 148 VTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSF 207

Query: 204 ----ALYERLKALIPHDYDAGSVAA------------------AKLAIGAVSGGIAQTVV 241
                +++ +K+ +   Y    +++                  A+L  G +SG ++QT  
Sbjct: 208 FAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAA 267

Query: 242 YPFDLLRRRFQVLTMGQSEL-GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300
           YP +++RRR QV T+   ++   ++ S++     I +++G RG++ GL+   +KV P +A
Sbjct: 268 YPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVA 327

Query: 301 VQWFVYE 307
             +FVYE
Sbjct: 328 CSFFVYE 334

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 91/190 (47%), Gaps = 29/190 (15%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLD  R ++  QT+N    H SK        G+ E  + I+  +G +RG+++G   T L 
Sbjct: 38  PLD--RIKILFQTSNP---HYSKYAG--SLVGLYEAAKHIWINDG-IRGFFQGHSVTLLR 89

Query: 195 VVPFVALNFALYERLKA-LIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ 252
           + P+ A+ F  YE++++ LIP  +Y++      +LA G+++G  +  + YP DL R R  
Sbjct: 90  IFPYAAVKFVAYEQIRSILIPSREYES---HWRRLASGSLAGLCSVFITYPLDLTRVRLA 146

Query: 253 VLTMGQSELGFRYASVADALWTIGRQEGLR-------------GYYKGLTANLVKVVPAM 299
            +T  +     +   +   ++     EGL               +Y+G    ++ ++P  
Sbjct: 147 YVTEHKR---VKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYA 203

Query: 300 AVQWFVYELI 309
            V +F ++LI
Sbjct: 204 GVSFFAHDLI 213

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 76/185 (41%), Gaps = 42/185 (22%)

Query: 61  VKQVYKEEGVKGL----------------FRGNGINCLRIFPYSAVQY----AVYEFCKT 100
           VK +Y E   +GL                +RG     L + PY+ V +     +++  K+
Sbjct: 160 VKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKS 219

Query: 101 RV---FHVGQ-SGHEQL-----------RSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
            +   + V Q S  E+L           R+W                 YPL+++R RL +
Sbjct: 220 SLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQV 279

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
            T +  K++  K   I         + RI  +E G RG++ G+    + V P VA +F +
Sbjct: 280 STLSPRKMYDHKFQSISS-------IARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFV 332

Query: 206 YERLK 210
           YER+K
Sbjct: 333 YERMK 337

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G VSG  A+T++ P D ++  FQ      S+       + +A   I   +G+RG+++G +
Sbjct: 25  GGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHS 84

Query: 290 ANLVKVVPAMAVQWFVYELI 309
             L+++ P  AV++  YE I
Sbjct: 85  VTLLRIFPYAAVKFVAYEQI 104

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score =  125 bits (313), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 147/302 (48%), Gaps = 31/302 (10%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA----YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+V+P++R+KIL Q  +   A      GGLV A K +   +G +G F+G+    LRIF
Sbjct: 33  AKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIF 92

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+A+++  YE  ++ V    +  HE    W R              TYPLDLVR RL+ 
Sbjct: 93  PYAAIKFIAYEQIRSVVIPTWR--HES--HWRRLLSGSLAGLCSVFVTYPLDLVRVRLAY 148

Query: 146 QTA-NLAKLHRSKAHDIRRPPGIVELLRRIFREE--GGLRGWYRGVYPTSLGVVPFVALN 202
            T  + AK+ +  A      P   E LR+ +  +       +YRG  PT +G++P+  ++
Sbjct: 149 VTERHDAKVRKIMACIYNERPS--EALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVS 206

Query: 203 FALYERLKALIPHDY--------DAGSVA---------AAKLAIGAVSGGIAQTVVYPFD 245
           F  ++  + +  H            GS A          A+L  G ++G  +QT  YPF+
Sbjct: 207 FFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFE 266

Query: 246 LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305
           ++RRR QV  +        +  + +    I  + G RG++ GL+   +KV P +A  +F+
Sbjct: 267 IIRRRLQVSAITDPTRR-HFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFI 325

Query: 306 YE 307
           YE
Sbjct: 326 YE 327

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 67/152 (44%), Gaps = 23/152 (15%)

Query: 73  LFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-----------GQSGHEQ---LRSWER 118
            +RG     + + PY+ V +  ++ C+    H            G S +++   L++W +
Sbjct: 188 FYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQ 247

Query: 119 XXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREE 178
                          YP +++R RL +     A    ++ H +    GI E+ + I+  E
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRLQVS----AITDPTRRHFV----GINEIAKIIY-TE 298

Query: 179 GGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           GG RG++ G+    + V P VA +F +YER K
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSFFIYERTK 330

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 80/186 (43%), Gaps = 24/186 (12%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLD ++          A+   S         G+V   + I   +G  RG+++G   T L 
Sbjct: 39  PLDRIKILFQTSNPQFAQFAGSMG-------GLVRASKYIMAHDGP-RGFFQGHSATLLR 90

Query: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL 254
           + P+ A+ F  YE++++++   +   S    +L  G+++G  +  V YP DL+R R   +
Sbjct: 91  IFPYAAIKFIAYEQIRSVVIPTWRHES-HWRRLLSGSLAGLCSVFVTYPLDLVRVRLAYV 149

Query: 255 TMGQSELGFRYASVADALWTIGRQEGLR------------GYYKGLTANLVKVVPAMAVQ 302
           T        +   +   ++     E LR             +Y+G T  ++ ++P   V 
Sbjct: 150 TERHDA---KVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVS 206

Query: 303 WFVYEL 308
           +F ++L
Sbjct: 207 FFAHDL 212

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G ++G  A+T+V P D ++  FQ      ++       +  A   I   +G RG+++G +
Sbjct: 26  GGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHS 85

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A L+++ P  A+++  YE I
Sbjct: 86  ATLLRIFPYAAIKFIAYEQI 105

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA---YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           S+T   P E ++  LQV + T     +  G+    K +Y E G +G F G  I  +++ P
Sbjct: 258 SQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTP 317

Query: 87  YSAVQYAVYEFCK 99
             A  + +YE  K
Sbjct: 318 MVACSFFIYERTK 330

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score =  121 bits (304), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 144/309 (46%), Gaps = 44/309 (14%)

Query: 30  SRTVVSPVERVKILLQVQS--STTAYNGG------------------LVHAVKQVYKEEG 69
           SRT  +P +R+K+ L  ++  S+T  N                    L+ A   +Y++ G
Sbjct: 209 SRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAATTLYRQGG 268

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGH-EQLRSWERXXXXXXXXXX 128
           ++  + GNG+N +++FP SA+++  +E  K  + H+    H  +L  +            
Sbjct: 269 IRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGVV 328

Query: 129 XXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188
                YP+D ++ R+     + A     K +++     ++   R+++R+ GGL+ +YRGV
Sbjct: 329 AQFSVYPIDTLKYRVQCAPLDTA----LKGNEL-----LISTARQMYRD-GGLKLFYRGV 378

Query: 189 YPTSLGVVPFVALNFALYERLKAL----------IPHDYDAGSVAAAKLAIGAVSGGIAQ 238
               +G+ P+ AL+   +  LK            +P D    S     L +GA SG +  
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIV-LPMGAFSGTVGA 437

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           TVVYP +LLR R Q    G       Y    D LW   ++EG +G +KGL  NL KV PA
Sbjct: 438 TVVYPINLLRTRLQA--QGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPA 495

Query: 299 MAVQWFVYE 307
           +++ +  YE
Sbjct: 496 VSISYLCYE 504

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 83/190 (43%), Gaps = 22/190 (11%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q     TA  G   L+   +Q+Y++ G+K  +RG  +  + IFPY+A+ 
Sbjct: 333 VYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALD 392

Query: 92  YAVYEFCKTRVFHVGQSG--------HEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
                F   + +++ +             + ++                 YP++L+RTRL
Sbjct: 393 LGT--FSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRL 450

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
             Q    A  H           G  ++L +  + EG  +G ++G+ P    V P V++++
Sbjct: 451 QAQ-GTYAHPHTYT--------GFRDVLWKTVQREG-YQGLFKGLVPNLAKVCPAVSISY 500

Query: 204 ALYERLKALI 213
             YE  K L+
Sbjct: 501 LCYENFKRLM 510

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 230 GAVSGGIAQTVVYPFD---------------LLRRRFQVLTMG-QSELGFRYASVADALW 273
           G  SG I++T   PFD               LL  + +VL     +++    + +  A  
Sbjct: 202 GGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAAT 261

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           T+ RQ G+R +Y G   N++KV P  A+++  +EL
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFEL 296

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 154/325 (47%), Gaps = 65/325 (20%)

Query: 30  SRTVVSPVERVKILLQVQSST-TAYNG---GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+++P++R+KIL Q  +     Y G   GL++A   ++  + ++G+F+G+    LRIF
Sbjct: 67  AKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIF 126

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+AV++  YE    ++ +V     E    + R              TYPLDL+R RL+ 
Sbjct: 127 PYAAVKFIAYE----QIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAY 182

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG--------LRGW-------YRGVYP 190
            T +         H +R  P    L+++I+ E           +  W       YRG  P
Sbjct: 183 VTEH---------HKVRVWP----LVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIP 229

Query: 191 TSLGVVPFVALNFALYERLKALIPH------------DYDAGSVAA-------------- 224
           T +G++P+  ++F  ++    ++ H            D DA  +                
Sbjct: 230 TVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLN 289

Query: 225 --AKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
             A+L  G ++G  +QT  YPF+++RRR QV  +  + L  ++ S+++    I  + G R
Sbjct: 290 TWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAV-TNPLEHKFTSMSEMAKIIFHERGWR 348

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYE 307
           G++ GL+   +KV P +A  +FVYE
Sbjct: 349 GFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G V+G  A+T++ P D ++  FQ       +    +  + +A   I  ++ LRG ++G +
Sbjct: 60  GGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHS 119

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A L+++ P  AV++  YE I
Sbjct: 120 ATLLRIFPYAAVKFIAYEQI 139

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 63/144 (43%), Gaps = 21/144 (14%)

Query: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLKALI--PHDYDAGSVAAAKLAIGAVSGGIAQ 238
           LRG ++G   T L + P+ A+ F  YE+++ +I    +Y+       +L  G+++G  + 
Sbjct: 111 LRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYE---THFRRLCSGSLAGLCSV 167

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR-------------GYY 285
              YP DL+R R   +T        R   +   +++    E L               +Y
Sbjct: 168 FCTYPLDLIRVRLAYVTEHHK---VRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFY 224

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
           +G    ++ ++P   V +F ++L 
Sbjct: 225 RGYIPTVIGMIPYAGVSFFAHDLF 248

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 9/98 (9%)

Query: 113 LRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLR 172
           L +W                 YP +++R RL +        H+  +        + E+ +
Sbjct: 288 LNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTS--------MSEMAK 339

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            IF E G  RG++ G+    + V P VA +F +YER+K
Sbjct: 340 IIFHERG-WRGFFVGLSIGYIKVTPMVACSFFVYERMK 376

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score =  116 bits (290), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 137/308 (44%), Gaps = 42/308 (13%)

Query: 30  SRTVVSPVERVKILLQVQS--STTAYNGG------------------LVHAVKQVYKEEG 69
           SRT  +P +R+K+ L  ++  S+T  N                    LV A+  +Y++ G
Sbjct: 214 SRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGG 273

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGH-EQLRSWERXXXXXXXXXX 128
           +K  + GNG+N L++FP S++++  +E  K  +  V      + L               
Sbjct: 274 IKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVC 333

Query: 129 XXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188
                YP+D ++ R+     N A+L   K         +++  + ++  EGGL+ +YRGV
Sbjct: 334 AQFSVYPIDTLKFRMQCAPLN-AELKGRKL--------MIQTAKEMY-TEGGLKLFYRGV 383

Query: 189 YPTSLGVVPFVALNFALYERL---------KALIPHDYDAGSVAAAKLAIGAVSGGIAQT 239
               LG+ P+ AL+   +  L         K L   + D        L +GA SG    T
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 240 VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299
           VVYP +LLR R Q    G     +RY    D L    ++EG  G +KGL   L KV PA+
Sbjct: 444 VVYPINLLRTRLQA--QGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAV 501

Query: 300 AVQWFVYE 307
           ++ +  YE
Sbjct: 502 SISYLCYE 509

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 18/188 (9%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q         G   ++   K++Y E G+K  +RG  +  L IFPY+A+ 
Sbjct: 338 VYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALD 397

Query: 92  YAVYEFCK-----TRVFHVGQSGHE-QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
              +   K     ++   + +   + +L +                  YP++L+RTRL  
Sbjct: 398 LGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQA 457

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           Q         + AH  R       LL+ I RE  G  G ++G+ PT   V P V++++  
Sbjct: 458 QG--------TFAHPYRYDGFRDVLLKTIQRE--GYPGLFKGLVPTLAKVCPAVSISYLC 507

Query: 206 YERLKALI 213
           YE LK L+
Sbjct: 508 YENLKKLM 515

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 89/179 (49%), Gaps = 13/179 (7%)

Query: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196
           DL  T L+     LAK   +K + +R P  +V+ +  ++R+ GG++ +Y G    +L V 
Sbjct: 233 DLSSTLLNSTEDVLAKNPHAKPNKLRSP--LVKAIISLYRQ-GGIKSFYVGNGLNALKVF 289

Query: 197 PFVALNFALYERLKALIPHDYDAGSVAA-AKLAI---GAVSGGIAQTVVYPFDLLRRRFQ 252
           P  ++ F  +E  K L+    +       +KL+    G ++G  AQ  VYP D L+ R Q
Sbjct: 290 PESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQ 349

Query: 253 VLTMGQSELGFRYASV--ADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
              +  +EL  R   +  A  ++T G   GL+ +Y+G+T  ++ + P  A+    + ++
Sbjct: 350 CAPL-NAELKGRKLMIQTAKEMYTEG---GLKLFYRGVTVGVLGIFPYAALDLGTFSML 404

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 24/99 (24%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY--------------------ASVA 269
           G +SG I++T   PFD    R +V  + +++L                        + + 
Sbjct: 207 GGISGVISRTCTAPFD----RLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLV 262

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            A+ ++ RQ G++ +Y G   N +KV P  ++++  +E+
Sbjct: 263 KAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEI 301

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 4/71 (5%)

Query: 32  TVVSPVERVKILLQVQSSTTAYN---GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           TVV P+  ++  LQ Q  T A+     G    + +  + EG  GLF+G      ++ P  
Sbjct: 443 TVVYPINLLRTRLQAQG-TFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAV 501

Query: 89  AVQYAVYEFCK 99
           ++ Y  YE  K
Sbjct: 502 SISYLCYENLK 512

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score =  116 bits (290), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 142/309 (45%), Gaps = 44/309 (14%)

Query: 30  SRTVVSPVERVK-----------ILLQVQSSTTAYNGG---------LVHAVKQVYKEEG 69
           SRT  +P +R+K           ILL  ++   A N           L  AVK +Y++ G
Sbjct: 241 SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGG 300

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXX 128
           +K  + GNG+N +++FP S++++  +E  K  +  + G    + L  +            
Sbjct: 301 IKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMA 360

Query: 129 XXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188
                YP+D ++ R  +Q A L    + K +++     + +  + +FR EGGLR +YRGV
Sbjct: 361 AQFSVYPIDTLKFR--VQCAPLDT--KLKGNNL-----LFQTAKDMFR-EGGLRLFYRGV 410

Query: 189 YPTSLGVVPFVALNFALYERLKAL----------IPHDYDAGSVAAAKLAIGAVSGGIAQ 238
               +G+ P+ AL+   +  LK            +P D    S     L +GA SG +  
Sbjct: 411 TVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV-LPMGAFSGTVGA 469

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           +VVYP +LLR R Q    G     + Y    D L     +EG +G +KGL   L KV PA
Sbjct: 470 SVVYPINLLRTRLQA--QGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPA 527

Query: 299 MAVQWFVYE 307
           +++ +  YE
Sbjct: 528 VSISYLCYE 536

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 20/189 (10%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q     T   G   L    K +++E G++  +RG  +  + IFPY+A+ 
Sbjct: 365 VYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALD 424

Query: 92  YAVYEFCK-------TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
              +   K        +  ++ Q     L +                  YP++L+RTRL 
Sbjct: 425 LGTFSALKKWYIAKQAKTLNLPQD-QVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQ 483

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
            Q         +   D+        LL+ + RE  G +G ++G+ PT   V P V++++ 
Sbjct: 484 AQGTYAHPYVYNGFKDV--------LLKTLERE--GYQGLFKGLVPTLAKVCPAVSISYL 533

Query: 205 LYERLKALI 213
            YE LK  +
Sbjct: 534 CYENLKKFM 542

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 16/95 (16%)

Query: 230 GAVSGGIAQTVVYPFD---------------LLRRRFQVLTMG-QSELGFRYASVADALW 273
           G +SG I++T   PFD               LL  +  +L     +++    + +A A+ 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           ++ RQ G++ +Y G   N++KV P  ++++  +E+
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEV 328

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 32  TVVSPVERVKILLQVQSSTT---AYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           +VV P+  ++  LQ Q +      YNG     + +  + EG +GLF+G      ++ P  
Sbjct: 470 SVVYPINLLRTRLQAQGTYAHPYVYNG-FKDVLLKTLEREGYQGLFKGLVPTLAKVCPAV 528

Query: 89  AVQYAVYEFCK 99
           ++ Y  YE  K
Sbjct: 529 SISYLCYENLK 539

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score =  114 bits (286), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 142/311 (45%), Gaps = 48/311 (15%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA--------------------YNGGLVHAVKQVYKEEG 69
           SRT  +P +R+K+ L  ++  ++                        LV A   +Y++ G
Sbjct: 189 SRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGG 248

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFH----VGQSGHEQLRSWERXXXXXXX 125
           ++  + GNG+N +++FP SA+++  +E  K RV       G++G  +L            
Sbjct: 249 LRAFYLGNGLNVIKVFPESAMKFGSFELAK-RVLAGLEGCGETG--ELSRLSTYVAGGLG 305

Query: 126 XXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWY 185
                   YP+D ++ R  IQ A L    R         P +++  + ++R EGGLR +Y
Sbjct: 306 GIMAQFSVYPIDTLKFR--IQCAPLDTRCRGL-------PLLIKTAKDMYR-EGGLRLFY 355

Query: 186 RGVYPTSLGVVPFVALNFALYERLKA-LIPHDYDAGSVAAAK--------LAIGAVSGGI 236
           RG+    LGV P+ AL+   +  LK   I    +A  ++  +        L +GA SG +
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTV 415

Query: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296
             TVVYP +LLR R Q    G      RY    D      ++EGL G YKGL   L KV 
Sbjct: 416 GATVVYPINLLRTRLQA--QGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVC 473

Query: 297 PAMAVQWFVYE 307
           PA+A+ +  YE
Sbjct: 474 PAVAISYLCYE 484

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 18/185 (9%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q     T   G   L+   K +Y+E G++  +RG G+  L +FPY+A+ 
Sbjct: 313 VYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALD 372

Query: 92  YAVYEFCKT-----RVFHVGQSGHEQLRS-WERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
              +   K      R   +G S +E + S                   YP++L+RTRL  
Sbjct: 373 LGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQA 432

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           Q    A  HR          G  ++ R+  + EG L G Y+G+ PT   V P VA+++  
Sbjct: 433 Q-GTYAHPHRYD--------GFQDVFRKTVQREG-LPGLYKGLVPTLAKVCPAVAISYLC 482

Query: 206 YERLK 210
           YE LK
Sbjct: 483 YENLK 487

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           + +  A  ++ RQ GLR +Y G   N++KV P  A+++  +EL
Sbjct: 234 SPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFEL 276

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  110 bits (276), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 127/280 (45%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYN------GGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           ++T  SP+ERVKIL+Q Q              G+V   K+  K+EG+   +RGN  N +R
Sbjct: 26  AKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIR 85

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K      G    E    W                   Y LD  RT
Sbjct: 86  YFPTQALNFAFKDKIK---LMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFART 142

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+      A    SK    R+  G+ ++ ++  + + G+ G YRG  P+ +G+V +  L
Sbjct: 143 RLA------ADAKSSKKGGARQFNGLTDVYKKTLKSD-GIAGLYRGFMPSVVGIVVYRGL 195

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F +++ LK L+      GS  A+ L    V+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 196 YFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTG-ASTCSYPLDTVRRR-MMMTSGQA-- 251

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    D L  I   EG+   +KG  AN+++ V    V
Sbjct: 252 -VKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGR 277
           A    +G VS  IA+T   P +    R ++L   Q E      L  +Y+ + D      +
Sbjct: 13  AINFLMGGVSAAIAKTAASPIE----RVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAK 68

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQW 303
           QEGL  +++G TAN+++  P  A+ +
Sbjct: 69  QEGLISFWRGNTANVIRYFPTQALNF 94

>Kwal_26.7972
          Length = 358

 Score =  111 bits (278), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 144/303 (47%), Gaps = 33/303 (10%)

Query: 30  SRTVVSPVERVKILLQVQSST-TAYNG---GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           ++T+++P++R+KIL Q  +     Y+G   GL+ A   +   +G++G ++G+    +RIF
Sbjct: 41  AKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIF 100

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           PY+A+++  YE  + R F +    +E      R              TYPLDL+R RL+ 
Sbjct: 101 PYAAIKFIAYE--QIRHFMIPSKEYET--HARRLASGSMAGLCSVFMTYPLDLIRVRLAY 156

Query: 146 QT--ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
            T  + +  L   K     R    +     + R       +YRG  PT LG++P+  ++F
Sbjct: 157 VTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSF 216

Query: 204 ALYE------RLKALIPHDYDAGSVAA----------------AKLAIGAVSGGIAQTVV 241
             ++      R  AL P+     S                   A+L  G ++G  +QT  
Sbjct: 217 FAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTAS 276

Query: 242 YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
           YPF+++RRR QV  +  + +   + ++ D +  I ++ G RG++ GL+   +KV P +A 
Sbjct: 277 YPFEIIRRRLQVSVVSPTSI-HNFQTIPDMIRIIYKERGWRGFFVGLSIGYIKVTPMVAC 335

Query: 302 QWF 304
            +F
Sbjct: 336 SFF 338

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 90/191 (47%), Gaps = 33/191 (17%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRR--IFREEGGLRGWYRGVYPTS 192
           PLD  R ++  QT+N         H ++     + L+R         G+RG+Y+G   T 
Sbjct: 47  PLD--RIKILFQTSN--------PHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATL 96

Query: 193 LGVVPFVALNFALYERLKA-LIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
           + + P+ A+ F  YE+++  +IP  +Y+     A +LA G+++G  +  + YP DL+R R
Sbjct: 97  IRIFPYAAIKFIAYEQIRHFMIPSKEYE---THARRLASGSMAGLCSVFMTYPLDLIRVR 153

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLR-------------GYYKGLTANLVKVVP 297
              +T  +S +  +   V   ++T    E L               +Y+G T  ++ ++P
Sbjct: 154 LAYVT-DRSRI--KMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIP 210

Query: 298 AMAVQWFVYEL 308
              V +F ++L
Sbjct: 211 YAGVSFFAHDL 221

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 10/85 (11%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQV-----LTMGQSELGFRYASVADALWTIGRQEGLRGY 284
           G ++G  A+T++ P D ++  FQ      L    S +G   A        I   +G+RG+
Sbjct: 34  GGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAH-----INAHDGIRGF 88

Query: 285 YKGLTANLVKVVPAMAVQWFVYELI 309
           Y+G +A L+++ P  A+++  YE I
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQI 113

>Kwal_23.3042
          Length = 542

 Score =  112 bits (280), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 136/309 (44%), Gaps = 44/309 (14%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA--------------------YNGGLVHAVKQVYKEEG 69
           SRT  +P +R+K+ L  ++  ++                        LV A   +Y++ G
Sbjct: 238 SRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAATTLYRQGG 297

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXX 128
           ++  + GNG+N +++FP SA+++  +E  K  +  + G      L  +            
Sbjct: 298 IRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGVM 357

Query: 129 XXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188
                YP+D ++ R+     N      SK   +     ++   + +++ EGGLR +YRG+
Sbjct: 358 AQLSVYPIDTLKYRVQCAPLNT----ESKGRQL-----LISTAKDMYK-EGGLRIFYRGI 407

Query: 189 YPTSLGVVPFVALNFALYERLKAL----------IPHDYDAGSVAAAKLAIGAVSGGIAQ 238
               +G+ P+ A++   +  LK            +P D    S     L +GA SG +  
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFV-LLMGAFSGTVGA 466

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           T VYP +LLR R Q    G      RY    D L    ++EG +G +KGL  NL KV PA
Sbjct: 467 TAVYPVNLLRTRLQA--QGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPA 524

Query: 299 MAVQWFVYE 307
           +++ +  YE
Sbjct: 525 VSISYLCYE 533

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 81/186 (43%), Gaps = 20/186 (10%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q     T   G   L+   K +YKE G++  +RG  +  + IFPY+A+ 
Sbjct: 362 VYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMD 421

Query: 92  YAVYEFCK----TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXT--YPLDLVRTRLSI 145
              +   K     R   +     +Q+                   T  YP++L+RTRL  
Sbjct: 422 LGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQA 481

Query: 146 QTANLAKLHRSKA-HDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
           Q    A  HR     D+        LL+ + RE  G +G ++G+ P    V P V++++ 
Sbjct: 482 Q-GTFAHPHRYNGFRDV--------LLKTVQRE--GYQGLFKGLVPNLAKVCPAVSISYL 530

Query: 205 LYERLK 210
            YE LK
Sbjct: 531 CYENLK 536

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVAD------------------- 270
           G VSG +++T   PFD    R +V  + +++L   +    D                   
Sbjct: 231 GGVSGVVSRTCTAPFD----RIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLV 286

Query: 271 -ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            A  T+ RQ G+R +Y G   N +KV P  A+++  +EL
Sbjct: 287 KAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFEL 325

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 32  TVVSPVERVKILLQVQSSTTA---YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           T V PV  ++  LQ Q +      YNG     +K V + EG +GLF+G   N  ++ P  
Sbjct: 467 TAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTV-QREGYQGLFKGLVPNLAKVCPAV 525

Query: 89  AVQYAVYEFCK 99
           ++ Y  YE  K
Sbjct: 526 SISYLCYENLK 536

>Scas_578.3*
          Length = 524

 Score =  112 bits (280), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 141/307 (45%), Gaps = 42/307 (13%)

Query: 30  SRTVVSPVERVKILLQVQS--STTAYN----------------GGLVHAVKQVYKEEGVK 71
           SRT  +P++R+K+ L  ++  S+T  N                  ++ A++ +Y++ G++
Sbjct: 222 SRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSLYRQGGLR 281

Query: 72  GLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXX 130
             + GNG++  +I P S++++  +E  K  + ++ G      L   +             
Sbjct: 282 AFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQ 341

Query: 131 XXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190
              YP+D ++ R  IQ A L    +  A        ++   + +++E GG+R +YRGV  
Sbjct: 342 ISIYPIDTLKFR--IQCAPLEGNLKGNAL-------LISTAKEMYKE-GGIRVFYRGVLL 391

Query: 191 TSLGVVPFVALNFALYERLKAL----------IPHDYDAGSVAAAKLAIGAVSGGIAQTV 240
            +LG+ P+ AL+   +  LK            IP   D        L +GA SG +  T 
Sbjct: 392 GALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEK-DVMLSYLLVLPMGAFSGTVGATA 450

Query: 241 VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300
           VYP +LLR R Q    G     + Y    D      ++EG+ G+YKGL   LVKV PA++
Sbjct: 451 VYPINLLRTRLQA--QGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVS 508

Query: 301 VQWFVYE 307
           + +  YE
Sbjct: 509 IGYLCYE 515

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 85/189 (44%), Gaps = 24/189 (12%)

Query: 34  VSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           + P++ +K  +Q          N  L+   K++YKE G++  +RG  +  L IFPY+A+ 
Sbjct: 344 IYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALD 403

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXX---------XXXXXXXXXTYPLDLVRTR 142
                F   + +++ +   ++L   E+                        YP++L+RTR
Sbjct: 404 LGT--FSALKKWYIKRQS-KKLNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTR 460

Query: 143 LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALN 202
           L  Q         + AH      G  ++  +  + EG + G+Y+G+ PT + V P V++ 
Sbjct: 461 LQAQG--------TYAHPYTYT-GFRDVFMQTLKREG-VPGFYKGLVPTLVKVCPAVSIG 510

Query: 203 FALYERLKA 211
           +  YE+ KA
Sbjct: 511 YLCYEKFKA 519

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%), Gaps = 22/97 (22%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL--------------GFRYASV----ADA 271
           G +SG I++T   P D    R +V  + +++L              G   A +      A
Sbjct: 215 GGLSGVISRTCTAPLD----RIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 272 LWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           + ++ RQ GLR +Y G   ++ K+ P  ++++  +EL
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFEL 307

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score =  112 bits (279), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 146/311 (46%), Gaps = 48/311 (15%)

Query: 30  SRTVVSPVERVKILLQVQS--STTAYNGG------------------LVHAVKQVYKEEG 69
           SRT  +P +R+K+ L  ++  S+T  N                    L+ A   +Y++ G
Sbjct: 213 SRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKAATTLYRQGG 272

Query: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLRSWERXXXXXXXX 126
           ++  + GNG+N +++FP SA+++  +E  K    R+ +V  +   +L             
Sbjct: 273 LRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTS--ELSRLSTYIAGGLGG 330

Query: 127 XXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYR 186
                  YP+D ++ R  IQ A L         ++++   +++  + ++ ++GG+R +YR
Sbjct: 331 VAAQFSVYPIDTLKYR--IQCAPLNT-------NLKKSSILLQTAKEMY-QQGGIRLFYR 380

Query: 187 GVYPTSLGVVPFVALNFALYERLKAL----------IPHDYDAGSVAAAKLAIGAVSGGI 236
           GV+   +G+ P+ AL+   +  LK            +P D    S     L +GA SG +
Sbjct: 381 GVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIV-LPMGAFSGTV 439

Query: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296
             T+VYP +LLR R Q    G       Y   +D L    ++EG +G +KGL  NL KV 
Sbjct: 440 GATLVYPINLLRTRLQA--QGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVC 497

Query: 297 PAMAVQWFVYE 307
           PA+++ +  YE
Sbjct: 498 PAVSISYLCYE 508

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 18/188 (9%)

Query: 34  VSPVERVKILLQVQSSTTAYNGG--LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V P++ +K  +Q     T       L+   K++Y++ G++  +RG  I  + IFPY+A+ 
Sbjct: 337 VYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALD 396

Query: 92  YAVYE-----FCKTRVFHVGQSGHEQLRS-WERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
              +      + K      G    E + S                   YP++L+RTRL  
Sbjct: 397 LGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQA 456

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           Q    A  H           G  ++L++  + EG  +G ++G+ P    V P V++++  
Sbjct: 457 Q-GTYAHPHTYN--------GFSDVLKKTIQREG-YQGLFKGLVPNLAKVCPAVSISYLC 506

Query: 206 YERLKALI 213
           YE LK L+
Sbjct: 507 YENLKRLM 514

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALW---------------- 273
           G  SG +++T   PFD    R +V  + +++L     +  D L                 
Sbjct: 206 GGCSGVVSRTCTAPFD----RIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLI 261

Query: 274 ----TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
               T+ RQ GLR +Y G   N+VKV P  A+++  +E+
Sbjct: 262 KAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEM 300

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 32  TVVSPVERVKILLQVQSSTT---AYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           T+V P+  ++  LQ Q +      YNG     +K+  + EG +GLF+G   N  ++ P  
Sbjct: 442 TLVYPINLLRTRLQAQGTYAHPHTYNG-FSDVLKKTIQREGYQGLFKGLVPNLAKVCPAV 500

Query: 89  AVQYAVYEFCK 99
           ++ Y  YE  K
Sbjct: 501 SISYLCYENLK 511

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score =  107 bits (267), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 129/280 (46%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNG------GLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           S+T  +P+ERVK+L+Q Q              G+V   K+   +EGV   +RGN  N +R
Sbjct: 24  SKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASFWRGNTANVIR 83

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K       + G+ +   W                   Y LD  RT
Sbjct: 84  YFPTQALNFAFKDKIKAMFGFKKEEGYAK---WFAGNLASGGLAGGLSLLFVYSLDYART 140

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+      A    +K    R+  G+V++ ++    + G+ G YRG  P+ +G+V +  L
Sbjct: 141 RLA------ADSKSAKKGGERQFNGLVDVYKKTLASD-GVAGLYRGFLPSVVGIVVYRGL 193

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F LY+ LK L+       S  A+ L   AV+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 194 YFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTG-ASTASYPLDTVRRR-MMMTSGQA-- 249

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    DA   I   EG++  +KG  AN+++ V    V
Sbjct: 250 -VKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGR 277
           A    +G VS  +++T   P +    R ++L   Q E      L  RY  + +       
Sbjct: 11  AIDFLMGGVSAAVSKTAAAPIE----RVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAA 66

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQW 303
            EG+  +++G TAN+++  P  A+ +
Sbjct: 67  DEGVASFWRGNTANVIRYFPTQALNF 92

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score =  106 bits (265), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 129/280 (46%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYN------GGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           ++T  SP+ERVK+L+Q Q              G++   K+   +EGV   +RGN  N +R
Sbjct: 37  AKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIR 96

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K       + G+ +   W                   Y LD  RT
Sbjct: 97  YFPTQALNFAFKDKIKAMFGFKKEEGYAK---WFAGNLASGGAAGALSLLFVYSLDYART 153

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+      A    SK    R+  G++++ ++  + +G + G YRG  P+ +G+V +  L
Sbjct: 154 RLA------ADSKSSKKGGARQFNGLIDVYKKTLKSDG-VAGLYRGFLPSVVGIVVYRGL 206

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F +Y+ LK L+      GS  A+ L    V+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 207 YFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG-ASTCSYPLDTVRRR-MMMTSGQA-- 262

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    D L  I   EG+   +KG  AN+++ V    V
Sbjct: 263 -VKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 229 IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGRQEGLR 282
           +G VS  +A+T   P +    R ++L   Q E      L  +YA + D       QEG+ 
Sbjct: 29  MGGVSAAVAKTAASPIE----RVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVI 84

Query: 283 GYYKGLTANLVKVVPAMAVQW 303
            +++G TAN+++  P  A+ +
Sbjct: 85  SFWRGNTANVIRYFPTQALNF 105

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score =  105 bits (262), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 128/280 (45%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNG------GLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           ++T  SP+ERVK+L+Q Q              G+V   ++  ++EG+   +RGN  N +R
Sbjct: 25  AKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIR 84

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K       + G+ +   W                   Y LD  RT
Sbjct: 85  YFPTQALNFAFKDQIKAMFGFKKEEGYAK---WFAGNLASGGIAGGLSLMFVYSLDYART 141

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+      A    SK    R+  G+V++ ++    +G + G YRG  P+ +G+V +  L
Sbjct: 142 RLA------ADAKSSKKGGERQFNGLVDVYKKTIASDG-VAGLYRGFLPSVIGIVVYRGL 194

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F LY+  K L+      GS  A+ L    V+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 195 YFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTG-ASTASYPLDTVRRRM-MMTSGQA-- 250

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    D L  I   EG+   +KG  AN+++ V    V
Sbjct: 251 -VKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGR 277
           A    +G VS  +A+T   P +    R ++L   Q E      L  RY  + D      R
Sbjct: 12  AIDFLMGGVSAAVAKTAASPIE----RVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTAR 67

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQW 303
           QEG+  +++G TAN+++  P  A+ +
Sbjct: 68  QEGIISFWRGNTANVIRYFPTQALNF 93

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 129/291 (44%), Gaps = 34/291 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           +R   +P++ VKI  Q+Q        G+   V+ + KEEG++ L++GN         Y A
Sbjct: 32  ARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGA 91

Query: 90  VQYAVYEFCKT----RVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           VQ+  Y +       +     Q G       +               +YPLDL+RTRL  
Sbjct: 92  VQFGSYSWFNNVWSAKFPRFSQQG-------QTLTVGALAGMTSSVVSYPLDLLRTRL-- 142

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
             AN    HR+          + E  R+++  EG +RG++ G+      V    A+ F  
Sbjct: 143 -IANRTS-HRT---------SVAEECRQMWLNEG-VRGFFTGISTAMTTVTLSTAIMFLT 190

Query: 206 YERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS------ 259
           YE +  +  +            + G ++G +++T+V+P D LRRR QV+   ++      
Sbjct: 191 YETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKF 250

Query: 260 ---ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                 +RY S    ++ I RQEG+   Y+GLT  L K VP  A+  FVYE
Sbjct: 251 PAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 18/178 (10%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P+D V+ R  +Q     K             GI   +R I +EEG LR  ++G  P +
Sbjct: 36  TAPMDTVKIRYQLQPVQEDKYK-----------GIASTVRTIMKEEG-LRALWKGNIPAT 83

Query: 193 LGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ 252
              V + A+ F  Y     +    +   S     L +GA++G  +  V YP DLLR R  
Sbjct: 84  AMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSYPLDLLRTR-- 141

Query: 253 VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            L   ++       SVA+    +   EG+RG++ G++  +  V  + A+ +  YE ++
Sbjct: 142 -LIANRTS---HRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETVN 195

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 70/172 (40%), Gaps = 16/172 (9%)

Query: 51  TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGH 110
           T++   +    +Q++  EGV+G F G       +   +A+ +  YE       ++    H
Sbjct: 147 TSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYE-----TVNIVCENH 201

Query: 111 EQLRSWERXXXXXXXXXX---XXXXTYPLDLVRTRLSIQTANLAKLHRSKA----HDIRR 163
           E+   W R                  +P+D +R R+ +  +    +H +K     H+ R 
Sbjct: 202 EK-EFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRT-VHFTKFPAVYHEYRY 259

Query: 164 PPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH 215
                 ++ +I R+E G+   YRG+       VP  A++  +YER   L  H
Sbjct: 260 KSS-TAIIYKILRQE-GVSALYRGLTMGLCKSVPTTAISLFVYERTMDLFDH 309

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
           G+VSG  A+    P D ++ R+Q+  + +     +Y  +A  + TI ++EGLR  +KG
Sbjct: 25  GSVSGVFARMATAPMDTVKIRYQLQPVQED----KYKGIASTVRTIMKEEGLRALWKG 78

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 130/282 (46%), Gaps = 26/282 (9%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA-------YNGGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           S+T  +P+ERVK+L+Q Q            YNG +V   K+    EGV   +RGN  N +
Sbjct: 23  SKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNG-IVDCFKRTAASEGVISFWRGNTANVI 81

Query: 83  RIFPYSAVQYAVYEFCKTRV-FHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLV 139
           R FP  A+ +A  +  K    F     G+ +   W                   Y LD  
Sbjct: 82  RYFPTQALNFAFKDKIKAMFGFRKEVDGYAK---WFAGNLASGGAAGGLSLLFVYSLDYA 138

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           RTRL+      A    +K    R+  G+V++ ++    +G + G YRG  P+ +G+V + 
Sbjct: 139 RTRLA------ADSKSAKKGGERQFNGLVDVYKKTLASDG-IAGLYRGFLPSVVGIVVYR 191

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
            L F +Y+ LK L+       S  A+ L   AV+ G A T  YP D +RRR  ++T GQ+
Sbjct: 192 GLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTG-ASTASYPLDTVRRR-MMMTSGQA 249

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
               +Y    DA   I   EG++  +KG  AN+++ V    V
Sbjct: 250 ---VKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 229 IGAVSGGIAQTVVYPFD----LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284
           +G VS  +++T   P +    L++ + ++L   Q  L  RY  + D        EG+  +
Sbjct: 15  MGGVSAAVSKTAAAPIERVKLLIQNQDEMLK--QGSLDRRYNGIVDCFKRTAASEGVISF 72

Query: 285 YKGLTANLVKVVPAMAVQW 303
           ++G TAN+++  P  A+ +
Sbjct: 73  WRGNTANVIRYFPTQALNF 91

>Kwal_27.12481
          Length = 304

 Score =  103 bits (256), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 127/280 (45%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNG------GLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           S+T  +P+ERVK+L+Q Q              G+    K+    EG+   +RGN  N +R
Sbjct: 24  SKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASFWRGNTANVIR 83

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K       + G+ +   W                   Y LD  RT
Sbjct: 84  YFPTQALNFAFKDKIKAMFGFKKEEGYAK---WFAGNLASGGAAGGLSLMFVYSLDYART 140

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+  +        +K    R+  G+V++ ++    +G + G YRG  P+ +G+V +  L
Sbjct: 141 RLAADSKG------AKKGGERQFNGLVDVYKKTLASDG-IAGLYRGFLPSVVGIVVYRGL 193

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F  Y+ LK L+      GS  A+ L   AV+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 194 YFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTG-ASTASYPLDTVRRR-MMMTSGQA-- 249

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    DA   I   EG++  +KG  AN+++ V    V
Sbjct: 250 -VKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGR 277
           A    +G VS  +++T   P +    R ++L   Q E      L  RY  + +       
Sbjct: 11  AVDFLMGGVSAAVSKTAAAPIE----RVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAA 66

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQW 303
            EG+  +++G TAN+++  P  A+ +
Sbjct: 67  NEGIASFWRGNTANVIRYFPTQALNF 92

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score =  103 bits (256), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 135/282 (47%), Gaps = 26/282 (9%)

Query: 30  SRTVVSPVERVKILLQVQ-------SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           ++T  +P+ERVK+L+Q Q       S  T Y G ++   K+    EG+   +RGN  N L
Sbjct: 27  AKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKG-ILDCFKRTATHEGIVSFWRGNTANVL 85

Query: 83  RIFPYSAVQYAVYEFCKTRV-FHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLV 139
           R FP  A+ +A  +  K+ + +   + G+ +   W                   Y LD  
Sbjct: 86  RYFPTQALNFAFKDKIKSLLSYDRERDGYAK---WFAGNLFSGGAAGGLSLLFVYSLDYA 142

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           RTRL+      A    SK+   R+  G++++ ++  + +G L G YRG  P+ LG++ + 
Sbjct: 143 RTRLA------ADARGSKSTSQRQFNGLLDVYKKTLKTDG-LLGLYRGFVPSVLGIIVYR 195

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
            L F LY+  K ++      GS  A+ L    ++ G A T  YP D +RRR  ++T GQ+
Sbjct: 196 GLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMG-ASTASYPLDTVRRR-MMMTSGQT 253

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
               +Y    D L  I ++EG    +KG  AN+ + V A  V
Sbjct: 254 ---IKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGV 292

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 229 IGAVSGGIAQTVVYPFD----LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284
           +G VS  IA+T   P +    L++ + ++L   Q  L  RY  + D        EG+  +
Sbjct: 19  MGGVSAAIAKTGAAPIERVKLLMQNQEEMLK--QGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 285 YKGLTANLVKVVPAMAVQW 303
           ++G TAN+++  P  A+ +
Sbjct: 77  WRGNTANVLRYFPTQALNF 95

>Scas_718.24
          Length = 337

 Score =  103 bits (258), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 132/281 (46%), Gaps = 25/281 (8%)

Query: 30  SRTVVSPVERVKILLQVQSS-------TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           ++T  SP+ERVK+L+Q Q+         T Y G +V   ++  ++EG+   +RGN  N +
Sbjct: 56  AKTAASPIERVKLLIQNQNEMLKQGTLDTKYKG-IVDCFRRTAQQEGIISFWRGNTANVI 114

Query: 83  RIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVR 140
           R FP  A+ +A  +  K       + G+ +   W                   Y LD  R
Sbjct: 115 RYFPTQALNFAFKDKIKLMFGFKKEDGYGK---WFAGNLASGGAAGGLSLLFVYSLDFAR 171

Query: 141 TRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVA 200
           TRL+      A    SK    R+  G++++ ++  + +G + G YRG  P+ +G++ +  
Sbjct: 172 TRLA------ADSKSSKKGGSRQFNGLIDVYKKTLKSDG-VAGLYRGFLPSVVGIIVYRG 224

Query: 201 LNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE 260
           L F LY+ +K ++      GS  A+ L    V+ G A T  YP D +RR+  ++T GQ+ 
Sbjct: 225 LYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVTTG-ASTCSYPLDTVRRK-MMMTSGQA- 281

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
              +Y    D    I   EG+   +KG  AN+++ V    V
Sbjct: 282 --VKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFD----LLRRRFQVLTMGQSELGFRYASVADALWTIGRQE 279
           A    +G VS  +A+T   P +    L++ + ++L   Q  L  +Y  + D      +QE
Sbjct: 43  AIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLK--QGTLDTKYKGIVDCFRRTAQQE 100

Query: 280 GLRGYYKGLTANLVKVVPAMAVQW 303
           G+  +++G TAN+++  P  A+ +
Sbjct: 101 GIISFWRGNTANVIRYFPTQALNF 124

>Scas_667.4
          Length = 308

 Score =  101 bits (252), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 126/280 (45%), Gaps = 23/280 (8%)

Query: 30  SRTVVSPVERVKILLQVQS------STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           ++T  SP+ERVK+L+Q Q       S  +   G++   ++  K EG+   +RGN  N +R
Sbjct: 27  AKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAFWRGNTANVIR 86

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW--ERXXXXXXXXXXXXXXTYPLDLVRT 141
            FP  A+ +A  +  K      G    E    W                   Y LD  RT
Sbjct: 87  YFPTQALNFAFKDKIKA---MFGFKKEEGYGKWFAGNLASGGAAGGLSLLFVYSLDYART 143

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           RL+      A    SK    R+  G++++ ++    + G+ G YRG  P+ +G++ +  L
Sbjct: 144 RLA------ADAKSSKKGGSRQYKGLIDVYKQTLATD-GMAGLYRGFLPSVVGIIVYRGL 196

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            F LY+ LK  +      GS  A+ L    V+ G A T  YP D +RRR  ++T GQ+  
Sbjct: 197 YFGLYDSLKPAVLTGSLEGSFLASFLLGWIVTTG-ASTASYPLDTVRRR-MMMTSGQA-- 252

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
             +Y    D    +   EG+   +KG  AN+++ V    V
Sbjct: 253 -VKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE------LGFRYASVADALWTIGR 277
           A    +G VS  +A+T   P +    R ++L   Q E      L  +Y  + +      +
Sbjct: 14  AIDFLMGGVSAAVAKTAASPIE----RVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAK 69

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQW 303
            EG+  +++G TAN+++  P  A+ +
Sbjct: 70  TEGIIAFWRGNTANVIRYFPTQALNF 95

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score =  100 bits (248), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 137/287 (47%), Gaps = 27/287 (9%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNG----GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           S   V P++  K  LQ Q   T +      G++  +  + ++EG +GL++G     L  F
Sbjct: 91  SGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYF 150

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           P   + ++VYEF K + FH       Q     +              T P+ +V+TRL +
Sbjct: 151 PTWMIYFSVYEFSK-KFFH---GIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLML 206

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           Q +NL + H +         G  +  R++F +EG  +  Y G+ P+ LG+   VA++F +
Sbjct: 207 Q-SNLGE-HPTHYK------GTFDAFRKLFYQEG-FKALYAGLVPSLLGLF-HVAIHFPI 256

Query: 206 YERLKALIPHDY----DAGSVAAAKLAIGA-VSGGIAQTVVYPFDLLRRRFQVLTMGQSE 260
           YE LK    H Y    +  S+   +L + + VS  IA  V YP ++LR R Q+ +     
Sbjct: 257 YEDLKVRF-HCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDS 315

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +  R   +  A +    QEGL+G+Y G T NLV+ +PA A+    +E
Sbjct: 316 IQRRLFPLIKATYA---QEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 33  VVSPVERVKILLQVQSST-TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V  P E ++  +Q++S    +    L   +K  Y +EG+KG + G   N +R  P SA+ 
Sbjct: 295 VTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAIT 354

Query: 92  YAVYEFCKTRVFHVG 106
              +E+ + R+ ++ 
Sbjct: 355 LVSFEYFRNRLENIS 369

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 94.4 bits (233), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 128/291 (43%), Gaps = 31/291 (10%)

Query: 30  SRTVVSPVERVKILLQVQ-----SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRI 84
           S  +V P +  K  LQ Q     +  + +  G       ++K+EG  GL++G     L  
Sbjct: 52  SAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGY 111

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
            P   + ++VY+FC  R + V    H    S                 T P+ +V+TRL 
Sbjct: 112 IPTLMIYFSVYDFC--RKYSVDIFPHSPFLS--NASSAITAGAISTVATNPIWVVKTRLM 167

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
           +QT     + +   H      G ++  R+I ++EG  +  Y G+ P  LG++  VA+ F 
Sbjct: 168 LQTG----IGKYSTHY----KGTIDTFRKIIQQEGA-KALYAGLVPALLGMLN-VAIQFP 217

Query: 205 LYERLKALIPHD------YDAGSVAAAKLAIGAV-SGGIAQTVVYPFDLLRRRFQVLTMG 257
           LYE LK    +        D  S    KL + ++ S  +A TV YP ++LR R Q+    
Sbjct: 218 LYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL---- 273

Query: 258 QSELGFRYASVADALWTIG-RQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +S+L          L  I  RQEG  G+Y G   NLV+ VPA  V    +E
Sbjct: 274 KSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFE 324

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTM-GQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
           GA+SG ++  +V PFD+ + R Q   +   +     Y        TI + EG  G YKGL
Sbjct: 45  GALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGL 104

Query: 289 TANLVKVVPAMAVQWFVYEL 308
              ++  +P + + + VY+ 
Sbjct: 105 QPTVLGYIPTLMIYFSVYDF 124

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 30  SRTVVSPVERVKILLQVQSS-TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           + TV  P E ++  +Q++S         L+  +K  Y++EG  G + G   N +R  P +
Sbjct: 257 ASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAA 316

Query: 89  AVQYAVYEFCK 99
            V    +E+ K
Sbjct: 317 VVTLVSFEYSK 327

>Scas_709.9
          Length = 365

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 134/289 (46%), Gaps = 28/289 (9%)

Query: 30  SRTVVSPVERVKILLQ---VQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           S  +V P++  K  LQ   +QS    Y  G++  +  +  +EGV+GL++G     L  FP
Sbjct: 78  SGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFP 137

Query: 87  YSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
              + ++VYEF K     V  +      S                 T P+ +V+TRL +Q
Sbjct: 138 TWMIYFSVYEFAKDLYPRVLPNSDFISHSCS----AITAGAASTVLTNPIWVVKTRLMLQ 193

Query: 147 TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
           T     L  S+ H      G ++  ++I  +EG +R  Y G+ P+  G++  VA++F +Y
Sbjct: 194 TP----LGESRTHY----RGTIDAFKKIITQEG-VRTLYTGLVPSMFGLL-HVAIHFPVY 243

Query: 207 ERLKALIPHDYDAG-------SVAAAKLAIGA-VSGGIAQTVVYPFDLLRRRFQVLTMGQ 258
           E+LK  +  D   G       S+   +L I +  S  +A  + YP ++LR R Q   +  
Sbjct: 244 EKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQ---LKS 300

Query: 259 SELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            +L      + D +    R EGL G+Y G   NL++ VPA A+    +E
Sbjct: 301 DKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 214 PHDYDAGSVAAAKLAI---------GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR 264
           P  + A +V  +KL +         GA++G ++  +V P D+ + R Q   +   E  + 
Sbjct: 46  PEKHIASTVIQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPY- 104

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           Y  V   + TI   EG+RG YKGL   ++   P   + + VYE 
Sbjct: 105 YRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIYFSVYEF 148

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 36  PVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAV 94
           P E ++  +Q++S     +   L+  +K+ Y+ EG+ G + G   N LR  P SA+    
Sbjct: 288 PHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVS 347

Query: 95  YEFCKTRVFHVGQS 108
           +E+ +  +  + Q 
Sbjct: 348 FEYFRNALLKINQD 361

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 129/289 (44%), Gaps = 32/289 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTA--YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           S  +V P++  K  LQ Q + +   Y  G+V  +  + ++EGV GL++G     L  FP 
Sbjct: 98  SGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPT 157

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
             + ++VYE CK R       G                       T P+ +V+TRL IQ+
Sbjct: 158 WMLYFSVYEKCKQRYPSYLPGGFVS-----HAASALTAGAISTALTNPIWVVKTRLMIQS 212

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
                     + D       ++  R+++R EG L+ +Y G+ P+  G+   VA++F +YE
Sbjct: 213 --------DVSRDSTNYRSTLDAFRKMYRSEG-LKVFYSGLVPSLFGLF-HVAIHFPVYE 262

Query: 208 RLKALIPHD--------YDAGSVAAAKLAIGA-VSGGIAQTVVYPFDLLRRRFQVLTMGQ 258
           +LK  +  +         D   +   +L + + +S  +A  + YP ++LR R QV   G 
Sbjct: 263 KLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGV 322

Query: 259 SELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+ + L  I   EG  G+Y G   NLV+ VPA  +    +E
Sbjct: 323 PP------SLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GA++G ++  +V P D+ + R Q    G  E  +R   +   L  I R EG+ G YKGL 
Sbjct: 91  GALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYR--GIVGTLSAILRDEGVAGLYKGLA 148

Query: 290 ANLVKVVPAMAVQWFVYE 307
             ++   P   + + VYE
Sbjct: 149 PIVLGYFPTWMLYFSVYE 166

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 89.4 bits (220), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 133/291 (45%), Gaps = 29/291 (9%)

Query: 30  SRTVVSPVERVKILLQVQ-----SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRI 84
           S  VV P++  K  LQ Q     ++   Y  G +  +  + ++EGV+GL++G     +  
Sbjct: 82  SGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGY 141

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
           FP   + ++VYEFCK  +    ++                        T P+ +V+TRL 
Sbjct: 142 FPTWMIYFSVYEFCKDNL----RTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLM 197

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
           +QT     +  +  H      G  +  ++I  +E G++  Y G+ P+ LG++  VA++F 
Sbjct: 198 LQT----HIGSNTTHY----QGTYDAFKKIINQE-GVKALYAGLVPSLLGLL-HVAIHFP 247

Query: 205 LYERLKALIPHDYDAGSVAAAKLAI------GAVSGGIAQTVVYPFDLLRRRFQVLTMGQ 258
           +YERLK          S   +K+ +       +VS  +A  + YP ++LR R Q+    +
Sbjct: 248 VYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQL----K 303

Query: 259 SELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           S+L      +   +     QEG+ G+Y G   NL + +PA A+    +E +
Sbjct: 304 SDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTM-GQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
           GA++G ++  VV P D+ + R Q   +  ++     Y      + TI R EG+RG YKGL
Sbjct: 75  GALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGL 134

Query: 289 TANLVKVVPAMAVQWFVYEL 308
              ++   P   + + VYE 
Sbjct: 135 VPIIMGYFPTWMIYFSVYEF 154

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P E ++  LQ++S   ++   L+  +K  Y +EG+ G + G G N  R  P SA+    +
Sbjct: 292 PHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSF 351

Query: 96  EFCK 99
           E+ +
Sbjct: 352 EYVR 355

>Kwal_55.20868
          Length = 380

 Score = 89.0 bits (219), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 132/293 (45%), Gaps = 37/293 (12%)

Query: 33  VVSPVERVKILLQVQ---SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
            V P++  K  LQ Q   S+ + Y  G++  +  + ++EG +GL++G     +  FP   
Sbjct: 92  TVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWM 151

Query: 90  VQYAVYEFCKT---RVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
           + ++VYE  K    R+F                             T P+ +V+TRL +Q
Sbjct: 152 IYFSVYERSKKLYPRIF-------PSFDFISHSASALTAGTVSTILTNPVWVVKTRLMLQ 204

Query: 147 T-ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           T  N    H +   D            +++  EG LR +Y G+ P+ LG+   VA++F +
Sbjct: 205 THVNKNSTHYTSTFDA---------FHKMYTTEG-LRTFYAGLLPSLLGLF-HVAIHFPI 253

Query: 206 YERLKALIPHDYDAGS------VAAAKLAIGA-VSGGIAQTVVYPFDLLRRRFQVLTMGQ 258
           YE+LK  + H   + S      +  A+L I +  S  +A T+ YP ++LR R Q+     
Sbjct: 254 YEKLKVWL-HCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPT 312

Query: 259 SELGFRYASVADALWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             L     +    L  + +     EGLRG+Y G TANL + +PA A+    +E
Sbjct: 313 DPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GA++G +A   V P D+ + R Q   +  +   + Y  +   L TI R EG RG YKGL 
Sbjct: 82  GAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNY-YKGILGTLTTIIRDEGARGLYKGLV 140

Query: 290 ANLVKVVPAMAVQWFVYE 307
             ++   P   + + VYE
Sbjct: 141 PIIMGYFPTWMIYFSVYE 158

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK 99
           GL+  +K  YK EG++G + G   N  R  P SA+    +E+ +
Sbjct: 325 GLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFR 368

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 129/290 (44%), Gaps = 37/290 (12%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           TVV P++ +K  +Q Q S   Y    +  + ++   EG+KGL+ G G   + + P  A++
Sbjct: 546 TVVYPIDFIKTRMQAQRSLAQYKNS-IDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIK 604

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT---- 147
             V +F + R+    ++G  +L  +                T PL++V+ RL +Q+    
Sbjct: 605 LTVNDFMRNRL--TDKNG--KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVG 660

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
            N+ + + +          IV+ L        GLRG Y GV    +  VPF A+ F  Y 
Sbjct: 661 ENIQQANETATQ-------IVKKL--------GLRGLYNGVAACLMRDVPFSAIYFPTYA 705

Query: 208 RLKALIPHDYDAGSVAAAK-------LAIGAVSGGIAQTVVYPFDLLRRRFQVLT-MGQS 259
            LK  +  D+D               L  GA++G  A  +  PFD+++ R Q+    G++
Sbjct: 706 HLKKDL-FDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGET 764

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
               +Y  +  A+ TI ++E  R ++KG  A +++  P        YEL 
Sbjct: 765 ----KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELF 810

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 89/214 (41%), Gaps = 16/214 (7%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVH-AVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
            +P+E VKI LQVQS     N    +    Q+ K+ G++GL+ G     +R  P+SA+ +
Sbjct: 642 TNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYF 701

Query: 93  AVYEFCKTRVFHVG---QSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             Y   K  +F      ++   +L++WE               T P D+++TRL I    
Sbjct: 702 PTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQID--- 758

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
             +   +K +      GI   +R I +EE   R +++G     L   P      A YE  
Sbjct: 759 -PRKGETKYN------GIFHAIRTILKEES-FRSFFKGGGARVLRSSPQFGFTLAAYELF 810

Query: 210 KALIPH-DYDAGSVAAAKLAIGAVSGGIAQTVVY 242
           K  IP  D    S    K        G  +TVV+
Sbjct: 811 KGFIPSPDNKLKSREGRKRFCIDDDAGNEETVVH 844

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
             ++G+++G I  TVVYP D ++ R Q     Q  L  +Y +  D L  I  +EG++G Y
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQ----AQRSLA-QYKNSIDCLLKIISREGIKGLY 587

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
            GL   L+ V P  A++  V + +
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFM 611

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 33  VVSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           + +P + +K  LQ+      T YNG + HA++ + KEE  +  F+G G   LR  P    
Sbjct: 744 LTTPFDVIKTRLQIDPRKGETKYNG-IFHAIRTILKEESFRSFFKGGGARVLRSSPQFGF 802

Query: 91  QYAVYEFCK 99
             A YE  K
Sbjct: 803 TLAAYELFK 811

>Kwal_23.3965
          Length = 307

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 132/300 (44%), Gaps = 49/300 (16%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           +R V +P++ +KI LQ+Q +  A  GG++   K++ ++EGV+ L++GN         Y +
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 90  VQYAVYE-----FCKTRV---FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRT 141
            Q+  Y        K+++    H G  G                       +YP D++RT
Sbjct: 88  TQFTSYAILNKLLSKSQLPAQIHTGMVG-------------ALSGTCSAIASYPCDVLRT 134

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           R               A+  R    ++   + I+R EG  RG+++GV  + + +    + 
Sbjct: 135 RF-------------IANHSRELSTMLSTAQEIWRHEG-FRGFFKGVSSSIVSIAVATSS 180

Query: 202 NFALYERLKALIPH--DYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM--- 256
             A YE +K       D D+  +   + +   ++G +++T+V+P D +R+R+QV+     
Sbjct: 181 ILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240

Query: 257 ---GQSELGFR-YASVADALW-----TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
              G +   ++ Y S     +      I  +EGL   Y G T  + K VP+  V   VYE
Sbjct: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 11/75 (14%)

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYK 286
           L  G +SG  A+ V  P D L+ R Q+    +++    Y  +      + RQEG+R  +K
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQ----YGGILVTFKRLVRQEGVRALWK 73

Query: 287 GLTANLVKVVPAMAV 301
           G        VPAMA+
Sbjct: 74  G-------NVPAMAM 81

>Scas_602.8
          Length = 885

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 132/285 (46%), Gaps = 27/285 (9%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           T+V P++ +K  +Q Q S T Y   +   VK ++ +EG++GL+ G G   + + P  A++
Sbjct: 514 TLVYPIDFIKTRMQAQRSLTKYKNSIDCLVK-IFGKEGIRGLYSGLGPQLIGVAPEKAIK 572

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
             V +F +  +  V + G+ QL +                 T PL++V+ RL +      
Sbjct: 573 LTVNDFMRKSL--VDKKGNLQLGA--EVLSGATAGACQVVFTNPLEIVKIRLQV------ 622

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
              +S+  +   P   +   + I  +E  L G Y+GV    L  VPF A+ F  Y  LK 
Sbjct: 623 ---KSEYTNAMIPKSQLTAFQII--KELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKK 677

Query: 212 LI----PHDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQVLT-MGQSELGFR 264
            +    P+D D          L  GA++G  A  +  PFD+++ R Q+   +G++    R
Sbjct: 678 NVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGET----R 733

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           Y  +  A+ TI ++E  R ++KG  A +++  P        YEL 
Sbjct: 734 YTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELF 778

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 80/187 (42%), Gaps = 21/187 (11%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVK----QVYKEEGVKGLFRGNGINCLRIFPYSA 89
            +P+E VKI LQV+S    Y   ++   +    Q+ KE  + GL++G G   LR  P+SA
Sbjct: 610 TNPLEIVKIRLQVKSE---YTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSA 666

Query: 90  VQYAVYEFCKTRVFHV---GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
           + +  Y   K  VF      +   ++L++WE               T P D+++TRL I+
Sbjct: 667 IYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIE 726

Query: 147 TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
                           R  GI+  +R I +EE   R +++G     +   P      A Y
Sbjct: 727 PGVGET----------RYTGILHAVRTILKEE-SFRSFFKGGAARVMRSSPQFGFTLAAY 775

Query: 207 ERLKALI 213
           E  K + 
Sbjct: 776 ELFKNMF 782

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
             ++G+V+G I  T+VYP D ++ R Q     Q  L  +Y +  D L  I  +EG+RG Y
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQ----AQRSLT-KYKNSIDCLVKIFGKEGIRGLY 555

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
            GL   L+ V P  A++  V + +
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFM 579

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 33  VVSPVERVKILLQVQSST--TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           + +P + +K  LQ++     T Y  G++HAV+ + KEE  +  F+G     +R  P    
Sbjct: 712 LTTPFDVIKTRLQIEPGVGETRY-TGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGF 770

Query: 91  QYAVYEFCKTRVFHVGQS 108
             A YE  K  +F++   
Sbjct: 771 TLAAYELFKN-MFNISDD 787

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 134/285 (47%), Gaps = 28/285 (9%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           TVV P++ VK  +Q Q ++  Y   +   VK +++ +G++GL+ G G   + + P  A++
Sbjct: 520 TVVYPIDLVKTRMQAQRNSVQYKNSIDCVVK-IFQTKGIRGLYSGLGPQLIGVAPEKAIK 578

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
             V +F   R + + +S    ++ ++               T PL++V+ RL +++  + 
Sbjct: 579 LTVNDF--MRQYFMNKS--RTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVG 634

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
           +  R +        G V ++R++     GLRG Y+G     L  VPF A+ F  Y  LK 
Sbjct: 635 ENARPQL-------GAVGIIRQL-----GLRGLYKGAAACLLRDVPFSAIYFPTYAHLKK 682

Query: 212 LI----PHDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQVLT-MGQSELGFR 264
            +    P+D +  +       L  G ++G  A  +  PFD+++ R Q+    G++     
Sbjct: 683 DVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGET----T 738

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           Y  V  A  TI ++E ++ ++KG  A +++  P        +E+ 
Sbjct: 739 YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMF 783

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 22/191 (11%)

Query: 34  VSPVERVKILLQVQSSTTAYNG----GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
            +P+E VKI LQ++S     N     G V  ++Q+    G++GL++G     LR  P+SA
Sbjct: 616 TNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSA 671

Query: 90  VQYAVYEFCKTRVFHV---GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
           + +  Y   K  VF+     ++   +L++WE               T P D+++TRL I 
Sbjct: 672 IYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID 731

Query: 147 TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
                  +           G++   R I +EE  ++ +++G     L   P      A +
Sbjct: 732 PRKGETTY----------TGVIHAARTILKEE-SIKSFFKGGPARVLRSSPQFGFTLAAF 780

Query: 207 ERLKALIPHDY 217
           E  + L P  +
Sbjct: 781 EMFQGLFPSHF 791

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
              +G+++G I  TVVYP DL++ R Q           +Y +  D +  I + +G+RG Y
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQA-----QRNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
            GL   L+ V P  A++  V + +
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFM 585

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 128/286 (44%), Gaps = 30/286 (10%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           TVV P++ VK  +Q Q S + Y    +    +++  EG++G++ G G   + + P  A++
Sbjct: 534 TVVYPIDLVKTRMQAQRSFSQYKNS-IDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIK 592

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
             V ++ + R+       H  L+ +                T PL++V+ RL +++    
Sbjct: 593 LTVNDYMRGRL----MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAG 648

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
            + +S+   +    G+++ L        G++G Y+G+    +  VPF A+ F  Y  LK 
Sbjct: 649 DVLKSQVTAL----GVIKQL--------GIKGLYKGIAACLMRDVPFSAIYFPTYAHLKK 696

Query: 212 LIPHDYDAGSVAAAK-------LAIGAVSGGIAQTVVYPFDLLRRRFQVLT-MGQSELGF 263
            +   YD               L  G ++G  A  +  PFD+++ R Q+    G++    
Sbjct: 697 DV-FKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET---- 751

Query: 264 RYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           RY  +  A  TI ++E  + ++KG +A +++  P        YE+ 
Sbjct: 752 RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIF 797

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 80/191 (41%), Gaps = 28/191 (14%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHA---VKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
            +P+E VKI LQV+S    Y G ++ +      V K+ G+KGL++G     +R  P+SA+
Sbjct: 630 TNPLEVVKIRLQVRSE---YAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAI 686

Query: 91  QYAVYEFCKTRVFHVGQSGHEQ---LRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
            +  Y   K  VF       +Q   L++WE               T P D+++TRL I  
Sbjct: 687 YFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQI-- 744

Query: 148 ANLAKLHRSKAHDIR----RPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                       D R    R  GI    R I +EE   + +++G     L   P      
Sbjct: 745 ------------DPRKGETRYEGIFHAARTILKEE-SFKSFFKGGSARVLRSSPQFGFTL 791

Query: 204 ALYERLKALIP 214
           A YE  + + P
Sbjct: 792 AAYEIFQNMFP 802

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
              +G+++G I  TVVYP DL++ R Q     Q     +Y +  D    I  +EG+RG Y
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQ----AQRSFS-QYKNSIDCFAKIFSREGIRGIY 575

Query: 286 KGLTANLVKVVPAMAVQ 302
            GL   L+ V P  A++
Sbjct: 576 SGLGPQLIGVAPEKAIK 592

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 117/288 (40%), Gaps = 34/288 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           +R+V +P++ VKI  Q+Q ++     G++H  + V +EEGV+ L++GN         Y +
Sbjct: 38  ARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL-SIQTA 148
           +Q+  Y +  T     G                          TYPLDL+RTRL + ++A
Sbjct: 98  LQFGTYAWLNTAAASAGLPPQAH-----SLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
           +   L R                 R+  +  G  G++RG             L F +YE 
Sbjct: 153 HFFSLRRQA---------------RVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYET 197

Query: 209 LKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV 268
              +    Y    +AAA       +G +++  V+P D +RRR Q++         R    
Sbjct: 198 CT-IAADTYGLPWLAAAA---SPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGA 253

Query: 269 ADAL---------WTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             AL           + R EG+   YKGLT  L K  P   +  +VY+
Sbjct: 254 YSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
           G+VSG +A++V  P D ++ R Q+    Q     +Y  +     T+ R+EG+R  +KG
Sbjct: 31  GSVSGLVARSVTAPMDTVKIRRQL----QLASEHKYHGILHTFRTVAREEGVRALWKG 84

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 114/285 (40%), Gaps = 35/285 (12%)

Query: 31  RTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
            +++ P++ +K  +Q      A + G++  + ++   EG   L++G     L   P  AV
Sbjct: 38  HSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAV 97

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            +  YEFCK R+  +     +  +  +                 P D V+ RL + T   
Sbjct: 98  YFGTYEFCKARL--ISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDT--- 152

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFALYERL 209
                    ++R    +  + ++I++ EG    +Y   YPT+L + +PF A NF +YE  
Sbjct: 153 ---------NLR----VWNVTKQIYQNEGFAAFYYS--YPTTLAMNIPFAAFNFMIYESA 197

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
                       +       G +SG     +  P D ++   QV   G   +       A
Sbjct: 198 SKFFNPQNSYNPL--IHCLCGGISGATCAALTTPLDCIKTVLQV--RGSETVSIEIMKDA 253

Query: 270 DALWTIGRQE-------GLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +   T GR         G +G+++GL   +V  +PA A+ W  YE
Sbjct: 254 N---TFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 78/178 (43%), Gaps = 22/178 (12%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +P+D ++TR  +Q A L K   +         G++  + +I   EG +  W +GV    L
Sbjct: 42  FPIDALKTR--VQAAGLNKAAST---------GMISQISKISTMEGSMALW-KGVQSVIL 89

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQ 252
           G  P  A+ F  YE  KA +    D  +    K A+ G ++   A  ++ PFD +++R Q
Sbjct: 90  GAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQ 149

Query: 253 VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
           + T        R  +V   ++   + EG   +Y      L   +P  A  + +YE  S
Sbjct: 150 LDT------NLRVWNVTKQIY---QNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESAS 198

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 71/178 (39%), Gaps = 16/178 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +++P + VK  LQ+ ++   +N       KQ+Y+ EG    +           P++A  +
Sbjct: 137 LMNPFDTVKQRLQLDTNLRVWN-----VTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF 191

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
            +YE      F   Q+ +  L                   T PLD ++T L ++ +    
Sbjct: 192 MIYE--SASKFFNPQNSYNPLI---HCLCGGISGATCAALTTPLDCIKTVLQVRGSETVS 246

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           +      +I +         R   E  G +G++RG+ P  +  +P  A+++  YE  K
Sbjct: 247 I------EIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAK 298

>Kwal_23.4731
          Length = 314

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 138/294 (46%), Gaps = 40/294 (13%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKG-----LFRGNGINCLRIFPYSAV 90
           P++ VK+ LQ+  +TT ++ G    +K + ++           +RG G+N +       +
Sbjct: 33  PLDLVKLRLQLLVNTT-HSHGYKEVIKTIIRDSKADSNVFREAYRGLGVNLIGNSIAWGL 91

Query: 91  QYAVYEFCKTRVFHVG--------QSGHEQLRSWERXXXXXXXXXX---XXXXTYPLDLV 139
            + +Y F K  V+  G        QS  ++ ++                    T P+ ++
Sbjct: 92  YFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALSGLGTAILTNPIWVI 151

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TR+   ++  ++ +++    IR+          ++  EG   G++RG+ P+  GV    
Sbjct: 152 KTRIMSTSSQASERYKTTWDGIRK----------VYAHEG-FSGFWRGLVPSLFGVAQ-G 199

Query: 200 ALNFALYERLKAL------IPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
           A+ F +Y+ L+        I  D   G++    +AI +VS  ++ T VYPF LL+   Q 
Sbjct: 200 AIYFTIYDSLRHQYFARRGITEDEKMGNLE--NIAITSVSKMLSVTAVYPFQLLKSNLQS 257

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
               +    +R+ ++     +I ++EGL+G YKGL+ANL++ +P+  + + +YE
Sbjct: 258 FAAVEKRDSYRFWNLVK---SIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 65/151 (43%), Gaps = 13/151 (8%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF-HVGQSGHEQLRSWERX 119
           +++VY  EG  G +RG  +  L      A+ + +Y+  + + F   G +  E++ + E  
Sbjct: 173 IRKVYAHEGFSGFWRGL-VPSLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENI 231

Query: 120 XXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEG 179
                         YP  L+++       NL      +  D  R      L++ I ++EG
Sbjct: 232 AITSVSKMLSVTAVYPFQLLKS-------NLQSFAAVEKRDSYR---FWNLVKSIHQKEG 281

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            L+G Y+G+    L  +P   + F +YE L+
Sbjct: 282 -LQGLYKGLSANLLRAIPSTCITFCIYENLR 311

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 78/193 (40%), Gaps = 34/193 (17%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG----LRGWYRGV 188
           T+PLDLV+ RL +       ++ + +H      G  E+++ I R+        R  YRG+
Sbjct: 31  THPLDLVKLRLQLL------VNTTHSH------GYKEVIKTIIRDSKADSNVFREAYRGL 78

Query: 189 YPTSLGVVPFVALNFALYERLKALI--------------PHDYDAGSVAAAKLAIGAVSG 234
               +G      L F LY   K ++                  D     +  LA  A+SG
Sbjct: 79  GVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALSG 138

Query: 235 GIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
                +  P  +++ R    +   SE   RY +  D +  +   EG  G+++GL  +L  
Sbjct: 139 LGTAILTNPIWVIKTRIMSTSSQASE---RYKTTWDGIRKVYAHEGFSGFWRGLVPSLFG 195

Query: 295 VVPAMAVQWFVYE 307
           V    A+ + +Y+
Sbjct: 196 VAQG-AIYFTIYD 207

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 79.7 bits (195), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 123/289 (42%), Gaps = 36/289 (12%)

Query: 31  RTVVSPVERVKILLQVQSST-----TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
            +++ P++ +K  +Q  S+T     T     ++  + ++   EG   L++G     L   
Sbjct: 32  HSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAG 91

Query: 86  PYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
           P  AV +A YE CK+R+     +  H+ L++                   P D ++ RL 
Sbjct: 92  PAHAVYFATYEMCKSRLIDPEDRQTHQPLKT---ALSGTLATVAADALMNPFDTIKQRL- 147

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNF 203
                  +LH S +        + +   R+++ EG    +Y   YPT++ + +PF ALNF
Sbjct: 148 -------QLHPSDS--------MTKCAVRMYQREGIAAFFYS--YPTTIAMNIPFAALNF 190

Query: 204 ALYER-LKALIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMG--QS 259
            +YE   K   P ++Y+           G +SG     +  P D ++   Q+      QS
Sbjct: 191 VIYESSTKIFNPSNNYNPW----IHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQS 246

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +L     +   A   I +  G  G+++GL   ++  +PA A+ W  YE 
Sbjct: 247 QLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEF 295

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADA-LWTIGRQEGLRGY 284
           +LA GA +G +  ++++P D ++ R Q ++   S    R  S   A +  I   EG    
Sbjct: 20  QLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLAL 79

Query: 285 YKGLTANLVKVVPAMAVQWFVYELI 309
           +KG+ + ++   PA AV +  YE+ 
Sbjct: 80  WKGVQSVVLGAGPAHAVYFATYEMC 104

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 33  VVSPVERVKILLQ------VQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           + +P++ VK +LQ      VQS           A   ++K  G  G FRG     +   P
Sbjct: 225 ITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMP 284

Query: 87  YSAVQYAVYEFCKTRVF 103
            +A+ +  YEF K  +F
Sbjct: 285 ATAISWTSYEFAKHLLF 301

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 80.1 bits (196), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 118/260 (45%), Gaps = 19/260 (7%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS 115
           G +   + +Y +EG   L++G G   + I P  A++++ YEF +T +    Q+G     S
Sbjct: 81  GFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRT-LLADKQTGVVST-S 138

Query: 116 WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPP--GIVELLRR 173
                              P+++V+ RL  Q       H +  HD+ +P     V+    
Sbjct: 139 NTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQ-------HLNPNHDLAKPKYTNAVQAGYT 191

Query: 174 IFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-IGAV 232
           I +EEG +   YRGV  T+         NF +Y +L+  +   +   ++ + + + IG +
Sbjct: 192 IIKEEG-ISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLI 250

Query: 233 SGGIAQTVVYPFDLLRRRFQV--LTMGQSELGF-RYASVADALWTIGRQEGLRGYYKGLT 289
           SG I      P D ++ R Q    T  + E G+ R A +   L    ++EG R  YKG+T
Sbjct: 251 SGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLL---KEEGFRALYKGIT 307

Query: 290 ANLVKVVPAMAVQWFVYELI 309
             +++V P  AV + VYE +
Sbjct: 308 PRVMRVAPGQAVTFTVYEFV 327

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 76/184 (41%), Gaps = 22/184 (11%)

Query: 33  VVSPVERVKILLQVQSSTTAYN------GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           VV+P+E VKI LQ Q     ++         V A   + KEEG+  L+RG  +   R   
Sbjct: 155 VVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQAT 214

Query: 87  YSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
                + VY   K R F     G E L SWE                 PLD ++TR    
Sbjct: 215 NQGANFTVYS--KLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTR---- 268

Query: 147 TANLAKLHRSKAHDIRRPPG---IVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                 L + K+   +   G   I  +  ++ +EE G R  Y+G+ P  + V P  A+ F
Sbjct: 269 ------LQKDKSTSFKGESGWKRIAHIGTQLLKEE-GFRALYKGITPRVMRVAPGQAVTF 321

Query: 204 ALYE 207
            +YE
Sbjct: 322 TVYE 325

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 72/149 (48%), Gaps = 6/149 (4%)

Query: 163 RPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSV 222
           +PPG +   R I+ +EG L   Y+G+    +G++P +A+ F+ YE  + L+  D   G V
Sbjct: 78  KPPGFIRTGRNIYAQEGFL-ALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-ADKQTGVV 135

Query: 223 AAAKLAIGAVSGGIAQT--VVYPFDLLRRRFQV--LTMGQSELGFRYASVADALWTIGRQ 278
           + +   I  V  G+ +   VV P ++++ R Q   L         +Y +   A +TI ++
Sbjct: 136 STSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKE 195

Query: 279 EGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           EG+   Y+G++    +        + VY 
Sbjct: 196 EGISALYRGVSLTAARQATNQGANFTVYS 224

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 35  SPVERVKILLQVQSSTTAYNGG-----LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           +P++ +K  LQ +  +T++ G      + H   Q+ KEEG + L++G     +R+ P  A
Sbjct: 260 APLDTIKTRLQ-KDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQA 318

Query: 90  VQYAVYEFCKTRVFHVG 106
           V + VYEF +  + ++G
Sbjct: 319 VTFTVYEFVRRHLENLG 335

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 110/260 (42%), Gaps = 32/260 (12%)

Query: 57  LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQ-SGHEQLRS 115
           L+  + ++   EG   L+RG     +   P  AV +A YEFCK ++      + H+ L++
Sbjct: 78  LLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKT 137

Query: 116 WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIF 175
                              P D ++ RL +Q         SK+ D      +  +   I+
Sbjct: 138 ---AVSGVAATVAADALMNPFDTIKQRLQLQ---------SKSSD----SSMWRMAFNIY 181

Query: 176 REEGGLRGWYRGVYPTSLGV-VPFVALNFALYE-RLKALIPHDYDAGSVAAAKLAIGAVS 233
           + EG +  +Y   YPT+L + +PF ALNF +YE   K   P +     +       G ++
Sbjct: 182 KNEGPMAFFYS--YPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNPWI---HCLCGGIA 236

Query: 234 GGIAQTVVYPFDLLRRRFQV-----LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
           G     V  P D ++   Q+     + +   +    +   A A+W   +  G +G+++GL
Sbjct: 237 GATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIW---QSYGWKGFWRGL 293

Query: 289 TANLVKVVPAMAVQWFVYEL 308
              ++  +PA A+ W  YE 
Sbjct: 294 QPRVISNIPATAISWTSYEF 313

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 33  VVSPVERVKILLQVQSSTTAY------NGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           V +P++ +K +LQ++ S T +            A + +++  G KG +RG     +   P
Sbjct: 243 VTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIP 302

Query: 87  YSAVQYAVYEFCKTRVF 103
            +A+ +  YEF K  +F
Sbjct: 303 ATAISWTSYEFAKHLLF 319

>Scas_716.29
          Length = 316

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 129/295 (43%), Gaps = 33/295 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYN-GGLVHAVK-QVYKEEGVKGLFRGNGINCLRIFPY 87
           +RTV++P++ +KI LQ++ S T     GL+  +K  +  E G++  ++GN    +    Y
Sbjct: 36  ARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLY 95

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
              Q++ Y F    +F      + QL+S                 +YP D++RTR     
Sbjct: 96  GGAQFSSYSF-YNNLFGETSDMNGQLQS---LVVGALAGMTSSFVSYPTDVLRTRF---I 148

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
           AN      S +H  +           I+  EG + G++RG   +   +    ++ F  YE
Sbjct: 149 ANQDVALSSLSHGCKE----------IWNMEG-IPGFFRGCTASMFTITLSASILFGTYE 197

Query: 208 RLKALIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLT----------- 255
            +K     +  ++      + +  ++SG  ++ V YP D +RRR QV             
Sbjct: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257

Query: 256 -MGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            + +    ++ AS       I RQEGL   Y+G++ +L K VP+  V  + YE +
Sbjct: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLT--MGQSELGFRYASVADALWTIGRQEGL 281
           +  L  G+VSG +A+TV+ P D L+ R Q+     GQ+  G     +      I  + GL
Sbjct: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL----LKMMKGMILNEGGL 78

Query: 282 RGYYKG 287
           R ++KG
Sbjct: 79  RSFWKG 84

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 137/286 (47%), Gaps = 38/286 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKE------EGVKGLFRGNGINCLRIFP 86
           +V P++  K+ LQ+  ++T   G      + ++ E         + L+RG  +N +    
Sbjct: 25  IVHPLDLFKVRLQLLITSTTKKG-----YRNLWSEIVGSDLSLTRELYRGLTVNLVGNTI 79

Query: 87  YSAVQYAVYEFCKTRVFHVGQS--GHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
              + +A Y   K  + +        + L SW                T PL +++TR+ 
Sbjct: 80  AWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRM- 138

Query: 145 IQTANLAKLHRSKAH-DIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                      SKA+ D+      +++LR + + +G ++G ++G+ P  +GV    AL+F
Sbjct: 139 ----------MSKANSDLTS----MKVLRDLIKNDG-VQGLWKGLVPALVGVSQG-ALHF 182

Query: 204 ALYERLK-ALIPHDYDAGSVAAAK-LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
             Y+ LK  L+  + D+  +   + +A+ +VS  ++ + VYPF LL+   Q  +   SE 
Sbjct: 183 TCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQ--SFQASEN 240

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            F+   ++  +++   + GL G+YKGL+ANL++ VP+  + + +YE
Sbjct: 241 DFKLLPLSKMIYS---RSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 66/156 (42%), Gaps = 15/156 (9%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWE 117
           +  ++ + K +GV+GL++G  +  L      A+ +  Y+  K ++  +     +++ + E
Sbjct: 149 MKVLRDLIKNDGVQGLWKG-LVPALVGVSQGALHFTCYDTLKHKLV-LKNRDSDEITNLE 206

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                           YP  L++       +NL     S+ +D +  P     L ++   
Sbjct: 207 TIAVTSVSKMLSTSAVYPFQLLK-------SNLQSFQASE-NDFKLLP-----LSKMIYS 253

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
             GL G+Y+G+    L  VP   + F +YE  K+ +
Sbjct: 254 RSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 9/67 (13%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWT--IGRQEGL-RGYYK 286
           G  +G +   +V+P DL + R Q+L    ++ G+R       LW+  +G    L R  Y+
Sbjct: 15  GLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYR------NLWSEIVGSDLSLTRELYR 68

Query: 287 GLTANLV 293
           GLT NLV
Sbjct: 69  GLTVNLV 75

 Score = 34.7 bits (78), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 30  SRTVVSPVERVKILLQ-VQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           S + V P + +K  LQ  Q+S   +   L+   K +Y   G+ G ++G   N LR  P +
Sbjct: 218 STSAVYPFQLLKSNLQSFQASENDFK--LLPLSKMIYSRSGLLGFYKGLSANLLRSVPST 275

Query: 89  AVQYAVYEFCKT 100
            + + +YE  K+
Sbjct: 276 CITFCIYENFKS 287

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 142/318 (44%), Gaps = 68/318 (21%)

Query: 33  VVSPVERVKILLQVQ-------------SSTTAYNG----GLVHAVKQVYKEEGVKGLFR 75
           +V P++  K  LQ Q             S  T + G    G+   +  + ++E ++GL++
Sbjct: 120 IVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYK 179

Query: 76  GNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXX 132
           G     L  FP   + ++VYE CK    R F+  +     + +                 
Sbjct: 180 GIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSAL-------TAGAISTTL 232

Query: 133 TYPLDLVRTRLSIQTA-NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           T P+ +V+TRL +Q+  N+  +   K          ++   +I++ EG ++ +Y G+ P+
Sbjct: 233 TNPIWVVKTRLMLQSGKNIKGMTHYK--------NTLDAFIKIYKVEG-IKSFYSGLIPS 283

Query: 192 SLGVVPFVALNFALYERLKALIPHDYDAG----------------SVAAAKLAIGAV--- 232
             G++  VA++F +YE+LK ++ H Y +G                +  +    +G +   
Sbjct: 284 LFGLL-HVAIHFPVYEKLKKVL-HCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVA 341

Query: 233 ---SGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
              S  IA T+ YP ++LR R Q+    +S++     S+   + T   +EG+RG+Y G  
Sbjct: 342 SCGSKMIASTLTYPHEILRTRLQL----KSDM---KPSIKSIIRTTYAKEGIRGFYSGFL 394

Query: 290 ANLVKVVPAMAVQWFVYE 307
            N+ + VPA A+    +E
Sbjct: 395 TNMFRTVPASAITLVSFE 412

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 13/91 (14%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQ-------------VLTMGQSELGFRYASVADALWTIG 276
           GA++G +A  +V P D+ + R Q             V ++  +  G  Y+ +   L TI 
Sbjct: 110 GALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIV 169

Query: 277 RQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           R E +RG YKG+   ++   P   + + VYE
Sbjct: 170 RDESIRGLYKGIVPIVLGYFPTWMIYFSVYE 200

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + T+  P E ++  LQ++S        +   ++  Y +EG++G + G   N  R  P SA
Sbjct: 349 ASTLTYPHEILRTRLQLKSDMKP---SIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASA 405

Query: 90  VQYAVYEF 97
           +    +E+
Sbjct: 406 ITLVSFEY 413

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 129/284 (45%), Gaps = 28/284 (9%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           VV P++ VK  +Q Q   + Y    +  + ++  +EGV+GL+ G G   + + P  A++ 
Sbjct: 541 VVYPIDMVKTRMQAQRDFSKYKNS-IDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKL 599

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
            V +  +  +   G+ G   L                   T PL++V+ RL +++  +A 
Sbjct: 600 TVNDHMRATL--AGRDGKLSLPC--EIISGATAGACQVVFTNPLEIVKIRLQVKSDYVAD 655

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
             R+  + I     +++ L        GL G YRG     L  +PF A+ F  Y  +K+ 
Sbjct: 656 AARNSVNAI----SVIKNL--------GLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSN 703

Query: 213 I----PHDYDA-GSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVL-TMGQSELGFRY 265
           +    P D D    +   +L + G ++G  A  +  PFD+++ R Q+    G+S     Y
Sbjct: 704 VFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGES----VY 759

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             + DA  TI ++EG++ ++KG  A +++  P        YE+ 
Sbjct: 760 NGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 81/185 (43%), Gaps = 16/185 (8%)

Query: 34  VSPVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
            +P+E VKI LQV+S   A      V+A+  V K  G+ GL+RG G   LR  P+SA+ +
Sbjct: 636 TNPLEIVKIRLQVKSDYVADAARNSVNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAIYF 694

Query: 93  AVYEFCKTRVFHVGQSGHE---QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             Y   K+ VF+      +   +L +W+               T P D+++TRL I    
Sbjct: 695 PTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKK 754

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
              ++           GI +  R I +EE G++ +++G     L   P      A YE  
Sbjct: 755 GESVYN----------GIWDAARTILKEE-GIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

Query: 210 KALIP 214
             L P
Sbjct: 804 HNLFP 808

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
              +G+V+G I   VVYP D+++ R Q     Q +   +Y +  D L  I  +EG+RG Y
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQ----AQRDFS-KYKNSIDCLLKILSKEGVRGLY 581

Query: 286 KGLTANLVKVVPAMAVQWFVYE 307
            GL   L+ V P  A++  V +
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVND 603

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 139/296 (46%), Gaps = 43/296 (14%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFR----GNGINCL--------R 83
           P++ VK+ LQ+ + T     G    VK++ K+      FR    G G+N L         
Sbjct: 28  PLDLVKVRLQLLA-TNKKPQGYYDVVKRIVKDSKQHSFFRETYRGLGVNLLGNSVAWGLY 86

Query: 84  IFPYSAVQYAVYEFCKTRV--FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRT 141
              Y A +  V+++C T V  F+   +  +++ S                 T P+ +++T
Sbjct: 87  FGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKT 146

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           R+   +   ++ +RS           V+ +++++R EG L G++RG+ P+  GV    A+
Sbjct: 147 RIMSTSFVDSRSYRST----------VDGIKKLYRIEG-LAGFWRGLVPSLFGVSQG-AI 194

Query: 202 NFALYERLKALIPHDYDAGSVAAAK-------LAIGAVSGGIAQTVVYPFDLLR---RRF 251
            F +Y+ LK    H + A  V   K       + I ++S  ++ T VYP  LL+   + F
Sbjct: 195 YFTVYDTLKY---HYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSF 251

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +V T+   +   R   V   + TI  ++G+ G YKGL ANL++ VP+  + + VYE
Sbjct: 252 EVSTVINPKTSHR---VWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYE 304

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 81/195 (41%), Gaps = 36/195 (18%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE---EGGLRGWYRGVY 189
           T+PLDLV+ RL +   N            ++P G  ++++RI ++       R  YRG+ 
Sbjct: 26  THPLDLVKVRLQLLATN------------KKPQGYYDVVKRIVKDSKQHSFFRETYRGLG 73

Query: 190 PTSLGVVPFVALNFALY---------------ERLKALIPHDYDAGSVAAAKLAIGAVSG 234
              LG      L F LY               +R    + +D +  S+    L   A+SG
Sbjct: 74  VNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY--LLAAAMSG 131

Query: 235 GIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
                +  P  +++ R    +   S     Y S  D +  + R EGL G+++GL  +L  
Sbjct: 132 VATSVLTNPIWVIKTRIMSTSFVDSR---SYRSTVDGIKKLYRIEGLAGFWRGLVPSLFG 188

Query: 295 VVPAMAVQWFVYELI 309
           V    A+ + VY+ +
Sbjct: 189 VSQG-AIYFTVYDTL 202

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 14/156 (8%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF---HVGQSGHEQLR 114
           V  +K++Y+ EG+ G +RG  +  L      A+ + VY+  K   F   HV +   ++L 
Sbjct: 163 VDGIKKLYRIEGLAGFWRG-LVPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKK--KKLS 219

Query: 115 SWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRI 174
           + E                YPL L++       +NL     S   + +    + +L+  I
Sbjct: 220 NLEYITITSLSKMVSVTAVYPLQLLK-------SNLQSFEVSTVINPKTSHRVWKLITTI 272

Query: 175 FREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           +  +G + G Y+G+    +  VP   + F +YE  +
Sbjct: 273 YVRDG-VTGLYKGLLANLIRAVPSTCITFCVYENFR 307

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 119/270 (44%), Gaps = 37/270 (13%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLR 114
           V  +  VY++EG + LF+G G N + + P  ++ +  Y   K   ++ F+ GQ       
Sbjct: 124 VSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEA----- 178

Query: 115 SWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRI 174
            W                T P+ +V+TR+ +  A   + +++            + L+ I
Sbjct: 179 PWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNS----------YDCLKSI 228

Query: 175 FREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP---------HDYDAGSVAAA 225
            R EG + G YRG+  + LG V  + L + LYE+LK LI          HD    +    
Sbjct: 229 LRNEG-IYGLYRGLSASYLGSVEGI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDK 286

Query: 226 KLAIGAVSGG------IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQE 279
                  SGG      +A  V YP +++R R +   +   ++  +Y  +  +   I ++E
Sbjct: 287 IKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKV--KYTGLVQSFRVIIKEE 344

Query: 280 GLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           GL   Y GLT +L++ VP   + +  +E++
Sbjct: 345 GLASMYSGLTPHLMRTVPNSIIMFGTWEVV 374

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 22/89 (24%)

Query: 240 VVYPFDLLRRRFQ-------------VLTMGQS---------ELGFRYASVADALWTIGR 277
           V  PFDL++ R Q              L M  +         +    +      +  + R
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           QEG R  +KGL  NLV V+PA ++ +F Y
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTY 161

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYE 96
           GLV + + + KEEG+  ++ G   + +R  P S + +  +E
Sbjct: 332 GLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWE 372

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 126/283 (44%), Gaps = 25/283 (8%)

Query: 36  PVERVKILLQVQSSTTAYNG----GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           P++ +K+ +Q+   + A  G    G +   + +Y EEG+  L++G G   + I P  A++
Sbjct: 30  PLDTIKVRMQIYRRS-ALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIR 88

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           ++ YEF ++ +    Q+G     +                   P+++V+ RL  Q     
Sbjct: 89  FSSYEFYRSALAD-KQTGSVSTGN-TFLAGVGAGTTEAVLVVNPMEVVKIRLQAQ----- 141

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
            LH   A   R    + +    I +EEG +   YRGV  T+         NF +Y +LK 
Sbjct: 142 HLHPETAASPRYRNAL-QACYLIVKEEG-IGALYRGVSLTAARQATNQGANFTVYSKLKE 199

Query: 212 LIPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVAD 270
            +   +   ++ + + + IG +SG I      P D ++ R Q      +  G+       
Sbjct: 200 FLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGW------S 253

Query: 271 ALWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            + TIG+Q    EG R  YKG+T  +++V P  AV + VYE +
Sbjct: 254 RIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 296

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 86/176 (48%), Gaps = 13/176 (7%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +PLD ++ R+ I        +R  A +  +PPG ++  R I+ EEG L   Y+G+    +
Sbjct: 29  HPLDTIKVRMQI--------YRRSALEGIKPPGFIKTGRNIYTEEG-LLALYKGLGAVVI 79

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT--VVYPFDLLRRRF 251
           G++P +A+ F+ YE  ++ +  D   GSV+     +  V  G  +   VV P ++++ R 
Sbjct: 80  GIIPKMAIRFSSYEFYRSALA-DKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRL 138

Query: 252 QVLTM-GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           Q   +  ++    RY +   A + I ++EG+   Y+G++    +        + VY
Sbjct: 139 QAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVY 194

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 80/183 (43%), Gaps = 23/183 (12%)

Query: 33  VVSPVERVKILLQVQ------SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           VV+P+E VKI LQ Q      +++  Y   L  A   + KEEG+  L+RG  +   R   
Sbjct: 127 VVNPMEVVKIRLQAQHLHPETAASPRYRNAL-QACYLIVKEEGIGALYRGVSLTAARQAT 185

Query: 87  YSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL--S 144
                + VY   K + F       + L SWE                 PLD ++TRL   
Sbjct: 186 NQGANFTVYS--KLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 243

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
             TAN++   R           IV + +++ +EE G R  Y+G+ P  + V P  A+ F 
Sbjct: 244 KSTANMSGWSR-----------IVTIGKQLIKEE-GFRALYKGITPRVMRVAPGQAVTFT 291

Query: 205 LYE 207
           +YE
Sbjct: 292 VYE 294

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 35  SPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +P++ +K  LQ   ST   +G   +V   KQ+ KEEG + L++G     +R+ P  AV +
Sbjct: 231 APLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTF 290

Query: 93  AVYEFCKTRVFHVG 106
            VYEF +  +  +G
Sbjct: 291 TVYEFVREHLETLG 304

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           S  A  L  G  +G       +P D ++ R Q+      E G +          I  +EG
Sbjct: 8   SNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALE-GIKPPGFIKTGRNIYTEEG 66

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           L   YKGL A ++ ++P MA+++  YE 
Sbjct: 67  LLALYKGLGAVVIGIIPKMAIRFSSYEF 94

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 127/284 (44%), Gaps = 25/284 (8%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           T+V P++ VK  +Q Q S + Y    +    ++   EG++G++ G G   + + P  A++
Sbjct: 559 TIVYPIDFVKTRMQAQRSLSQYKNS-IDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIK 617

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
             V ++ + ++    +  + +L                   T PL++V+ RL ++   +A
Sbjct: 618 LTVNDYMRNKL----KDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVA 673

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK- 210
           +     A + +     +++++R+     GL G Y+G     L  VPF A+ F  Y  LK 
Sbjct: 674 E----NAENAKLTA--LQIIKRL-----GLPGLYKGAAACLLRDVPFSAIYFPTYAHLKR 722

Query: 211 ---ALIPHDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
                 P+D +  S       L+ GA++G  A  +  PFD+++ R Q+       +   Y
Sbjct: 723 DLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI---Y 779

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             +  A  TI R+E  + ++KG  A +++  P        YEL 
Sbjct: 780 KGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 17/191 (8%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVK-QVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
            +P+E VKI LQV+    A N         Q+ K  G+ GL++G     LR  P+SA+ +
Sbjct: 655 TNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYF 714

Query: 93  AVYEFCKTRVFHV---GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             Y   K  +F+     ++   +L +WE               T P D+++TRL I    
Sbjct: 715 PTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKK 774

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
              +++          GI+   R I REE   + +++G     L   P      A YE  
Sbjct: 775 GETIYK----------GIIHAARTILREE-SFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

Query: 210 KAL--IPHDYD 218
             +  +P+D D
Sbjct: 824 HNIFPLPNDKD 834

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
             ++G+V+G I  T+VYP D ++ R Q     Q  L  +Y +  D    I  +EG+RG Y
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQ----AQRSLS-QYKNSIDCFLKILSREGIRGVY 600

Query: 286 KGLTANLVKVVPAMAVQWFVYE 307
            GL   L+ V P  A++  V +
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVND 622

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 117/285 (41%), Gaps = 33/285 (11%)

Query: 31  RTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
            +V+ P++ +K  +Q  ++ +     ++  +  +   EG   L++G     L   P  AV
Sbjct: 48  HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            +  YEFCK  +  +  S  +    ++                 P D ++ R+ + T+  
Sbjct: 108 YFGTYEFCKKNL--IDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTS-- 163

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFALYE-R 208
                           + +  ++I++ EG    +Y   YPT+L + +PF A NF +YE  
Sbjct: 164 --------------ASVWQTTKQIYQSEGLAAFYYS--YPTTLVMNIPFAAFNFVIYESS 207

Query: 209 LKALIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYAS 267
            K L P ++Y+           G++SG     +  P D ++   Q+   G   +      
Sbjct: 208 TKFLNPSNEYN----PLIHCLCGSISGSTCAAITTPLDCIKTVLQI--RGSQTVSLEIMR 261

Query: 268 VAD----ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            AD    A   I +  G +G+++G    +V  +PA A+ W  YE 
Sbjct: 262 KADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYEC 306

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/184 (19%), Positives = 73/184 (39%), Gaps = 16/184 (8%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S  +++P + +K  +Q+ +S + +        KQ+Y+ EG+   +       +   P++A
Sbjct: 144 SDALMNPFDTIKQRIQLNTSASVW-----QTTKQIYQSEGLAAFYYSYPTTLVMNIPFAA 198

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             + +YE   T+  +     +  +                   T PLD ++T L I+ + 
Sbjct: 199 FNFVIYE-SSTKFLNPSNEYNPLIHC----LCGSISGSTCAAITTPLDCIKTVLQIRGSQ 253

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
              L      +I R             +  G +G++RG  P  +  +P  A+++  YE  
Sbjct: 254 TVSL------EIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECA 307

Query: 210 KALI 213
           K  +
Sbjct: 308 KHFL 311

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 76.3 bits (186), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 120/284 (42%), Gaps = 32/284 (11%)

Query: 31  RTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
            +V+ PV+ +K  +Q  SS+ A   GL+  + ++   EG   L++G     L   P  AV
Sbjct: 31  HSVLFPVDAIKTRIQ-SSSSGAATQGLIKQISKITTAEGSLALWKGVQSVILGAGPAHAV 89

Query: 91  QYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
            +A YEF K+++        H+ +++                   P D+++ R+ + T  
Sbjct: 90  YFATYEFSKSKLIDPQDMHTHQPIKT---AISGMAATTVADALMNPFDVIKQRMQLNTRE 146

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFALYER 208
                            +  + + I+ +EG    +Y   YPT+L + +PF A NFA+YE 
Sbjct: 147 ----------------SVWHVTKNIYHKEGFAAFYYS--YPTTLVMNIPFAAFNFAIYES 188

Query: 209 LKALI--PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV--LTMGQSELGFR 264
               +   ++Y+           G +SG     +  P D ++   QV       +E+  +
Sbjct: 189 ATKFMNPSNEYN----PFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQ 244

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             +   A   I +  G +G+ +GL   ++  +PA A+ W  YE 
Sbjct: 245 ANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYEC 288

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 6/73 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYN------GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           + +P++ +K +LQV+ S T  N           A   +YK  G KG  RG     +   P
Sbjct: 218 ITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMP 277

Query: 87  YSAVQYAVYEFCK 99
            +A+ +  YE  K
Sbjct: 278 ATAISWTSYECAK 290

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXX 120
           +  VY+ EG + LF+G G N + + P  ++ +  Y   K        +G E +  W    
Sbjct: 118 ISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAV--WIHLM 175

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG 180
                       T P+ LV+TRL +  A   K +++            + L+ + ++EG 
Sbjct: 176 AAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSW----------DCLKNVVQKEGI 225

Query: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY--DAGSVAAAKLAIG-------- 230
           L G Y+G+  + LG V  + L + LYE++K +I        G+++  + +          
Sbjct: 226 L-GLYKGLSASYLGSVEGI-LQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQ 283

Query: 231 -AVSGGIAQ----TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
            + S G+A+     + YP +++R R +   +   +L  +Y  +  ++  I ++EGL   Y
Sbjct: 284 RSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKL--KYTGLVQSIRVIIKEEGLASMY 341

Query: 286 KGLTANLVKVVPAMAVQWFVYELI 309
            GLT +L++ VP   + +  +EL+
Sbjct: 342 GGLTPHLLRTVPNSIIMFGTWELV 365

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 83/191 (43%), Gaps = 24/191 (12%)

Query: 30  SRTVVSPVERVKILLQV-QSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           + T  +P+  VK  LQ+ ++ TT         +K V ++EG+ GL++G   + L      
Sbjct: 184 TSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVE-G 242

Query: 89  AVQYAVYEFCKT-----------RVFHVGQSGHEQLRSW-ERXXXXXXXXXXXXXXTYPL 136
            +Q+ +YE  K             +  V +S  ++++ W +R              TYP 
Sbjct: 243 ILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPH 302

Query: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196
           ++VRTRL        KL  +         G+V+ +R I +EEG L   Y G+ P  L  V
Sbjct: 303 EVVRTRLRQAPLENGKLKYT---------GLVQSIRVIIKEEG-LASMYGGLTPHLLRTV 352

Query: 197 PFVALNFALYE 207
           P   + F  +E
Sbjct: 353 PNSIIMFGTWE 363

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 17/84 (20%)

Query: 240 VVYPFDLLRRRFQ-----------VLTMGQSELGFRYASVADALWTIG------RQEGLR 282
           V  PFD+++ R Q             ++G ++       V     T G      R EG R
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 283 GYYKGLTANLVKVVPAMAVQWFVY 306
             +KGL  NLV V+PA ++ +F Y
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTY 152

>Kwal_33.14050
          Length = 314

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 118/289 (40%), Gaps = 32/289 (11%)

Query: 31  RTVVSPVERVKILLQVQSST-------TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
            +++ P++ +K  +Q  S+T             +V  + ++   EG   L++G     L 
Sbjct: 31  HSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILG 90

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQ-SGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTR 142
             P  AV +A YE CK+ +        H+ L++                   P D ++ R
Sbjct: 91  AGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKT---AASGIAATVAADLLMNPFDTIKQR 147

Query: 143 LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVAL 201
           + ++T +  ++                +  RI+R EG    +Y   YPT++ + +PF A 
Sbjct: 148 MQLRTFSKDRMW--------------SVASRIYRNEGLAAFFYS--YPTTIAMNIPFAAF 191

Query: 202 NFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL-TMGQSE 260
           NFA+YE        +     +       G +SG     +  P D ++   QV  +    +
Sbjct: 192 NFAIYESATKFFNPENTYNPLI--HCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVD 249

Query: 261 LGFRYA-SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             FR A + + A   I +  G  G+++GL   ++  +PA A+ W  YE 
Sbjct: 250 PLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYEC 298

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVL--TMGQSELGFRYAS-VADALWTIGRQEGLR 282
           +LA GA +G +  ++++P D ++ R Q L  T+G +    +  S +   +  I   EG  
Sbjct: 19  QLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSM 78

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYEL 308
             +KG+ + ++   PA AV +  YE+
Sbjct: 79  ALWKGVQSVILGAGPAHAVYFATYEM 104

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 73/180 (40%), Gaps = 18/180 (10%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +++P + +K  +Q++   T     +     ++Y+ EG+   F           P++A  +
Sbjct: 137 LMNPFDTIKQRMQLR---TFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNF 193

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN--L 150
           A+YE   T+ F+   + +  +                   T PLD ++T L ++ +   +
Sbjct: 194 AIYE-SATKFFNPENTYNPLIHC----LCGGISGATCAAITTPLDCIKTVLQVRGSESVV 248

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
             L R      R    I ++         G  G++RG+ P  +  +P  A+++  YE  K
Sbjct: 249 DPLFRQADTFSRAASAISKVY--------GWSGFWRGLKPRIISNMPATAISWTAYECAK 300

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 33  VVSPVERVKILLQVQSSTTAYN------GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           + +P++ +K +LQV+ S +  +           A   + K  G  G +RG     +   P
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMP 287

Query: 87  YSAVQYAVYEFCKTRVFHVG 106
            +A+ +  YE  K  +F+ G
Sbjct: 288 ATAISWTAYECAKHTLFNYG 307

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 121/275 (44%), Gaps = 22/275 (8%)

Query: 44  LQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF 103
           L  ++S+  +NG L  A  ++   EG+  L+RG  +  L   P + V ++ YE+   R  
Sbjct: 93  LHCKNSSLKFNGTL-EAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEY--IRDV 149

Query: 104 HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL-SIQTANLAKLHRSKAHDIR 162
               S +  L                     PL+LV+T+L SI  ++ +        D+ 
Sbjct: 150 SPIASTYPTLNP---LFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDL- 205

Query: 163 RPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY----- 217
                +   R+  +  G  R  ++G+  T    VPF A+ ++ YE  K  +  D      
Sbjct: 206 -----LNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFAS 260

Query: 218 -DAGSVA-AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL--GFRYASVADALW 273
            DA  V      A G +SG IA    +PFD+ + R+Q+  M  S+   G R  ++   L 
Sbjct: 261 KDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLE 320

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           TI R EGL   Y GL A ++K+ P+ A+    YE+
Sbjct: 321 TIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 75/187 (40%), Gaps = 17/187 (9%)

Query: 32  TVVSPVERVKILLQV------QSSTTAYNGGLVHAVKQVYKEEG-VKGLFRGNGINCLRI 84
           T ++P+E VK  LQ        + T      L++  +Q  K  G  + LF+G  I   R 
Sbjct: 174 TSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRD 233

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW----ERXXXXXXXXXXXXXXTYPLDLVR 140
            P+SA+ ++ YE CK R++        +  +W                    T+P D+ +
Sbjct: 234 VPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGK 293

Query: 141 TRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVA 200
           TR  I   N      S      R   + + L  I+R E GL   Y G+    + + P  A
Sbjct: 294 TRWQISMMN-----NSDPKGGNRSRNMFKFLETIWRTE-GLAALYTGLAARVIKIRPSCA 347

Query: 201 LNFALYE 207
           +  + YE
Sbjct: 348 IMISSYE 354

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 115/267 (43%), Gaps = 38/267 (14%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLRSWE 117
           +  VY++EG + LF+G G N + + P  ++ +  Y   K   +R  + GQ        W 
Sbjct: 117 IGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEA-----PWI 171

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                          T P+ LV+TRL +  A       S           ++ ++ + + 
Sbjct: 172 HLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNS-----------LDCIKSVVKN 220

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP--------HDYDAGSVAAAKLAI 229
           EG L G Y+G+  + LG V  + L + LYE++K +I         H ++     + K+  
Sbjct: 221 EGVL-GLYKGLSASYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKE 278

Query: 230 GAVSGG-------IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
                G       +A  V YP +++R R +       +L  +Y  +  +   I ++EGL 
Sbjct: 279 WCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKL--KYTGLVQSFRVIIKEEGLV 336

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYELI 309
             Y GLT +L++ VP   + +  +EL+
Sbjct: 337 SMYSGLTPHLLRTVPNSIIMFGTWELV 363

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 85/197 (43%), Gaps = 25/197 (12%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRG---------NGIN 80
           + TV +P+  VK  LQ+  + T      +  +K V K EGV GL++G          GI 
Sbjct: 183 TSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGI- 241

Query: 81  CLRIFPYSAVQYAVYEFCKTRVFHV---GQSGHEQLRSW-ERXXXXXXXXXXXXXXTYPL 136
            L+   Y  ++  + E    +  H+    +S  ++++ W +R              TYP 
Sbjct: 242 -LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPH 300

Query: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196
           ++VRTRL        KL  +         G+V+  R I +EE GL   Y G+ P  L  V
Sbjct: 301 EVVRTRLRQAPTENGKLKYT---------GLVQSFRVIIKEE-GLVSMYSGLTPHLLRTV 350

Query: 197 PFVALNFALYERLKALI 213
           P   + F  +E +  L+
Sbjct: 351 PNSIIMFGTWELVIKLL 367

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 18/85 (21%)

Query: 240 VVYPFDLLRRRFQ------------VLTMGQSELGFRYASVADALWTIG------RQEGL 281
           V  PFD+++ R Q            +   G S L F   S+     T G      RQEG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 282 RGYYKGLTANLVKVVPAMAVQWFVY 306
           R  +KGL  NLV V+PA ++ +  Y
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTY 151

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 130/297 (43%), Gaps = 40/297 (13%)

Query: 30  SRTVVSPVERVKILLQVQSST--TAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           +R++ +P++ +KI LQ+  +     +   ++   + + K EG++  ++GN    L    Y
Sbjct: 30  ARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTY 89

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
            + Q++ Y      +   G     +L S                 +YP D++RTRL    
Sbjct: 90  GSAQFSSYSLFNRYLTPFGLEA--RLHS---LVVGAFAGITSSIVSYPFDVLRTRL---V 141

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
           AN      ++ H +     I   +R I++ EG L G+++G   +   +    ++ F  YE
Sbjct: 142 AN------NQMHSM----SITREVRDIWKLEG-LPGFFKGSIASMTTITLTASIMFGTYE 190

Query: 208 RLKALIPHDYDAGSVAAAKL--------AIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
            ++  I  D +  + AA K         + G + G IA+ + +P + +RRR Q +     
Sbjct: 191 TIR--IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHL 248

Query: 260 ELGFRYASVADALWTIG---------RQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           E   R++SV  +    G         +QEG+   Y+G+   L K +P   V ++ YE
Sbjct: 249 EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 83/178 (46%), Gaps = 20/178 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P+D ++ RL +  AN  K   S+         ++E+ R + + EG +R +++G  P S
Sbjct: 34  TAPMDTIKIRLQLTPANGLKPFGSQ---------VMEVARSMIKNEG-IRSFWKGNIPGS 83

Query: 193 LGVVPFVALNFALYERL-KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRF 251
           L  V + +  F+ Y    + L P   +A       L +GA +G  +  V YPFD+LR R 
Sbjct: 84  LLYVTYGSAQFSSYSLFNRYLTPFGLEA---RLHSLVVGAFAGITSSIVSYPFDVLRTRL 140

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
                  S       S+   +  I + EGL G++KG  A++  +    ++ +  YE I
Sbjct: 141 VANNQMHS------MSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 221 SVAAAK-LAIGAVSGGIAQTVVYPFDLLRRRFQVL-TMGQSELGFRYASVADALWTIGRQ 278
           +VAA K L  GAVSG +A+++  P D ++ R Q+    G    G +   VA ++    + 
Sbjct: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI---KN 69

Query: 279 EGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
           EG+R ++KG     +  V   + Q+  Y L +
Sbjct: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFN 101

>Kwal_27.12081
          Length = 369

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 116/267 (43%), Gaps = 37/267 (13%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLRSWE 117
           +  +YK EG + LF+G G N + + P  ++ +  Y   K   +R F+ G+        W 
Sbjct: 115 ISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEA-----PWI 169

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                          T P+ L++TRL +           KA   R+     + L+ I ++
Sbjct: 170 HLISAATAGWATSTATNPIWLIKTRLQLD----------KAGHTRQYKNSWDCLKHIIQK 219

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP--------HDYDAGSVAAAKLAI 229
           EG   G Y+G+  + LG V  + L + LYE++K +I         H  +     + K+  
Sbjct: 220 EG-FFGLYKGLSASYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKE 277

Query: 230 GAVSGG-------IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
                G       +A  V YP +++R R +   +   +L  +Y  +  +   I ++EGL 
Sbjct: 278 WCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKL--KYTGLIQSFRVIIKEEGLA 335

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYELI 309
             Y GLT +L++ VP   + +  +EL+
Sbjct: 336 SMYGGLTPHLLRTVPNSIIMFGTWELV 362

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 26/198 (13%)

Query: 30  SRTVVSPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           + T  +P+  +K  LQ+  +  T  Y       +K + ++EG  GL++G   + L     
Sbjct: 181 TSTATNPIWLIKTRLQLDKAGHTRQYKNSW-DCLKHIIQKEGFFGLYKGLSASYLGSVE- 238

Query: 88  SAVQYAVYEFCK--TRVFHVGQSGH---------EQLRSW-ERXXXXXXXXXXXXXXTYP 135
             +Q+ +YE  K   ++  + + GH         E+++ W +R              TYP
Sbjct: 239 GILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYP 298

Query: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV 195
            ++VRTRL  + A L        +D  +  G+++  R I +EEG L   Y G+ P  L  
Sbjct: 299 HEVVRTRL--RQAPLE-------NDKLKYTGLIQSFRVIIKEEG-LASMYGGLTPHLLRT 348

Query: 196 VPFVALNFALYERLKALI 213
           VP   + F  +E +  L+
Sbjct: 349 VPNSIIMFGTWELVIKLL 366

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 14/81 (17%)

Query: 240 VVYPFDLLRRRFQVLTMGQSELGFRYASVADALW--------TIG------RQEGLRGYY 285
           V  PFD+++ R Q      +     +   ++ +         T G      + EG R  +
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 286 KGLTANLVKVVPAMAVQWFVY 306
           KGL  NLV V+PA ++ +F Y
Sbjct: 129 KGLGPNLVGVIPARSINFFTY 149

>Scas_645.9
          Length = 391

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 123/282 (43%), Gaps = 34/282 (12%)

Query: 44  LQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF 103
           L  ++S+  +NG L  A  +++K EG+  L+RG  IN L   P + V +  YE+ +    
Sbjct: 120 LNCKNSSVRFNGTL-EAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 104 HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRR 163
               S      ++                  PL+L++T+L     ++ ++ +S    +  
Sbjct: 179 LATSSP-----TFNPLMCGAIARILAASTVAPLELLKTKLQ----SIPRVSKSTTSWMM- 228

Query: 164 PPGIVELL---RRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAG 220
              + ELL   R+  R  G     ++G+  T    VPF A+ +  YE  K    H +   
Sbjct: 229 ---VKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKT---HLWMDT 282

Query: 221 SVAAAKLAI-------GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGF-------RYA 266
           S + + L         G++SG IA  V +PFD+ + R+Q+  MG ++          +  
Sbjct: 283 SKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTK 342

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           ++   L  I + EG    Y GL   +VK+ P+ A+    YEL
Sbjct: 343 NMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYEL 384

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 83/197 (42%), Gaps = 25/197 (12%)

Query: 32  TVVSPVERVKILLQ----VQSSTTAYNGGLVHAVKQVYKEE--------GVKGLFRGNGI 79
           + V+P+E +K  LQ    V  STT++       VK++ KE             LF+G  I
Sbjct: 201 STVAPLELLKTKLQSIPRVSKSTTSW-----MMVKELLKETRQEMRISGASNALFKGLEI 255

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW-ERXXXXXXXXXXXXXXTYPLDL 138
              R  P+SA+ +  YEFCKT ++      H  L  +                 T+P D+
Sbjct: 256 TLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDV 315

Query: 139 VRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGW---YRGVYPTSLGV 195
            +TR  I           K+ DI +   + + LR I++    L GW   Y G+ P  + +
Sbjct: 316 GKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWK----LEGWGALYTGLVPRMVKI 371

Query: 196 VPFVALNFALYERLKAL 212
            P  A+  + YE  K L
Sbjct: 372 APSCAIMISSYELSKRL 388

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           FQ L    S +  R+    +A   I + EG+   ++G++ NL+  +PA  V +  YE
Sbjct: 117 FQELNCKNSSV--RFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE 171

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 120/294 (40%), Gaps = 51/294 (17%)

Query: 45  QVQSSTTAYNGGLVH------AVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFC 98
           Q  + T     GL+H       ++ VY +EG + LF+G G N + + P  ++ +  Y   
Sbjct: 89  QATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVT 148

Query: 99  KTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKA 158
           K     +   G E    W                T P+ LV+TRL +  A   +  R K 
Sbjct: 149 KDTASRLLNDGQEA--PWIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKN 206

Query: 159 HDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH--- 215
                     + L+ + R EG L G Y+G+  + LG V  + L + LYE++K +I     
Sbjct: 207 S--------WDCLKGVMRNEGIL-GLYKGLSASYLGSVESI-LQWVLYEQMKHIIRQRSI 256

Query: 216 ----DYD----------------AGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLT 255
               D                  +GS  AAKL         A  + YP +++R R +   
Sbjct: 257 EEFGDISEENKTTYMKVKEWCQRSGSAGAAKL--------FASILTYPHEVVRTRLRQAP 308

Query: 256 MGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
               +L  +Y  +  +   I ++EG    Y GLT +L++ VP   + +  +EL+
Sbjct: 309 KENGKL--KYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELV 360

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 13/77 (16%)

Query: 243 PFDLLRRRFQV-------LTMGQSELGFRYASVADALWTIG------RQEGLRGYYKGLT 289
           PFD+++ R Q         T   +     Y  +     T+G       QEG R  +KGL 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 290 ANLVKVVPAMAVQWFVY 306
            NLV V+PA ++ +F Y
Sbjct: 129 PNLVGVIPARSINFFTY 145

>Kwal_47.17321
          Length = 881

 Score = 75.1 bits (183), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 127/285 (44%), Gaps = 28/285 (9%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           T V P++ VK  +Q Q + + Y   +   VK ++  EG++G++ G G   + + P  A++
Sbjct: 516 TAVYPIDLVKTRMQAQRNFSQYKNSIDCFVK-IFSREGIRGIYSGLGPQLVGVAPEKAIK 574

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
             V ++ +  +       + +L                   T PL++V+ RL +++    
Sbjct: 575 LTVNDYVRKLL----MDENNRLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYAD 630

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
            L +S+   +    G+V+ L        GLRG Y+G+    +  VPF A+ F  Y  LK 
Sbjct: 631 SLPKSQLTAL----GVVKSL--------GLRGLYKGLVACLMRDVPFSAIYFPTYAHLKR 678

Query: 212 LI----PHDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQVLT-MGQSELGFR 264
            I    P D +  +       L  G ++G  A  +  PFD+++ R Q+    G++    R
Sbjct: 679 DIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET----R 734

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           Y  +  A  TI ++E  + ++KG  A +++  P        YE+ 
Sbjct: 735 YTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIF 779

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 229 IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
           +G+V+G I  T VYP DL++ R Q     Q     +Y +  D    I  +EG+RG Y GL
Sbjct: 506 LGSVAGCIGATAVYPIDLVKTRMQ----AQRNFS-QYKNSIDCFVKIFSREGIRGIYSGL 560

Query: 289 TANLVKVVPAMAVQWFVYELI 309
              LV V P  A++  V + +
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYV 581

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 76/188 (40%), Gaps = 22/188 (11%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYA 93
            +P+E VKI LQV+S               V K  G++GL++G     +R  P+SA+ + 
Sbjct: 612 TNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFP 671

Query: 94  VYEFCKTRVFHV---GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            Y   K  +F+     ++   +L +WE               T P D+++TRL I     
Sbjct: 672 TYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQI----- 726

Query: 151 AKLHRSKAHDIR----RPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
                    D R    R  GI+   R I +EE   + +++G     L   P      A Y
Sbjct: 727 ---------DPRKGETRYTGILHAARTILKEE-RFKSFFKGGGARVLRSSPQFGFTLAAY 776

Query: 207 ERLKALIP 214
           E  + + P
Sbjct: 777 EIFQNMFP 784

>Scas_582.7
          Length = 329

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 37/283 (13%)

Query: 36  PVERVKILLQVQSSTTA----YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           P++ +K   ++QS+TT      +  ++  + ++   EG   L++G     L   P  AV 
Sbjct: 56  PIDALKT--RIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVY 113

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +A YEF K  +  +  S  E  +  +                 P D ++ R+ I     +
Sbjct: 114 FATYEFTKAHL--IPDSQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQI-----S 166

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFALYERLK 210
            L + K +++ +         +I+  EG L  +Y   YPT++ + +PF A NF +YE   
Sbjct: 167 DLKKEKVYNVAK---------KIYNLEG-LSAFYYS-YPTTIAMNIPFAAFNFMIYESAS 215

Query: 211 ALIP--HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV 268
                 H Y+           G +SG IA  V  P D ++   Q+   G S +       
Sbjct: 216 KFFNPLHHYNP----LIHCLCGGISGAIAAAVTTPLDCIKTVIQI--RGSSVVSLEVMKK 269

Query: 269 AD----ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           A+    A   I    G +G+++GL   ++  +PA A+ W  YE
Sbjct: 270 ANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 18/178 (10%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +P+D ++TR+   T    +         +    I++ + +I   EG L  W +GV    L
Sbjct: 55  FPIDALKTRIQSTTTKGTE---------QTSTSIIKQISKISTMEGSLALW-KGVQSVIL 104

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTV-VYPFDLLRRRFQ 252
           G  P  A+ FA YE  KA +  D    +    K+A+   +  +A    + PFD +++R Q
Sbjct: 105 GAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQ 164

Query: 253 VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
           +  + + ++     +VA  ++ +   EGL  +Y      +   +P  A  + +YE  S
Sbjct: 165 ISDLKKEKV----YNVAKKIYNL---EGLSAFYYSYPTTIAMNIPFAAFNFMIYESAS 215

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 75/183 (40%), Gaps = 20/183 (10%)

Query: 34  VSPVERVKILLQVQS--STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           ++P + +K  +Q+        YN       K++Y  EG+   +           P++A  
Sbjct: 153 MNPFDTIKQRMQISDLKKEKVYN-----VAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFN 207

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           + +YE   ++ F+     +  +                   T PLD ++T + I+ +++ 
Sbjct: 208 FMIYE-SASKFFNPLHHYNPLIHC----LCGGISGAIAAAVTTPLDCIKTVIQIRGSSVV 262

Query: 152 KLH-RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            L    KA+  ++    + ++        G +G++RG+ P  L  +P  A+++  YE  K
Sbjct: 263 SLEVMKKANTFKKATSAILMVY-------GWKGFWRGLQPRILANMPATAISWTAYECAK 315

Query: 211 ALI 213
             +
Sbjct: 316 HFL 318

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGS----VAAAKLA 228
           ++++ EG L  W RGV P+ LGV    A+ FALY+ LK    H     +      +  + 
Sbjct: 159 KLYQTEGVLAFW-RGVVPSLLGVSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIG 216

Query: 229 IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
           I  +S  I+ T VYPF LL+ + Q       + G   + +   + T+  +EG+RG+Y+GL
Sbjct: 217 ITCISKMISVTSVYPFQLLKSKLQ-------DFGAP-SGITQLVQTVYSREGIRGFYRGL 268

Query: 289 TANLVKVVPAMAVQWFVYELI 309
           +ANL++ VPA  + +FVYE I
Sbjct: 269 SANLLRAVPATCITFFVYENI 289

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 17/178 (9%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           + +P+  +K  +   S    Y       V ++Y+ EGV   +RG   + L +    A+ +
Sbjct: 130 LTNPIWVIKTRIMATSRAGPYKSTF-DGVYKLYQTEGVLAFWRGVVPSLLGV-SQGAIYF 187

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
           A+Y+  K    H      E+  S                    +  +   +S+ +    +
Sbjct: 188 ALYDTLKFHYLHSSTDKAERRLSVSEIIG--------------ITCISKMISVTSVYPFQ 233

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           L +SK  D   P GI +L++ ++  EG +RG+YRG+    L  VP   + F +YE +K
Sbjct: 234 LLKSKLQDFGAPSGITQLVQTVYSREG-IRGFYRGLSANLLRAVPATCITFFVYENIK 290

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S T V P + +K  LQ   + +    G+   V+ VY  EG++G +RG   N LR  P + 
Sbjct: 225 SVTSVYPFQLLKSKLQDFGAPS----GITQLVQTVYSREGIRGFYRGLSANLLRAVPATC 280

Query: 90  VQYAVYEFCKTRV 102
           + + VYE  K R+
Sbjct: 281 ITFFVYENIKYRL 293

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 14/135 (10%)

Query: 170 LLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL----IPHDYDAG----S 221
           L+R IF  +   R  YRG+    LG     AL F  Y   K +    + ++   G     
Sbjct: 51  LIRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRR 110

Query: 222 VAAAKLAIGAVSGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           + A    + A S GIA  V+  P  +++ R     M  S  G  Y S  D ++ + + EG
Sbjct: 111 LPAHAYMLAAGSSGIATAVLTNPIWVIKTRI----MATSRAG-PYKSTFDGVYKLYQTEG 165

Query: 281 LRGYYKGLTANLVKV 295
           +  +++G+  +L+ V
Sbjct: 166 VLAFWRGVVPSLLGV 180

>Scas_721.27
          Length = 374

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 114/265 (43%), Gaps = 37/265 (13%)

Query: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK---TRVFHVGQSGHEQLRSWERX 119
            VYK EG + LF+G G N + + P  ++ +  Y   K   ++ F+ GQ            
Sbjct: 124 NVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQE-----TPLIHL 178

Query: 120 XXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEG 179
                        T P+ +++TR+ +           KA   R+     + L+ + + EG
Sbjct: 179 MSAATAGWATSTATNPIWMIKTRVQLD----------KAGTTRKYKNSWDCLKTVLKSEG 228

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP--------HDYDAGSVAAAKL---- 227
            + G YRG+  + LG +  + L + LYE++K LI         H+         K+    
Sbjct: 229 -IYGLYRGLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWC 286

Query: 228 ---AIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284
                  V+  IA  V YP +++R R + + M   +   +Y  +  +   I ++EGL   
Sbjct: 287 QRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKP--KYTGLVQSFRVIIKEEGLASM 344

Query: 285 YKGLTANLVKVVPAMAVQWFVYELI 309
           Y GLT +L++ VP   + +  +EL+
Sbjct: 345 YSGLTPHLMRTVPNSIIMFGTWELV 369

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 30/194 (15%)

Query: 30  SRTVVSPVERVKILLQV-QSSTTAYNGGLVHAVKQVYKEEGVKGLFRG---------NGI 79
           + T  +P+  +K  +Q+ ++ TT         +K V K EG+ GL+RG          GI
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEGI 247

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQ---SGHEQLRSW-ERXXXXXXXXXXXXXXTYP 135
             L+   Y  +++ + +    +  H GQ   S  E+++ W +R              TYP
Sbjct: 248 --LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYP 305

Query: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRRPP--GIVELLRRIFREEGGLRGWYRGVYPTSL 193
            ++VRTRL           R    +  +P   G+V+  R I +EE GL   Y G+ P  +
Sbjct: 306 HEVVRTRL-----------RQMPMENGKPKYTGLVQSFRVIIKEE-GLASMYSGLTPHLM 353

Query: 194 GVVPFVALNFALYE 207
             VP   + F  +E
Sbjct: 354 RTVPNSIIMFGTWE 367

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 21/88 (23%)

Query: 240 VVYPFDLLRRRFQ--------------VLTMGQSEL-------GFRYASVADALWTIGRQ 278
           V  PFDL++ R Q              V     S++       G  +      L  + ++
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 279 EGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           EG R  +KGL  NLV V+PA ++ +F Y
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTY 156

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 132/317 (41%), Gaps = 31/317 (9%)

Query: 4   PENYIQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQV--QSSTTAYNGGLVHAV 61
           P+N++ +    +                    P++ +K+ +Q+  +++      G +   
Sbjct: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104

Query: 62  KQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKT----RVFHVGQSGHEQLRSWE 117
             +Y  EG+   ++G G   + I P  A++++ YEF +T    R   V  +G+  L    
Sbjct: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAG-- 162

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                            P+++V+ RL  Q       H   A + ++    ++    I +E
Sbjct: 163 ----VGAGVTEAVLVVNPMEVVKIRLQAQ-------HLHGAAEQQKYRNAIQAAYLIVKE 211

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-IGAVSGGI 236
           EG +   YRGV  T+         NF +Y +L   +   + + ++ + + + IG VSG I
Sbjct: 212 EG-IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAI 270

Query: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQ----EGLRGYYKGLTANL 292
                 P D ++ R Q       +   R  S    + TIGRQ    EG R  YKG+T  +
Sbjct: 271 GPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRV 324

Query: 293 VKVVPAMAVQWFVYELI 309
           ++V P  AV + VYE +
Sbjct: 325 MRVAPGQAVTFTVYEFV 341

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 35  SPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +P++ +K  LQ   ST   +    +    +Q+ +EEG + L++G     +R+ P  AV +
Sbjct: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335

Query: 93  AVYEFCKTRVFHVG 106
            VYEF +  +  +G
Sbjct: 336 TVYEFVRRHLEGLG 349

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 121/284 (42%), Gaps = 23/284 (8%)

Query: 36  PVERVKILLQVQSSTTAYN----GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           P++ +K+ +Q+             G +   + +Y++EG   L++G G   + I P  A++
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           ++ YEF +T + +  +SG     +                   P+++V+ RL  Q    +
Sbjct: 90  FSSYEFYRTLLVN-KESGIVSTGNT-FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPS 147

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
           + +    ++       +     I +EEG +   YRGV  T+         NF +Y +LK 
Sbjct: 148 EPNAGPKYN-----NAIHAAYTIVKEEG-VSALYRGVSLTAARQATNQGANFTVYSKLKE 201

Query: 212 LIPHDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
            +  +Y    V  +     IG +SG I      P D ++ R Q        +     S  
Sbjct: 202 FL-QNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ----KDKSISLEKQSGM 256

Query: 270 DALWTIG----RQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             + TIG    ++EG R  YKG+T  +++V P  AV + VYE +
Sbjct: 257 KKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV 300

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +PLD ++ R+ I         R    +  +PPG ++  R I+++EG L   Y+G+    +
Sbjct: 29  HPLDTIKVRMQI-------YRRVAGIEHVKPPGFIKTGRTIYQKEGFL-ALYKGLGAVVI 80

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT--VVYPFDLLRRRF 251
           G++P +A+ F+ YE  + L+ +  ++G V+     +  V  GI +   VV P ++++ R 
Sbjct: 81  GIIPKMAIRFSSYEFYRTLLVNK-ESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRL 139

Query: 252 QV--LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           Q   LT  +   G +Y +   A +TI ++EG+   Y+G++    +        + VY
Sbjct: 140 QAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVY 196

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 80/185 (43%), Gaps = 24/185 (12%)

Query: 33  VVSPVERVKILLQVQSSTTA-------YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           VV+P+E VKI LQ Q  T +       YN   +HA   + KEEGV  L+RG  +   R  
Sbjct: 128 VVNPMEVVKIRLQAQHLTPSEPNAGPKYNNA-IHAAYTIVKEEGVSALYRGVSLTAARQA 186

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
                 + VY   K + F       + L SWE                 PLD ++TR   
Sbjct: 187 TNQGANFTVYS--KLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTR--- 241

Query: 146 QTANLAKLHRSKAHDIRRPPG---IVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALN 202
                  L + K+  + +  G   I+ +  ++ +EE G R  Y+G+ P  + V P  A+ 
Sbjct: 242 -------LQKDKSISLEKQSGMKKIITIGAQLLKEE-GFRALYKGITPRVMRVAPGQAVT 293

Query: 203 FALYE 207
           F +YE
Sbjct: 294 FTVYE 298

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%)

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           S  A  L  G  +G       +P D ++ R Q+          +         TI ++EG
Sbjct: 8   SHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEG 67

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYEL 308
               YKGL A ++ ++P MA+++  YE 
Sbjct: 68  FLALYKGLGAVVIGIIPKMAIRFSSYEF 95

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 35  SPVERVKILLQVQSSTT-AYNGGLVHAVK---QVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           +P++ +K  LQ   S +     G+   +    Q+ KEEG + L++G     +R+ P  AV
Sbjct: 233 APLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAV 292

Query: 91  QYAVYEFCKTRVFHVG 106
            + VYE+ +  + ++G
Sbjct: 293 TFTVYEYVREHLENLG 308

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 10/146 (6%)

Query: 166 GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSV--- 222
            I+  + RI+ EEG L+ ++RG+ P+  GV    AL FA+Y+ LK    HD +       
Sbjct: 162 SILNAITRIYTEEG-LKTFWRGLVPSLFGVTQG-ALYFAIYDTLKLKYLHDRNDIQERRL 219

Query: 223 -AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL 281
            A   + I ++S  I+ + VYP  LL+   Q      +E   +  S+  ++W      G+
Sbjct: 220 NAVETIGIISLSKMISVSSVYPLQLLKTNLQTFRTEHNE-NSKMNSLIRSIW---HTNGI 275

Query: 282 RGYYKGLTANLVKVVPAMAVQWFVYE 307
            G+YKGL ANLV+ +P+  + + VYE
Sbjct: 276 AGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 79/179 (44%), Gaps = 15/179 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           + +P+  +K  +    S+  Y   +++A+ ++Y EEG+K  +RG  +  L      A+ +
Sbjct: 140 LTNPMWVIKTRIMSTKSSQGYTS-ILNAITRIYTEEGLKTFWRG-LVPSLFGVTQGALYF 197

Query: 93  AVYEFCKTRVFHVGQSGHEQ-LRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           A+Y+  K +  H      E+ L + E                YPL L++T L  QT    
Sbjct: 198 AIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNL--QTFRTE 255

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
               SK +          L+R I+   G + G+Y+G++   +  +P   + F +YE  K
Sbjct: 256 HNENSKMN---------SLIRSIWHTNG-IAGFYKGLFANLVRAIPSTCITFGVYEHFK 304

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 21/186 (11%)

Query: 133 TYPLDLVRTRLSIQTANL--AKLHRSKAHDIRRPPGIVELLRRIFREEG-----GLRGW- 184
           T+PLDL++ RL +   +L  +  +      I+   G  +LL+  +R  G         W 
Sbjct: 30  THPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYRGLGINIIGNAVAWG 89

Query: 185 -YRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYP 243
            Y G+Y  S  VV  ++   AL  +         D    ++  L     SG     +  P
Sbjct: 90  LYFGLYRCSKDVVYSLSSEPALQNKFMN------DRKMTSSMYLVSAGASGLATALLTNP 143

Query: 244 FDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQW 303
             +++ R       Q      Y S+ +A+  I  +EGL+ +++GL  +L  V    A+ +
Sbjct: 144 MWVIKTRIMSTKSSQG-----YTSILNAITRIYTEEGLKTFWRGLVPSLFGVTQG-ALYF 197

Query: 304 FVYELI 309
            +Y+ +
Sbjct: 198 AIYDTL 203

>Scas_667.22
          Length = 306

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 123/283 (43%), Gaps = 31/283 (10%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P +  K+ LQ  S+ T      +  ++++ K EG KG ++G     + +    ++Q+
Sbjct: 42  VGQPFDTTKVRLQTSSTPTTA----MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQF 97

Query: 93  AVYEFCKTRVFHV--GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            V E  K R FH     S  + L   +                 P++ VR RL  QT + 
Sbjct: 98  GVNEAMK-RFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSG 156

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
             +            G ++ +R++ R +GG   + RG+ PT L         F +YE   
Sbjct: 157 PNVEFK---------GPLDCIRKL-RAQGG---FMRGLTPTMLREGHGCGTYFLVYE--- 200

Query: 211 ALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           A++ ++ + G     V A KL + GA+SG     +VYP D+++   Q   +   + G   
Sbjct: 201 AMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSI 260

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +SVA  L+  G   GL  ++KG    +++  PA    +  +EL
Sbjct: 261 SSVAKTLYAKG---GLGAFFKGFGPTMLRAAPANGATFATFEL 300

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 124/296 (41%), Gaps = 40/296 (13%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           +RT ++P++ VKI LQV    T +N    + +  + K EG++G ++GN    +    Y  
Sbjct: 29  ARTCIAPLDTVKIKLQV----TPHNKN-ANVLINILKREGIRGFWKGNVPGSIMYIIYGG 83

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT-A 148
            Q+  Y +  +  F  G                          +YP D++RTR +  +  
Sbjct: 84  AQFGSYTYIGS--FLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG 141

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
            L KL               + +  I+  EG L G++ G   + + +    A+ F +YE 
Sbjct: 142 QLIKLR--------------DEIMAIWSHEG-LMGFFSGCGSSMINIGLNTAIMFGVYES 186

Query: 209 LKALIPH-----DYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGF 263
           +K          D         +LA G +SG  ++   +P D +RRR Q+      E   
Sbjct: 187 IKIFTEERSKLSDRRDPFTLLNELA-GPISGFTSKLATFPLDTVRRRIQIRNSPNEERHD 245

Query: 264 R------YASVADALW-----TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           R      Y S  +  +     ++ +QEG    Y+G+T +L+K VP+ A+  + YEL
Sbjct: 246 REFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYEL 301

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 24/176 (13%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLD V+ +L +        H   A+          +L  I + EG +RG+++G  P S+ 
Sbjct: 35  PLDTVKIKLQVTP------HNKNAN----------VLINILKREG-IRGFWKGNVPGSIM 77

Query: 195 VVPFVALNFALYERLKALIPHDYDAG-SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
            + +    F  Y  + + +    D   S       +G+++G  +    YPFD+LR RF  
Sbjct: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA 137

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            + GQ         + D +  I   EGL G++ G  ++++ +    A+ + VYE I
Sbjct: 138 NSQGQ------LIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESI 187

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 9/61 (14%)

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYK 286
           L  G++SG  A+T + P D ++ + QV    ++         A+ L  I ++EG+RG++K
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN---------ANVLINILKREGIRGFWK 69

Query: 287 G 287
           G
Sbjct: 70  G 70

>Scas_691.4
          Length = 334

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 117/295 (39%), Gaps = 37/295 (12%)

Query: 36  PVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAV 94
           P++ +K+ +Q+   T      G +   + +Y  EG   L++G G   + I P  A++++ 
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 95  YEFCK-------TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
           YEF +       TR    G +                          P+++V+ RL  Q 
Sbjct: 93  YEFYRNALTDKETRTITTGNT---------FLAGVGAGITEAVLVVNPMEVVKIRLQAQH 143

Query: 148 AN------LAKLHRSKAHDIRRP--PGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
            N              A  + +P     +     I +EEG     YRGV  T+       
Sbjct: 144 LNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGA-GALYRGVSLTAARQATNQ 202

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQ 258
             NF +Y  LK  +   ++  S+ + + + IG +SG I      P D ++ R Q      
Sbjct: 203 GANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ------ 256

Query: 259 SELGFRYASVADALWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            +      S    ++ IG Q    EG R  YKG+T  +++V P  AV + VYE +
Sbjct: 257 KDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 311

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 85/216 (39%), Gaps = 36/216 (16%)

Query: 33  VVSPVERVKILLQVQ-------------------SSTTAYNGGLVHAVKQVYKEEGVKGL 73
           VV+P+E VKI LQ Q                   + T       +HA   + KEEG   L
Sbjct: 128 VVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGAL 187

Query: 74  FRGNGINCLRIFPYSAVQYAVYEFCKT--RVFHVGQSGHEQLRSWERXXXXXXXXXXXXX 131
           +RG  +   R        + VY + K   + +H      E L SWE              
Sbjct: 188 YRGVSLTAARQATNQGANFTVYSYLKDYLQKYH----NRESLPSWETSCIGLISGAIGPF 243

Query: 132 XTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
              PLD ++TRL    +  +     K + I           ++ +EE G R  Y+G+ P 
Sbjct: 244 SNAPLDTIKTRLQKDKSISSNSAWKKIYIIG---------TQLIKEE-GFRALYKGITPR 293

Query: 192 SLGVVPFVALNFALYERL-KALIPHDYDAGSVAAAK 226
            + V P  A+ F +YE + K L   ++  GS  +AK
Sbjct: 294 VMRVAPGQAVTFTVYEFVRKHLETLNFFGGSGPSAK 329

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 29/191 (15%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +PLD ++ R+ I          +K  +  RP G +   R I+  EG L   Y+G+    +
Sbjct: 32  HPLDTIKVRMQI----------AKRTEGMRPHGFITTGRNIYSHEGFL-ALYKGLGAVVI 80

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT--VVYPFDLLRRRF 251
           G++P +A+ F+ YE  +  +  D +  ++      +  V  GI +   VV P ++++ R 
Sbjct: 81  GIIPKMAIRFSSYEFYRNAL-TDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRL 139

Query: 252 QVLTM--------GQSELGF-------RYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296
           Q   +        G S  G        +YA+   A +TI ++EG    Y+G++    +  
Sbjct: 140 QAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQA 199

Query: 297 PAMAVQWFVYE 307
                 + VY 
Sbjct: 200 TNQGANFTVYS 210

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 15/97 (15%)

Query: 218 DAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL--TMGQSELGFRYASVADALWTI 275
           D  S     L  G  +G       +P D ++ R Q+   T G    GF          T 
Sbjct: 8   DKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGF---------ITT 58

Query: 276 GR----QEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           GR     EG    YKGL A ++ ++P MA+++  YE 
Sbjct: 59  GRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEF 95

>Scas_379.2
          Length = 301

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 114/282 (40%), Gaps = 31/282 (10%)

Query: 31  RTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
            +V+ P++ +K   ++QS++      ++  + ++   EG   L++G     L   P  AV
Sbjct: 38  HSVMFPIDALKT--RIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVILGAGPAHAV 95

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            +A YE+  T+ + + +   +  +  +                 P D ++ R+ + T   
Sbjct: 96  YFATYEY--TKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTT 153

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFALYERL 209
                           +  + ++I++ EG    +Y   YPT+L + +PF A NF +YE  
Sbjct: 154 ----------------VWNVTKQIYKNEGFSAFYYS--YPTTLAMNIPFAAFNFMIYESA 195

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
                   D   +       G +SG     +  P D ++   QV   G   +  +    A
Sbjct: 196 TKFFNPTNDYNPLV--HCLSGGLSGATCAAITTPLDCIKTVLQV--RGSESVSLQVMKEA 251

Query: 270 D----ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +    A   I +  G +G+++GL   +   +PA A+ W  YE
Sbjct: 252 NTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 73/181 (40%), Gaps = 16/181 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +++P + +K  +Q+ ++TT +N       KQ+YK EG    +           P++A  +
Sbjct: 135 LMNPFDTLKQRMQLNTNTTVWN-----VTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNF 189

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
            +YE   T+ F+     +  +                   T PLD ++T L ++ +    
Sbjct: 190 MIYE-SATKFFNPTNDYNPLVHC----LSGGLSGATCAAITTPLDCIKTVLQVRGSESVS 244

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
           L       + +     +   +   +  G +G++RG+ P     +P  A+ +  YE  K  
Sbjct: 245 LQ------VMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHF 298

Query: 213 I 213
           +
Sbjct: 299 L 299

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 114/279 (40%), Gaps = 30/279 (10%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P +  K+ LQ     T+        VK + K EG KG ++G     + +    ++Q+ V 
Sbjct: 45  PFDTTKVRLQTSKVPTSA----AEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVN 100

Query: 96  EFCKTRVFHVGQSGHEQLRSWER-XXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           E  K R FH     H    S  +                 P++ VR RL  QT + A+  
Sbjct: 101 EAMK-RFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQ-- 157

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
                + + P   ++ LR         +G  RG+ PT L         F +YE   AL+ 
Sbjct: 158 ----AEFKGPIDCIKKLRS-------QKGLMRGLIPTMLREGHGCGTYFLVYE---ALVS 203

Query: 215 HDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
              + G     +   KL + GA+SG     +VYP D+++   Q   + + + G     VA
Sbjct: 204 KQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVA 263

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             L+    +EGL+ ++KG    +++  PA    +  +EL
Sbjct: 264 RNLYA---REGLKAFFKGFGPTMLRAAPANGGTFATFEL 299

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 78/177 (44%), Gaps = 17/177 (9%)

Query: 33  VVSPVERVKILLQVQSSTTAYN--GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           + SP+E V+I LQ Q+ + A     G +  +K++  +   KGL RG     LR       
Sbjct: 137 LASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQ---KGLMRGLIPTMLREGHGCGT 193

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            + VYE   ++  + G     ++  W+                YP+D+V++   +QT NL
Sbjct: 194 YFLVYEALVSKQINQGLK-RTEIPPWKLCLYGALSGTALWLMVYPIDVVKS--VMQTDNL 250

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
            K    K         ++++ R ++  EG L+ +++G  PT L   P     FA +E
Sbjct: 251 NKPQNGK--------NMIQVARNLYAREG-LKAFFKGFGPTMLRAAPANGGTFATFE 298

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 11/91 (12%)

Query: 218 DAGSVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIG 276
           D G V    LA    +GGIAQ ++  PFD  + R Q   +          S A+ +  + 
Sbjct: 21  DNGRVVKDLLA--GTAGGIAQVLIGQPFDTTKVRLQTSKV--------PTSAAEVVKNLL 70

Query: 277 RQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           + EG +G+YKG    LV V   +++Q+ V E
Sbjct: 71  KNEGPKGFYKGTLTPLVGVGACVSIQFGVNE 101

>Kwal_47.18216
          Length = 333

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 122/306 (39%), Gaps = 45/306 (14%)

Query: 36  PVERVKILLQVQSSTTAYNG---GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           P++ +K+ +Q+ S          G +   + +  +EG   L++G G   + I P  A+++
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 93  AVYEFCKT----RVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
             YEF +T    R   V  +G+  +                     P+++V+ RL  Q  
Sbjct: 90  TSYEFFRTLLADRQTGVVSTGNTFV------AGVGAGITEAVMVVNPMEVVKIRLQAQHV 143

Query: 149 NLAKLHRSKA-----------------HDIRRPP---GIVELLRRIFREEGGLRGWYRGV 188
               L    A                  ++   P     ++    I +EEG  R  YRGV
Sbjct: 144 RYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGP-RALYRGV 202

Query: 189 YPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLL 247
             T+         NF +Y  LK+ +   +    + + + + IG +SG +      P D +
Sbjct: 203 SLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTI 262

Query: 248 RRRFQVLTMGQSELGFRYASVADALWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQW 303
           + R Q       + G+        +  IGRQ    EG R  YKG+T  +++V P  AV +
Sbjct: 263 KTRLQKDKSTSKDSGW------SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316

Query: 304 FVYELI 309
            VYELI
Sbjct: 317 TVYELI 322

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 83/210 (39%), Gaps = 45/210 (21%)

Query: 33  VVSPVERVKILLQVQ--------------------------------SSTTAYNGGLVHA 60
           VV+P+E VKI LQ Q                                ++T  Y    + A
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNA-IQA 185

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXX 120
              + KEEG + L+RG  +   R        + VY   K+R+    Q+  + L SWE   
Sbjct: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT--DMLPSWETSL 243

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG 180
                         PLD ++TRL    +       SK     R   I+ + R++ REEG 
Sbjct: 244 IGLISGALGPFSNAPLDTIKTRLQKDKST------SKDSGWSR---ILAIGRQLIREEG- 293

Query: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            R  Y+G+ P  + V P  A+ F +YE ++
Sbjct: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIR 323

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 12/121 (9%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +PLD ++ R+ I +    +  R++        G +   R I  +EG L   Y+G+    +
Sbjct: 29  HPLDTIKVRMQIYSRAREQGQRAR--------GFIGTARDISTQEGFL-ALYKGLGAVVI 79

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT--VVYPFDLLRRRF 251
           G++P +A+ F  YE  + L+  D   G V+     +  V  GI +   VV P ++++ R 
Sbjct: 80  GIIPKMAIRFTSYEFFRTLLA-DRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRL 138

Query: 252 Q 252
           Q
Sbjct: 139 Q 139

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRG 283
           A  L  G  +G       +P D ++ R Q+ +  + E G R          I  QEG   
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAR-EQGQRARGFIGTARDISTQEGFLA 69

Query: 284 YYKGLTANLVKVVPAMAVQWFVYEL 308
            YKGL A ++ ++P MA+++  YE 
Sbjct: 70  LYKGLGAVVIGIIPKMAIRFTSYEF 94

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 35  SPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +P++ +K  LQ   ST+  +G   ++   +Q+ +EEG + L++G     +R+ P  AV +
Sbjct: 257 APLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316

Query: 93  AVYEFCKTRV 102
            VYE  + ++
Sbjct: 317 TVYELIRKKL 326

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 118/299 (39%), Gaps = 49/299 (16%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S  ++ P + +K  LQ   ++T +        K +   E    L+RG   +C+R    SA
Sbjct: 21  SAIILQPFDLLKTRLQQDKTSTLW--------KTLKSIETPSQLWRGALPSCIRTSVGSA 72

Query: 90  VQYAVYEFCKTRVF---HVGQSGHE---QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
           +   +    +  +    + G +G     QL  +E               T P+ +++ R 
Sbjct: 73  MYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRY 132

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                    L  + +H              IFR EG LRG++RG   T+L   P+  L  
Sbjct: 133 ESTLYQYTSLRYATSH--------------IFRTEG-LRGFFRGFGATALRDAPYAGLYM 177

Query: 204 ALYERLKALIP----------HDYDAGSVAAAKLAIGAVSGG---IAQTVVYPFDLLRRR 250
             Y+R+K L+P          +  +  S  A+ L  G+ +     IA ++  PFD ++ R
Sbjct: 178 LFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTR 237

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            Q+          ++ S     W I  +E +R  + G++  L +   +  + W +YE I
Sbjct: 238 MQLEPA-------KFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEI 289

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 109/270 (40%), Gaps = 31/270 (11%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS 115
           G +  ++++ + EG+  L+RG GI  +   P + V ++ YE               +L  
Sbjct: 82  GTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYE-----ALRDNSPLASRLPV 136

Query: 116 WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIF 175
                              PL+L+RTRL             +A D  R   ++  L R  
Sbjct: 137 ANPLVCGAFARILAATTIAPLELLRTRLQ---------SVPRARDTERTIYLIGDLLREM 187

Query: 176 REE---GGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAA------AK 226
           R E    G R  ++G+  T    VPF A+ +  YE  K      + A   A+        
Sbjct: 188 RHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGS 247

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL--GFRYASVADA------LWTIGRQ 278
            A G++ G +A  + +PFD+ + R Q+      +L  G +     D+      L  I + 
Sbjct: 248 FACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKS 307

Query: 279 EGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           EG+R  Y GL   ++K+ P+ A+    YEL
Sbjct: 308 EGIRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (43%), Gaps = 19/190 (10%)

Query: 32  TVVSPVERVKILLQV-----QSSTTAY-NGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           T ++P+E ++  LQ       +  T Y  G L+  ++      G + LF+G  I   R  
Sbjct: 152 TTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDV 211

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXX----XXXXTYPLDLVRT 141
           P+SA+ +  YEFCKT+ F    +      +W+                   T+P D+ +T
Sbjct: 212 PFSAIYWGTYEFCKTQ-FWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKT 270

Query: 142 RLSIQTANLAKL----HRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197
           R+ I  A+  +L      +K  D R   G+   L  I + E G+R  Y G+ P  + + P
Sbjct: 271 RMQIAIASPQQLTVGGKATKTDDSR---GMFSFLNAIRKSE-GIRALYTGLLPRVMKIAP 326

Query: 198 FVALNFALYE 207
             A+  + YE
Sbjct: 327 SCAIMISTYE 336

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 78/171 (45%), Gaps = 22/171 (12%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V++P ERVK++LQ QS     N  L  A K +    GV+ LFRG+     R  P SA+ +
Sbjct: 166 VMAPTERVKVVLQTQS-----NHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYF 220

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
           A YE   T+ +   +SG  +L                    +P+D ++T L  Q++N  +
Sbjct: 221 ASYE--ATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTEL--QSSNTRQ 276

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                         ++E  R+I+   GG++G++ G+ P  L   P  A  F
Sbjct: 277 T-------------MMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATF 314

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 81/184 (44%), Gaps = 35/184 (19%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIF---REEGGL------RGW 184
           +P DL++ R     A+                G V+ +R+I    R + GL      RG+
Sbjct: 66  HPFDLLKVRCQSNQAS----------------GTVDAVRKILVEARAQSGLSAVNMMRGF 109

Query: 185 YRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVY-P 243
           Y+GV P  LGV P  A++F  Y+  K L+  + ++G +  A+LA       I  T+V  P
Sbjct: 110 YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVMAP 169

Query: 244 FDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQW 303
            +    R +V+   QS       S A  +   G   G+R  ++G  A L +  P  A+ +
Sbjct: 170 TE----RVKVVLQTQSN--HSLGSAAKHILATG---GVRSLFRGSLATLARDGPGSALYF 220

Query: 304 FVYE 307
             YE
Sbjct: 221 ASYE 224

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV-ADALWTIGRQEGLR 282
           A  LA GAV G  A    +PFDLL+ R Q      +    R   V A A   +     +R
Sbjct: 48  AKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYEL 308
           G+YKG+   L+ V P  AV ++ Y++
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDV 133

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 10/132 (7%)

Query: 179 GGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQ 238
           GG+R  +RG   T     P  AL FA YE  KA +        ++   + +     G++ 
Sbjct: 196 GGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSM 255

Query: 239 TV-VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTI-GRQEGLRGYYKGLTANLVKVV 296
            V V+P D ++   Q     Q+ +        +A   I   + G++G++ G+   L++  
Sbjct: 256 WVGVFPIDTIKTELQSSNTRQTMM--------EATRKIYNTRGGIKGFFPGIGPALLRSF 307

Query: 297 PAMAVQWFVYEL 308
           PA A  +   EL
Sbjct: 308 PANAATFLGVEL 319

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 115/262 (43%), Gaps = 20/262 (7%)

Query: 57  LVHAVKQVYKEEGVK-GLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS 115
           ++ A + +  EEGV+ GL+ G G   L  FP +AV +  YE+ K ++ +  Q  HE   +
Sbjct: 93  MISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEWVKRQMINEWQI-HE---T 148

Query: 116 WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIF 175
           +                  P ++++TRL +Q     + H    ++ R   G+ + +R I 
Sbjct: 149 YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNR-HFQSGYNYR---GLSDAVRTIV 204

Query: 176 REEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA----LIPHDYDAGSVAAAKLAIGA 231
           R E G+   + G   T    +PF AL FA YER +     L     D      A++  GA
Sbjct: 205 RTE-GVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGA 263

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYA------SVADALWTIGRQEGLRGYY 285
            +GG+A  +  P D+++ R Q    G +      A      S+  +L  + R EGL G +
Sbjct: 264 SAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAF 323

Query: 286 KGLTANLVKVVPAMAVQWFVYE 307
            G+    +      ++   +Y+
Sbjct: 324 SGVGPRFIWTSIQSSIMLLLYQ 345

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 71/171 (41%), Gaps = 14/171 (8%)

Query: 30  SRTVVSPVERVKILLQVQSS------TTAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           S  V  P E +K  LQ+Q         + YN  GL  AV+ + + EGV  LF G      
Sbjct: 162 SSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLS 221

Query: 83  RIFPYSAVQYAVYEFCKTRVFHVGQ---SGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           R  P+SA+Q+A YE  +   F + +    GH  L                   T PLD+V
Sbjct: 222 RDLPFSALQFAFYERFRKWAFLLERKPVDGH--LSFTAEVVTGASAGGLAGIITTPLDVV 279

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190
           +TR+  Q    A    + A   R    I   L  + R E GL G + GV P
Sbjct: 280 KTRIQTQPRGSAGTPDASA-PARLNGSIFRSLLVVLRYE-GLGGAFSGVGP 328

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 119/284 (41%), Gaps = 38/284 (13%)

Query: 36  PVERVKILLQVQS-STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAV 94
           P +  K+ LQ  S  TTA +      VK++ K EG +G ++G     + +    +VQ+ V
Sbjct: 43  PFDTTKVRLQTSSVPTTALD-----VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGV 97

Query: 95  YEFCKTRVFHV--GQSG-HEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN-- 149
            E  K R FH   G SG +E L   +                 P++ VR RL  QT    
Sbjct: 98  NEAMK-RFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGA 156

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
            A+ H           G ++ ++++           RG+ PT L       + F  YE  
Sbjct: 157 AAQFH-----------GPLDCIKKLTANN----SLMRGLTPTMLRESHGCGVYFLTYE-- 199

Query: 210 KALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR 264
            ALI ++   G     +   KL + GA SG     ++YP D+++   Q  ++ Q + G  
Sbjct: 200 -ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKN 258

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
              VA  +++     GL  ++KG    +++  PA    +  +EL
Sbjct: 259 MLQVAKTIYST---RGLSSFFKGFGPTMLRAAPANGATFATFEL 299

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 212 LIPHDYDAG--SVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASV 268
           LI  D D    S    K  +   +GG++Q ++  PFD  + R Q  ++  + L       
Sbjct: 9   LIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTAL------- 61

Query: 269 ADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            D +  + + EG RG+YKG    LV V   ++VQ+ V E
Sbjct: 62  -DVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNE 99

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 19/172 (11%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V +P ER+K++LQ  S    + G  + A K +    GVK LF G+     R  P SA+ +
Sbjct: 149 VTAPTERIKVVLQTNSE---FKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYF 205

Query: 93  AVYEFCKTRVF-HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           A YE  K  +   V +   +++                    +P+D ++TRL + T    
Sbjct: 206 ASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATT--- 262

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                       P  +V+  + I+ + GG++G++ G+ P  L   P  A  F
Sbjct: 263 ------------PISMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATF 302

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 108/279 (38%), Gaps = 32/279 (11%)

Query: 35  SPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAV 94
           S ++ V I+L+   S +  NG L  ++   + +  VKG ++G     + + P  AV +  
Sbjct: 56  STMDAVSIILKEARSLSTVNGSLTTSL---FFKNSVKGFYKGVIPPLIGVTPIFAVSFWG 112

Query: 95  YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           Y+  K R+    Q+    L + +               T P + ++  L   +       
Sbjct: 113 YDIGK-RLVTWKQASDAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFI 171

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
           ++  H +                 GG++  + G   T     P  AL FA YE  KA + 
Sbjct: 172 KAAKHIV---------------STGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLN 216

Query: 215 HDYDAGSVAAAKLAIGAVSGGIAQT----VVYPFDLLRRRFQVLTMGQSELGFRYASVAD 270
                       LA   ++GGIA      VV+P D ++ R QV T           S+  
Sbjct: 217 KSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTP--------ISMVQ 268

Query: 271 ALWTIGRQE-GLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           A   I  Q  G++G++ GL   L++  PA A  +   EL
Sbjct: 269 ATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVEL 307

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query: 212 LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV----LTMGQSELGFRYA- 266
           ++ H  DA       L  G V G  A    +PFDL++ R Q      TM    +  + A 
Sbjct: 10  ILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEAR 69

Query: 267 ---SVADALWT-IGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
              +V  +L T +  +  ++G+YKG+   L+ V P  AV ++ Y++
Sbjct: 70  SLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDI 115

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 115/265 (43%), Gaps = 31/265 (11%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXX 120
           +  VYK+EG + LF+G G N + + P  ++ +  Y   K        +G E         
Sbjct: 123 IGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQET--PMIHLM 180

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG 180
                       T P+ L++TR+        +L ++    +R+     + L+ + R E G
Sbjct: 181 AAATAGWATATATNPIWLIKTRV--------QLDKAGKTSVRQYKNSWDCLKSVIRNE-G 231

Query: 181 LRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH------DYDAGSVAAAKLAIG---- 230
             G Y+G+  + LG V  + L + LYE++K LI         Y A    +    +     
Sbjct: 232 FTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQ 290

Query: 231 -AVSGGIAQTV----VYPFDLLRRRFQVLTMGQSELGFR-YASVADALWTIGRQEGLRGY 284
            + S G+A+ V     YP +++R R   L     E G R Y  +  +   I ++EGL   
Sbjct: 291 RSGSAGLAKFVASIATYPHEVVRTR---LRQTPKENGKRKYTGLVQSFKVIIKEEGLFSM 347

Query: 285 YKGLTANLVKVVPAMAVQWFVYELI 309
           Y GLT +L++ VP   + +  +E++
Sbjct: 348 YSGLTPHLMRTVPNSIIMFGTWEIV 372

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 22/89 (24%)

Query: 240 VVYPFDLLRRRFQV-------------LTMGQS---------ELGFRYASVADALWTIGR 277
           V  PFDL++ R Q              ++ G +         + G  +      +  + +
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           QEG R  +KGL  NLV V+PA ++ +F Y
Sbjct: 129 QEGFRSLFKGLGPNLVGVIPARSINFFTY 157

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYE 96
           GLV + K + KEEG+  ++ G   + +R  P S + +  +E
Sbjct: 330 GLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWE 370

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 81/176 (46%), Gaps = 15/176 (8%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YP D V+ RL  Q+A L              P     +   +++EG  RG+Y+G+     
Sbjct: 27  YPFDTVKVRLQTQSAALF-------------PTTWSCVSHTYKQEGLWRGFYQGMASPVF 73

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
           G     A+ F  + R +A++ + Y  G +     A GA++G     V+ P +L++ + QV
Sbjct: 74  GAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFA-GAIAGACTSYVLTPVELVKCKLQV 132

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             +     G RY +V   L  I +Q GL G ++G +   ++     AV +  YE++
Sbjct: 133 SNLTGVS-GPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVL 187

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 82/184 (44%), Gaps = 25/184 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG----GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           V++PVE VK  LQV S+ T  +G     ++  ++ + K+ G+ GL++G     +R     
Sbjct: 119 VLTPVELVKCKLQV-SNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGG 177

Query: 89  AVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
           AV +  YE  K  +    + G  +   WE                +P D V++  ++QT 
Sbjct: 178 AVWFTAYEVLKGWLAR--RRGSTENTVWELLASGAGAGAAFHASIFPADTVKS--TMQTE 233

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
           +L               G+   +R + ++ G   G+YRGV  T L  +P  A+ F +YE 
Sbjct: 234 HL---------------GLGPAVRTVLKKHGP-TGFYRGVGITLLRALPANAVIFYVYES 277

Query: 209 LKAL 212
           L  L
Sbjct: 278 LCGL 281

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 114/277 (41%), Gaps = 33/277 (11%)

Query: 36  PVERVKILLQVQSST---TAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQ 91
           P + VK+ LQ QS+    T ++      V   YK+EG+ +G ++G        F   AV 
Sbjct: 28  PFDTVKVRLQTQSAALFPTTWS-----CVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVL 82

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +  +   +  + +    G  +    +                 P++LV+ +L  Q +NL 
Sbjct: 83  FVSFNRAQAVLENCYSCGPLE----KVVFAGAIAGACTSYVLTPVELVKCKL--QVSNLT 136

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
            +         R   ++  LR I ++ G L G ++G   T +      A+ F  YE LK 
Sbjct: 137 GVSGP------RYTAVLPTLRAIVKQNG-LGGLWQGQSGTFIRESAGGAVWFTAYEVLKG 189

Query: 212 LIPHDYDAGSVAAAKLAIGAVSGGIA-QTVVYPFDLLRRRFQVLTMGQSELGFRYASVAD 270
            +     +      +L       G A    ++P D ++   Q   +G          +  
Sbjct: 190 WLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLG----------LGP 239

Query: 271 ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           A+ T+ ++ G  G+Y+G+   L++ +PA AV ++VYE
Sbjct: 240 AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 223 AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL- 281
           A   L  G V+G + + V YPFD ++ R Q  T   +     ++ V+       +QEGL 
Sbjct: 8   AYKDLLYGGVAGSLGKLVEYPFDTVKVRLQ--TQSAALFPTTWSCVSHTY----KQEGLW 61

Query: 282 RGYYKGLTA 290
           RG+Y+G+ +
Sbjct: 62  RGFYQGMAS 70

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (42%), Gaps = 23/182 (12%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V +P ERVK++LQ    TT      + A KQ+ + +G + LF+G+     R  P SA+ +
Sbjct: 156 VTAPTERVKVVLQ----TTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYF 211

Query: 93  AVYEFCKTRVFHVGQSGHE--QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
           A YE CK  +     SGH   +L                    +P+D V+T+L       
Sbjct: 212 ASYEICKEYLNKA--SGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQL------- 262

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
                       +   ++E+ R I+   GG++G++ GV P  L   P  A  F   E   
Sbjct: 263 --------QSSSKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVELTH 314

Query: 211 AL 212
           +L
Sbjct: 315 SL 316

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 75/190 (39%), Gaps = 35/190 (18%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKA-HDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           +P DLV+ R     A  A    S      R+  G   L          +RG+Y+GV P  
Sbjct: 47  HPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSL--------NAVRGFYKGVVPPL 98

Query: 193 LGVVPFVALNFALYERLKALIPH--------------DYDAGSVAAAKLAIGAVSGGIAQ 238
           LGV P  A++F  Y+  K L+                +     +AAA    G +S     
Sbjct: 99  LGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAA----GFISAIPTT 154

Query: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
            V  P + ++   Q  T G+       AS  DA   I R +G +  +KG  A L +  P 
Sbjct: 155 LVTAPTERVKVVLQT-TQGK-------ASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPG 206

Query: 299 MAVQWFVYEL 308
            A+ +  YE+
Sbjct: 207 SALYFASYEI 216

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 114/287 (39%), Gaps = 36/287 (12%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEG------VKGLFRGNGINCLRIFPYSA 89
           P + VK+  Q   + +A +  + H ++   +  G      V+G ++G     L + P  A
Sbjct: 48  PFDLVKVRCQSNQARSAMDA-VSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFA 106

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV-----RTRLS 144
           V +  Y+  K  V  V  S      + E                 P  LV     R ++ 
Sbjct: 107 VSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVV 166

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
           +QT       + KA         ++  ++I R +G  +  ++G   T     P  AL FA
Sbjct: 167 LQTT------QGKAS-------FLDAAKQIVRTQG-FQSLFKGSLATLSRDGPGSALYFA 212

Query: 205 LYERLKALI--PHDYDAGSVAAAKLAIGAVSGGIAQ-TVVYPFDLLRRRFQVLTMGQSEL 261
            YE  K  +     + +G ++   + I     G++   VV+P D ++ + Q  +  QS L
Sbjct: 213 SYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQSSSKRQSML 272

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
                 V   ++    + G++G++ G+   +++  PA A  +   EL
Sbjct: 273 -----EVTRMIYNT--RGGIKGFFPGVGPAILRSFPANAATFLGVEL 312

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 19/92 (20%)

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTI---GRQ----- 278
           LA G V G  A    +PFDL++ R Q           +  S  DA+  I    RQ     
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLVKVRCQ---------SNQARSAMDAVSHILQAARQAAGPT 82

Query: 279 --EGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
               +RG+YKG+   L+ V P  AV ++ Y++
Sbjct: 83  SLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDV 114

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 115/278 (41%), Gaps = 41/278 (14%)

Query: 53  YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQ 112
           +NG L  A +++ K EGV  L+RG  I  L   P + V +  YE+ + R    G      
Sbjct: 110 FNGTL-EAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGL----- 163

Query: 113 LRSWERXXXXXXXXXXXXXXTYPLDLVRTRL-SIQTANLAKLHRSKAHDIRRPPGIVELL 171
             +                   PL+L++T+L SI ++++               G V + 
Sbjct: 164 YPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKN-------------GSVIMY 210

Query: 172 RRIFRE---EGGLRG----WYRGVYPTSLGVVPFVALNFALYERLKA----LIPHDYDAG 220
           R +F E   E  +RG     ++G+  T    VPF A+ +A YE  K     L P  +D  
Sbjct: 211 RDLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKN 270

Query: 221 SVA----AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELG---FRYASVADA-- 271
           S            G +SG +A    +PFD+ + R Q+  +   +L     +Y S      
Sbjct: 271 SSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFG 330

Query: 272 -LWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            L  I + EG+   Y GL   + K+ P+ A+    YEL
Sbjct: 331 FLNYIRKTEGIGALYTGLAPRVAKIAPSCAIMISSYEL 368

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 83/195 (42%), Gaps = 18/195 (9%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLV---HAVKQVYKEEGVKG----LFRGNGINCLRI 84
           T V+P+E +K  LQ   S++  NG ++       ++  E  ++G    +F+G  I   R 
Sbjct: 182 TSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRD 241

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS-WERXXXXXX----XXXXXXXXTYPLDLV 139
            P+SA+ +A YEF KT+V ++  S  ++  S W                    T+P D+ 
Sbjct: 242 VPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHPFDVG 301

Query: 140 RTRLSIQTANLAKLHRS--KAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197
           +TR  I      KL  S  K        G +  +R+      G+   Y G+ P    + P
Sbjct: 302 KTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRK----TEGIGALYTGLAPRVAKIAP 357

Query: 198 FVALNFALYERLKAL 212
             A+  + YE  K L
Sbjct: 358 SCAIMISSYELTKRL 372

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 131/298 (43%), Gaps = 41/298 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKG------LFRGNGINCLRI 84
           VV P++ +K+ LQ+ S+T+A     G    +K++ +     G      L+RG  IN    
Sbjct: 26  VVHPLDLLKVRLQL-SATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINLFGN 84

Query: 85  FPYSAVQYAVYEFCKTRVFH-VGQSGHEQLR---------SWERXXXXXXXXXXXXXXTY 134
                V + +Y   K  ++  V + G  QL+         S                 T 
Sbjct: 85  AIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTN 144

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+ +++TR+ + T+  A+   +  ++     G+ +LLR       G +G ++G+ P   G
Sbjct: 145 PIWVIKTRI-MSTSKGAQGAYTSMYN-----GVQQLLR-----TDGFQGLWKGLVPALFG 193

Query: 195 VVPFVALNFALYERLKALI-----PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRR 249
           V    AL FA+Y+ LK         +  D        + I ++   ++ T+VYPF LL+ 
Sbjct: 194 VSQG-ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKS 252

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             Q  +   +E  FR   +      I   +G  G YKGL+ANLV+ +P+  + + VYE
Sbjct: 253 NLQ--SFRANEQKFRLFPLIKL---IIANDGFVGLYKGLSANLVRAIPSTCITFCVYE 305

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 68/163 (41%), Gaps = 21/163 (12%)

Query: 50  TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVG-QS 108
           T+ YNG     V+Q+ + +G +GL++G  +  L      A+ +AVY+  K R      ++
Sbjct: 165 TSMYNG-----VQQLLRTDGFQGLWKGL-VPALFGVSQGALYFAVYDTLKQRKLRRKREN 218

Query: 109 GHE-QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGI 167
           G +  L + E                YP  L+++ L    AN  K              +
Sbjct: 219 GLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKFR------------L 266

Query: 168 VELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
             L++ I   +G   G Y+G+    +  +P   + F +YE LK
Sbjct: 267 FPLIKLIIANDG-FVGLYKGLSANLVRAIPSTCITFCVYENLK 308

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRV 102
           +K +   +G  GL++G   N +R  P + + + VYE  K R+
Sbjct: 270 IKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLKHRL 311

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 80/167 (47%), Gaps = 4/167 (2%)

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
           ++ + +  K  +  A ++++   ++   R I+ EEG  RG Y G     LG  P  A+ F
Sbjct: 70  AMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFF 129

Query: 204 ALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL-- 261
             YE  K  +  D+         L+ G +   I+  V  P ++L+ R Q+     +    
Sbjct: 130 GTYEYTKRTMIEDWQINDT-ITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQ 188

Query: 262 -GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            G+ Y+++ +A+ T+ ++EG R  + G  A L + +P  A+Q+  YE
Sbjct: 189 SGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYE 235

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 113/274 (41%), Gaps = 32/274 (11%)

Query: 57  LVHAVKQVYKEEGVK-GLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS 115
           ++ A + ++ EEGV+ GL+ G     L  FP +A+ +  YE+ K  +         Q+  
Sbjct: 93  MISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIE-----DWQIND 147

Query: 116 WERXXXXXXXXXXXXXXTY-PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRI 174
                             Y P ++++TRL +Q     + +            +   ++ +
Sbjct: 148 TITHLSAGFLGDFISSFVYVPSEVLKTRLQLQ----GRFNNPFFQSGYNYSNLRNAIKTV 203

Query: 175 FREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI----PHDYDAGSVA-AAKLAI 229
            +EEG  R  + G   T    +PF AL FA YE+ + L       D   G ++   ++  
Sbjct: 204 IKEEG-FRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILT 262

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQV-LTMGQSELGFRYA--------------SVADALWT 274
           GA +GG+A  +  P D+++ R Q      QS   +                 S++ +L T
Sbjct: 263 GACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRT 322

Query: 275 IGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           + + EG+ G++ G+    V      ++   +Y++
Sbjct: 323 VYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQM 356

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 77/178 (43%), Gaps = 18/178 (10%)

Query: 30  SRTVVSPVERVKILLQVQSS------TTAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           S  V  P E +K  LQ+Q         + YN   L +A+K V KEEG + LF G      
Sbjct: 162 SSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLA 221

Query: 83  RIFPYSAVQYAVYEFCKTRVFHVGQ-SGHE-QLRSWERXXXXXXXXXXXXXXTYPLDLVR 140
           R  P+SA+Q+A YE  +   F + Q  G + +L                   T P+D+V+
Sbjct: 222 RDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVK 281

Query: 141 TRLSIQ--------TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190
           TR+  Q        + ++   H +          I   LR +++ EG L G++ GV P
Sbjct: 282 TRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVL-GFFSGVGP 338

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 78/167 (46%), Gaps = 4/167 (2%)

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
           ++ + +  K  +  A ++ +   +++  R +F EEG  RG Y G     LG  P  A+ F
Sbjct: 70  AMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFF 129

Query: 204 ALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV---LTMGQSE 260
           + YE  K  + +DY       + L  G +    +  V  P ++L+ R Q+          
Sbjct: 130 STYEFTKRTMINDYHLNDT-FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFN 188

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            G+ Y S+ +A+ TI R EG+   + G  A L + +P  A+Q+  YE
Sbjct: 189 SGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFYE 235

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 90/210 (42%), Gaps = 29/210 (13%)

Query: 57  LVHAVKQVYKEEGVK-GLFRGNGINCLRIFPYSAVQYAVYEFCKTRV---FHVGQSGHEQ 112
           ++ A + ++ EEG + GL+ G     L  FP +A+ ++ YEF K  +   +H+  +    
Sbjct: 93  MLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDT---- 148

Query: 113 LRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLR 172
              +                  P ++++TRL +Q       H +  ++ +    +   + 
Sbjct: 149 ---FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGC-YNNPHFNSGYNYK---SLRNAIA 201

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL---------KALIPHDYDAGSVA 223
            I+R EG +   + G   T    +PF AL FA YE+          K +  HD    +  
Sbjct: 202 TIYRTEG-VAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISN-- 258

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
             ++  GA +GG+A  +  P D+++ R Q 
Sbjct: 259 --EIVTGACAGGLAGILTTPLDVVKTRVQT 286

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 73/179 (40%), Gaps = 11/179 (6%)

Query: 8   IQTVYKNDXXXXXXXXXXXXXXSRTVVSPVERVKILLQVQS--STTAYNGG-----LVHA 60
           I   + ND              S  V  P E +K  LQ+Q   +   +N G     L +A
Sbjct: 140 INDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNA 199

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQ-LRSWER 118
           +  +Y+ EGV  LF G      R  P+SA+Q+A YE  +   F + G+  ++  L     
Sbjct: 200 IATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNE 259

Query: 119 XXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                         T PLD+V+TR  +QT   +++  S    I+     V L   IF+ 
Sbjct: 260 IVTGACAGGLAGILTTPLDVVKTR--VQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKS 316

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 79/162 (48%), Gaps = 15/162 (9%)

Query: 134 YPLDLVRTR--LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           YPLD+V+TR  L + T   A + +     + R  G+++ L++I ++EG  R  YRG+   
Sbjct: 31  YPLDVVKTRFQLEVTTPTAAAVGK----QVERYNGVIDCLKKIVKKEGFSR-LYRGISSP 85

Query: 192 SLGVVPFVALNFALYERLKALIPHDYDAG-SVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
            L   P  A  FA  ++ + +  + ++   +     +A GA +G     V+ PF+L++ R
Sbjct: 86  MLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIR 145

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292
            Q       ++   Y    D L    + EG+ G YKG+ + +
Sbjct: 146 MQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 118/289 (40%), Gaps = 37/289 (12%)

Query: 32  TVVSPVERVKILLQVQSSTTA----------YNGGLVHAVKQVYKEEGVKGLFRGNGINC 81
           TV+ P++ VK   Q++ +T            YNG ++  +K++ K+EG   L+RG     
Sbjct: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG-VIDCLKKIVKKEGFSRLYRGISSPM 86

Query: 82  LRIFPYSAVQYAV---YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDL 138
           L   P  A ++A    Y+     +F+  ++  +                       P +L
Sbjct: 87  LMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI-----SIAAGASAGMTEAAVIVPFEL 141

Query: 139 VRTRLSIQTANLAKLHRSKAHDIRRP-PGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197
           ++ R+                D++    G ++ L++  + EG + G Y+G+  T      
Sbjct: 142 IKIRM---------------QDVKSSYLGPMDCLKKTIKNEG-IMGLYKGIESTMWRNAL 185

Query: 198 FVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMG 257
           +    F +  +++  +P     G      L  GA+ G +   +  PFD+++ R Q +   
Sbjct: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAV 245

Query: 258 QSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
            S +  +Y     +L  I R+EG R  YKG    + ++ P  ++   V+
Sbjct: 246 SSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQ--VLTMGQSELGF---RYASVADALWTIGRQEGLRGY 284
           GAV+G    TV+YP D+++ RFQ  V T   + +G    RY  V D L  I ++EG    
Sbjct: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78

Query: 285 YKGLTANLVKVVPAMAVQW 303
           Y+G+++ ++   P  A ++
Sbjct: 79  YRGISSPMLMEAPKRATKF 97

>Scas_718.5
          Length = 324

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 120/295 (40%), Gaps = 49/295 (16%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P +  K+ +Q    T+A + G +  ++++ K EGV   ++G+ I  + +    +VQ+
Sbjct: 56  VGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQF 111

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTY----------------PL 136
            V E  K R F          R W                 Y                P+
Sbjct: 112 GVNEAMK-RFF----------REWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160

Query: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196
           + VR RL  QT N          + R   G ++ +R++ +E    +   RG+ P  L   
Sbjct: 161 EHVRIRLQTQTGN---------GNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLRAG 207

Query: 197 PFVALNFALYERLKA-LIPHDYDAGSVAAAKL-AIGAVSGGIAQTVVYPFDLLRRRFQVL 254
             +   F  YE L A  I    D   +A+ KL + G++SG +    +YP D+++   Q  
Sbjct: 208 HGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267

Query: 255 TMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           T+          +V + L+   R++G+  ++KG    +++  P     +  +EL+
Sbjct: 268 TLRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 74/187 (39%), Gaps = 25/187 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG------GLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           + SP+E V+I LQ Q+     NG      G +  ++++ KE   K L RG     LR   
Sbjct: 156 LASPIEHVRIRLQTQTG----NGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGH 208

Query: 87  YSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
                +  YE         G+    ++ SW+                YPLD+V++ +   
Sbjct: 209 GLGCYFLTYEALIANEIKKGKD-RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267

Query: 147 TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
           T    +   S  +          ++  ++RE+G +  +++G  PT L   P     F  +
Sbjct: 268 TLRNPRFKNSMKN----------VINHLYREQG-ISAFFKGFAPTMLRAAPVNGATFVTF 316

Query: 207 ERLKALI 213
           E +  L+
Sbjct: 317 ELVMRLL 323

>Scas_662.12
          Length = 308

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 122/293 (41%), Gaps = 32/293 (10%)

Query: 33  VVSPVERVKILLQVQSSTTA--YNGGLVHAVKQVYKEEG-----------VKGLFRGNGI 79
           +V P++ +K+ LQ+ ++TT   +  G  + + ++                +K  +RG  I
Sbjct: 24  IVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIYNLIKESYRGLPI 83

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           N L      ++ + +Y   K  +F      +     +                T PL ++
Sbjct: 84  NLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIF--LTSGLISGISTTLLTNPLWVI 141

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TR+     + ++ H+     IR   G   LL +      G +  + G+ P+ LGV    
Sbjct: 142 KTRI----MSTSRHHKDSYKSIRH--GFKSLLTK-----EGPKAIWMGLLPSLLGVSQG- 189

Query: 200 ALNFALYERLK-----ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL 254
           A+ F +Y+ LK      L     D  +     + I ++S  ++   VYPF LL+   Q  
Sbjct: 190 AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTF 249

Query: 255 TMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
               + +          +  I R  G++G YKGL+ANL++ +P+  + + +YE
Sbjct: 250 RSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYE 302

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 29/42 (69%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRV 102
           ++++Y++ G+KGL++G   N LR  P + + + +YE  K+++
Sbjct: 267 IRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFKSKL 308

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDI-RRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           YP  L+++ L  QT       RS  ++I +     + L+R+I+R+ G ++G Y+G+    
Sbjct: 237 YPFQLLKSNL--QT------FRSVTNNIPQNDYHFITLIRKIYRDNG-IKGLYKGLSANL 287

Query: 193 LGVVPFVALNFALYERLKA 211
           L  +P   + F +YE  K+
Sbjct: 288 LRAIPSTCITFCIYENFKS 306

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 17/88 (19%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVL---TMGQSELGFRYASVADALWTIGRQEGLRG--- 283
           G  +G +   +V+P DL++ R Q+L   T  Q + G+ Y  + + L    ++ G +G   
Sbjct: 14  GLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTY--LINELINNSKKMGSQGPIY 71

Query: 284 -----YYKGLTANLVKVVPAMAVQWFVY 306
                 Y+GL  NL+      AV W +Y
Sbjct: 72  NLIKESYRGLPINLL----GNAVAWSLY 95

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 118/282 (41%), Gaps = 24/282 (8%)

Query: 36  PVERVKILLQVQSSTTAYN---GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           P++ +K+ +Q+  +         G +    ++Y+ EG    ++G G   + I P  A+++
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
           + YEF +T +    ++G     S                      +   ++ +Q  +L  
Sbjct: 90  SSYEFYRT-LLADKETGK---VSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNP 145

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
           +  +  +        V+    I +EEG     YRGV  T+         NF +Y +LK  
Sbjct: 146 VEGAPKYK-----NAVQACYTIVKEEG-FSALYRGVSLTAARQATNQGANFTVYSKLKEF 199

Query: 213 IPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADA 271
           +   ++   + + + + IG +SG I      P D ++ R Q     ++  G +  ++   
Sbjct: 200 LQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITI--- 256

Query: 272 LWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
              IG+Q    EG R  YKG+T  +++V P  AV +  YE I
Sbjct: 257 ---IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 83/175 (47%), Gaps = 12/175 (6%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +PLD ++ R+ I        +++      + PG ++    I+R EG L  +Y+G+    +
Sbjct: 29  HPLDTIKVRMQI--------YKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKGLGAVVI 79

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGI--AQTVVYPFDLLRRRF 251
           G+ P +A+ F+ YE  + L+  D + G V+     I  V  GI  A  VV P ++++ R 
Sbjct: 80  GITPKMAIRFSSYEFYRTLLA-DKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRL 138

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           Q   +   E   +Y +   A +TI ++EG    Y+G++    +        + VY
Sbjct: 139 QAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVY 193

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 64/155 (41%), Gaps = 16/155 (10%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWE 117
           V A   + KEEG   L+RG  +   R        + VY   K + F  G    E L SWE
Sbjct: 156 VQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS--KLKEFLQGYHNQEMLPSWE 213

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRL--SIQTANLAKLHRSKAHDIRRPPGIVELLRRIF 175
                            PLD ++TRL     T N++ L R           I  + +++ 
Sbjct: 214 TSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR-----------ITIIGKQLI 262

Query: 176 REEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           +EEG  R  Y+G+ P  + V P  A+ F  YE ++
Sbjct: 263 QEEG-FRALYKGITPRVMRVAPGQAVTFTAYEFIR 296

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 35  SPVERVKILLQVQSSTTAYNG--GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +P++ +K  LQ   ST   +G   +    KQ+ +EEG + L++G     +R+ P  AV +
Sbjct: 230 APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289

Query: 93  AVYEFCKTRVFHVG 106
             YEF +  +   G
Sbjct: 290 TAYEFIRKELEKTG 303

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           S  A  L  G  +G +     +P D ++ R Q+        G +          I R EG
Sbjct: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGS-GVKAPGFIKTGGEIYRNEG 66

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYEL 308
              +YKGL A ++ + P MA+++  YE 
Sbjct: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEF 94

>Scas_589.10
          Length = 316

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 77/162 (47%), Gaps = 12/162 (7%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRP--PGIVELLRRIFREEGGLRGWYRGVYPT 191
           YPLD+V+TR  +Q  N   L  S     ++P    I+  L +I +EE G +  Y+G+ P 
Sbjct: 32  YPLDVVKTRFQLQI-NKKALATSSVAVPKQPEHSSILSCLSKILKEE-GFKNLYKGMSPP 89

Query: 192 SLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT-VVYPFDLLRRR 250
            L  VP  A+ FA  E+ + ++   +    V +    +     GI ++ +V PF+L++ R
Sbjct: 90  LLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIR 149

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292
            Q     QS+    Y S      TI   +GL G Y G  + +
Sbjct: 150 LQD---AQSD----YRSPIRCTRTIIENQGLFGIYAGFESTI 184

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 110/276 (39%), Gaps = 33/276 (11%)

Query: 36  PVERVKILLQVQSSTTAY------------NGGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           P++ VK   Q+Q +  A             +  ++  + ++ KEEG K L++G     L 
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
             P  AV++A  E  + +   + +   +++ S                   P +LV+ RL
Sbjct: 93  EVPKRAVKFASNE--QFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRL 150

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                      +    D R P   +   R I  E  GL G Y G   T      + A  F
Sbjct: 151 -----------QDAQSDYRSP---IRCTRTII-ENQGLFGIYAGFESTIWRNTIWNASYF 195

Query: 204 ALYERLKALIPHDYDAGSVAAAK--LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
            L  ++K  IP           +    +GA++G ++  +  PFD+++ R Q     ++  
Sbjct: 196 GLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ--GSKKTSS 253

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           G  Y     +++ I R EG++G YKG+   + +  P
Sbjct: 254 GMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGF---------RYASVADALWTIGRQEG 280
           GAV+G     ++YP D+++ RFQ L + +  L            ++S+   L  I ++EG
Sbjct: 20  GAVAGMSETIMMYPLDVVKTRFQ-LQINKKALATSSVAVPKQPEHSSILSCLSKILKEEG 78

Query: 281 LRGYYKGLTANLVKVVPAMAVQW 303
            +  YKG++  L+  VP  AV++
Sbjct: 79  FKNLYKGMSPPLLMEVPKRAVKF 101

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 117/290 (40%), Gaps = 37/290 (12%)

Query: 31  RTVVSPVERVKILLQVQSSTTAYNG-----GLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
            +V+ P++ +K  LQ   + +   G      ++  +  +  +EG   L++G     L   
Sbjct: 33  HSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAG 92

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           P  AV +A YE  K+ +     S   +   ++                 P D+++ R+ +
Sbjct: 93  PAHAVYFATYEMVKSFLIDEATST-SKYHFFKTAFSGATATIAADALMNPFDVIKQRIQL 151

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV-VPFVALNFA 204
            T N++               + +  +RI+ +EG  + +Y   YPT+L + +PF A NF 
Sbjct: 152 NT-NIS---------------VWDTAKRIYSKEG-FQAFYSS-YPTTLAINIPFAAFNFG 193

Query: 205 LYERLKALIPHDYDAGSV--AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELG 262
           +Y+         ++   V         G +SG     +  P D ++   QV   G  ++ 
Sbjct: 194 IYDTATRY----FNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQV--RGSEKVS 247

Query: 263 FRYASVAD----ALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
                 AD    A   I +  G RG++ G+   ++  +PA A+ W  YE 
Sbjct: 248 MEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEF 297

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 79/183 (43%), Gaps = 16/183 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           +++P + +K  +Q+ ++ + ++       K++Y +EG +  +           P++A  +
Sbjct: 138 LMNPFDVIKQRIQLNTNISVWD-----TAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNF 192

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
            +Y+   TR F+   SG      +                T PLD ++T L ++ +    
Sbjct: 193 GIYD-TATRYFN--PSG--VYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVS 247

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
           +   K  D  +     +  R I++  G  RG++ GV P  L  +P  A+++  YE  K  
Sbjct: 248 MEVFKQADTFK-----KATRAIYQVYG-WRGFWSGVKPRILANMPATAISWTAYEFAKHF 301

Query: 213 IPH 215
           + H
Sbjct: 302 LFH 304

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 224 AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL----TMGQSELGFRYASVADALWTIGRQE 279
           A +L  GA +G    +V++P D L+ R Q +    T G   +    +++   L +I  QE
Sbjct: 19  AHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIP---STMLRQLSSISAQE 75

Query: 280 GLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           G    +KG+ + L+   PA AV +  YE++
Sbjct: 76  GSMVLWKGVQSVLLGAGPAHAVYFATYEMV 105

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 70/147 (47%), Gaps = 13/147 (8%)

Query: 166 GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY-----DAG 220
           G+V    ++  ++G   G YRGV P S+      A+    Y ++K L+  DY     D  
Sbjct: 232 GMVSNYAKLLSDQG-FSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLV-QDYTNVPKDKP 289

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
             +     +GA SG +      P D ++ R Q L  GQ      Y+S  +   TI ++EG
Sbjct: 290 LSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQ------YSSTINCFATIFKEEG 343

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYE 307
           L+ ++KG T  L +++ +  + + +YE
Sbjct: 344 LKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 20/186 (10%)

Query: 30  SRTVVSPVERVKILL--QVQSSTTAY--NG-GLVHAVKQVYKEEGVKGLFRGNGINCLRI 84
           S   V+P E +K  L    Q++   Y  NG G+V    ++  ++G  GL+RG     +R 
Sbjct: 201 SVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQ 260

Query: 85  FPYSAVQYAVYEFCKTRV-FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
               AV+   Y   KT V  +      + L S                 T P+D V+TR+
Sbjct: 261 AANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRM 320

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
             Q+ N  +   +           +     IF+EE GL+ +++G  P    ++    + F
Sbjct: 321 --QSLNAGQYSST-----------INCFATIFKEE-GLKTFWKGATPRLGRLILSGGIVF 366

Query: 204 ALYERL 209
            +YE++
Sbjct: 367 TIYEKV 372

>Scas_640.25
          Length = 306

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 118/287 (41%), Gaps = 37/287 (12%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG------GLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           V+ P++ VK  +Q+Q ST A         G++  + Q+ K+EG   +++G     L   P
Sbjct: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAP 89

Query: 87  YSAVQYAVY-EFCK--TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
             AV++A   EF K    VF     G +QL                     P +LV+ RL
Sbjct: 90  KRAVKFASNDEFIKLWKSVF-----GTKQLTQQISVLSGASAGITEALVIVPFELVKIRL 144

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
             Q  N             +  G VE+L+ I +++ GL+G Y GV  T      + A  F
Sbjct: 145 --QDVN------------SKFKGPVEVLKHIIKQD-GLKGLYSGVESTVWRNAVWNAGYF 189

Query: 204 ALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV----LTMGQS 259
            +  +++ L+P            L  G V G        PFD+++ R Q     +  G  
Sbjct: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           +  + + SV      I  +EG R  YKG    ++++ P  AV   V+
Sbjct: 250 KYNWTWPSVMK----IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 230 GAVSGGIAQTVVYPFDLLRRR--FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
           GA++G     V+YP D+++ R   QV T         Y  V D L  I ++EG    YKG
Sbjct: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKG 79

Query: 288 LTANLVKVVPAMAVQW 303
           +++ ++   P  AV++
Sbjct: 80  ISSPMLMEAPKRAVKF 95

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 60  AVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHE 111
           +V ++Y EEG + L++G     LR+ P  AV   V+    T V +V +  HE
Sbjct: 257 SVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF----TNVMNVFREFHE 304

>Scas_558.2
          Length = 289

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 82/179 (45%), Gaps = 20/179 (11%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P E +K   QV S+ +++       +K   +E  ++ L+RG     +R  P++ +Q+ +Y
Sbjct: 119 PAEVIKQRTQVHSTNSSWQT-FRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPLY 177

Query: 96  EFCKTR-VFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           EF K     +  + GH  L+ W+               T PLD ++TRL +   ++    
Sbjct: 178 EFMKKEWALYDNEVGH--LKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIP--- 232

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
                       I  L+R I++EE G + ++ G+YP ++ +    A+   +YE +  ++
Sbjct: 233 ------------IKSLIRNIYKEE-GFKIFFSGIYPRTMWISAGGAIFLGVYETMHFML 278

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 118/292 (40%), Gaps = 55/292 (18%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P++ +K  LQ +       GG        ++  G  G++RG G   +   P +++ +
Sbjct: 23  VFFPIDTLKTRLQAK-------GGF-------FQNGGYHGIYRGLGSAVVASAPSASLFF 68

Query: 93  AVYEFCKTRVF-HV----GQSGHEQLRSWERXXXXXXXXXXXXXXTY---PLDLVRTRLS 144
             Y+  K RV  HV      SG     S +                    P ++++ R  
Sbjct: 69  VTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQ 128

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFR---EEGGLRGWYRGVYPTSLGVVPFVAL 201
           + + N +                 +  R I +   +EG +R  YRG   T +  +PF  +
Sbjct: 129 VHSTNSSW----------------QTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCI 172

Query: 202 NFALYERLK---ALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMG 257
            F LYE +K   AL  +D + G +   K AI G+++GGIA     P D L+ R   L + 
Sbjct: 173 QFPLYEFMKKEWAL--YDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTR---LMLN 227

Query: 258 QSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           +  +      +   +  I ++EG + ++ G+    + +    A+   VYE +
Sbjct: 228 KDSI-----PIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETM 274

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 125/288 (43%), Gaps = 49/288 (17%)

Query: 34  VSPVERVKILLQVQ---SSTTAYNGG----------LVHAVKQVYKEEGVKGLFRGNGIN 80
           V P++  K ++Q Q   SS+   N G          +V  +  ++KE+G+ GL++G  + 
Sbjct: 21  VYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQGMTVT 80

Query: 81  CLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLR---------SWERXXXXXXXXXXXXX 131
            +  F  + V +  Y F +         G + L+         + E              
Sbjct: 81  TVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEELVLGVAAASISQL 140

Query: 132 XTYPLDLVRTR-LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG-LRGWYRGVY 189
            T P+ +V TR  ++ +A  AK                 +++ I+RE  G +  +++G+ 
Sbjct: 141 FTSPMAVVATRQQTVHSAESAKF--------------TNVIKDIYRENNGDITAFWKGLR 186

Query: 190 PTSLGVVPFVALNFALYERLKALIPHDY--DAGSVAAAK-LAIGAVSGGIAQTVVYPFDL 246
            T L +    ++ +A ++RLK +  HD+  DAGS++A +   +G +S  I+  V  P  +
Sbjct: 187 -TGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIV 245

Query: 247 LRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
            +   Q         G ++ +  +AL  + + EGL+  +KG+   L K
Sbjct: 246 AKAMLQ-------SAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQV-LTMGQSELGF--------RYASVADALWTIGRQEG 280
           GAV+  +A   VYP DL +   Q  ++   SE           RY +V D +  I +++G
Sbjct: 10  GAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKG 69

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVY 306
           + G Y+G+T   V    A  VQ FVY
Sbjct: 70  ILGLYQGMTVTTV----ATFVQNFVY 91

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 112/283 (39%), Gaps = 30/283 (10%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P +  K+ LQ  S+ T      +  V+++   EG +G ++G     + +    ++Q+
Sbjct: 42  VGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
            V E  K    H        L   +                 P++ VR RL  QT +   
Sbjct: 98  GVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGS--- 154

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
                  + + P   ++ LR         +   RG+ PT L         F +YE   AL
Sbjct: 155 ---GTNAEFKGPLECIKKLRHN-------KALLRGLTPTILREGHGCGTYFLVYE---AL 201

Query: 213 IPHDYDA------GSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           I +  +         + A KL I GA+SG     +VYP D+++   Q   + + + G   
Sbjct: 202 IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSI 261

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +SVA  L+  G   G+  ++KG    +++  PA    +  +EL
Sbjct: 262 SSVAKTLYANG---GIGAFFKGFGPTMLRAAPANGATFATFEL 301

>Kwal_26.8669
          Length = 296

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 120/280 (42%), Gaps = 28/280 (10%)

Query: 33  VVSPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           V+ P++ VK  +Q+Q S        G+V  +KQ+  +EG   L++G     L   P  A 
Sbjct: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRAT 85

Query: 91  QYAVY-EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           ++A   EF K    +  + G E+L                     P +LV+ RL   +++
Sbjct: 86  KFACNDEFQK---IYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS 142

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                           G ++++R+I  +EG L   Y G+  T      + A  F +  ++
Sbjct: 143 YK--------------GPIDVVRKIIAQEGVL-AMYNGLESTLWRHGVWNAGYFGIIFQV 187

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ---VLTMGQSELGFRYA 266
           +AL+P            L  G++ G I   +  PFD+++ R Q   V+  G  +  + + 
Sbjct: 188 RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP 247

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           S+    +TI ++EG R  YKG    ++++ P   +   V+
Sbjct: 248 SI----FTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
           + A GAV+G     V+YP D+++ R Q+   G   LG +Y  V D +  I  +EG    Y
Sbjct: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEGASRLY 69

Query: 286 KGLTANLVKVVPAMAVQW 303
           KG+++ ++   P  A ++
Sbjct: 70  KGISSPVLMEAPKRATKF 87

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 111/284 (39%), Gaps = 42/284 (14%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ VK  +Q++   T YN G+V + +++  EEG   L  G G   L      A ++  Y
Sbjct: 33  PIDVVKTRIQLEP--TVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXX---XXXXXXXXXXXXTYPLDLVRTRLSIQT--ANL 150
           E  K   F +   G++    ++                    PL+  R RL  Q   AN 
Sbjct: 91  EVFKK--FFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFAN- 147

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
                          G+V    RI +EE G+  +Y G  P     +P+    F ++ER  
Sbjct: 148 ---------------GLVGGFSRILKEE-GVGSFYSGFTPILFKQIPYNIAKFLVFERAS 191

Query: 211 ALI-----PHD-YDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM--GQSELG 262
            L      P D     S+ A  L  G  +G  A  V  P D L  +    +   GQS +G
Sbjct: 192 ELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVG 251

Query: 263 FRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                    L+ + +Q G  G + GL   LV V    ++Q+ +Y
Sbjct: 252 L--------LFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 69/177 (38%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G+V   R+I  EEG       G  PT LG
Sbjct: 33  PIDVVKTRIQLEPTVYNK-------------GMVGSFRKIIAEEGA-GALLTGFGPTLLG 78

Query: 195 VVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAIGAVSGG--IAQTVVYPFDLLRRR 250
                A  F  YE  K        YD  +     + IG+ +    +A   + P +  R R
Sbjct: 79  YSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIR 138

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+  F    V      I ++EG+  +Y G T  L K +P    ++ V+E
Sbjct: 139 LV------SQPTFANGLVG-GFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

>Scas_328.1
          Length = 227

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 85/170 (50%), Gaps = 9/170 (5%)

Query: 133 TYPLDLVRTRLSI-QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           ++P+  +  RL   +  + AK  +S A   R+  GI+++ ++    +G L G YRG  P+
Sbjct: 49  SFPIVCLFLRLCKNEIGSDAKSIKSGAP--RKFNGILDVYKKTLFTDGVL-GLYRGFLPS 105

Query: 192 SLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRF 251
            +G++ +  L F LY+ LK ++       +   + L   AV+   A T  YP D +RRR 
Sbjct: 106 VVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFLLGWAVTIS-ASTTSYPLDTVRRR- 163

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301
            ++T GQ+    +Y    D    I  QEG+   +KG  AN+ + V A  V
Sbjct: 164 MMMTSGQA---VKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV 210

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLR 83
           + T   P++ V+  + + S       G +   +Q+  +EGV  LF+G G N  R
Sbjct: 150 ASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 50/124 (40%), Gaps = 15/124 (12%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRS 115
           G++   K+    +GV GL+RG   + + I  Y  + + +Y+  K  V   G   +  L S
Sbjct: 81  GILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKP-VLLTGSFENAFLPS 139

Query: 116 WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIF 175
           +                +YPLD VR R+ + +    K             G ++  ++I 
Sbjct: 140 F---LLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYK-----------GAIDCFQQIV 185

Query: 176 REEG 179
            +EG
Sbjct: 186 SQEG 189

>Kwal_27.12599
          Length = 304

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 110/280 (39%), Gaps = 26/280 (9%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P +  K+ LQ  ++ T      V  VK++ K EG++G ++G     + +    + Q+
Sbjct: 41  VGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQF 96

Query: 93  AVYEFCKTRVFHVGQSG--HEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            V E  K   F  G S   H+ L   +                 P++ VR RL  QTA+ 
Sbjct: 97  GVNEAMKR--FFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTAS- 153

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
                    + + P   +  L    R  G L    RG+ PT L      A  F  YE L 
Sbjct: 154 -----GTVAEFKGPLDCINKL----RANGAL---MRGLSPTILREAQGCATYFLTYEALV 201

Query: 211 A-LIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV 268
           A  I        V A KL + GAVSG      VYP D+++   Q   +     G     V
Sbjct: 202 ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261

Query: 269 ADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           A     +  + G + ++KG    +++  PA    +  +EL
Sbjct: 262 AR---LVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 47/95 (49%), Gaps = 13/95 (13%)

Query: 214 PHDYDAGSVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADAL 272
           PHD  +G V    LA    +GG+AQ +V  PFD  + R Q  T   + +        + +
Sbjct: 18  PHD--SGRVLKDLLA--GTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV--------EVV 65

Query: 273 WTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             + + EGLRG+YKG    LV V   ++ Q+ V E
Sbjct: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNE 100

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 71/182 (39%), Gaps = 32/182 (17%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P D  + RL   T                P   VE+++++ + EG LRG+Y+G     +G
Sbjct: 44  PFDTTKVRLQTSTT---------------PTTAVEVVKKLVKNEG-LRGFYKGTLTPLVG 87

Query: 195 VVPFVALNFALYERLKALI------PHDYDAGSVAAAKLAIGAVSGGIAQT-VVYPFDLL 247
           V   V+  F + E +K         PH     ++   +  I    GG+A + +  P + +
Sbjct: 88  VGACVSCQFGVNEAMKRFFRGSSADPHK----TLTLPQYYICGFVGGVANSFLASPIEHV 143

Query: 248 RRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           R R Q  T   +   F+       L  I +        +GL+  +++     A  +  YE
Sbjct: 144 RIRLQTQTASGTVAEFK-----GPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYE 198

Query: 308 LI 309
            +
Sbjct: 199 AL 200

>Kwal_23.3529
          Length = 395

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 81/178 (45%), Gaps = 18/178 (10%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           + LD V+TR   Q A  A  +R+          ++   ++IF EEG  RG Y G     L
Sbjct: 104 HSLDTVKTRQ--QGAPNAPKYRN----------MISAYQKIFMEEGIRRGLYGGYTAAML 151

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVY-PFDLLRRRFQ 252
           G  P  A+ F  YE  K  +  D+      +   A   +SG +  +VVY P ++L+ R Q
Sbjct: 152 GSFPSAAIFFGTYELTKRKLIDDWGVNETLSHLTA--GLSGDLVSSVVYVPSEVLKTRLQ 209

Query: 253 V---LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +           G+ Y ++ DA+  I R EG +  + G  A L + +P  A Q+  YE
Sbjct: 210 LQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 73/172 (42%), Gaps = 17/172 (9%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVH----------AVKQVYKEEGVKGLFRGNGI 79
           S  V  P E +K  LQ+Q     YN    H          A+  + + EG + LF G   
Sbjct: 194 SSVVYVPSEVLKTRLQLQG---CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKA 250

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDL 138
              R  P+SA Q+A YE  +   F + G++  + L                   T P+D+
Sbjct: 251 TLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDV 310

Query: 139 VRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190
           ++TR  IQT   + +       +R    +++ L  ++R EG L G++ GV P
Sbjct: 311 IKTR--IQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTL-GFFSGVGP 359

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 119/295 (40%), Gaps = 36/295 (12%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVK-GLFRGNGINCLRIFPYSAV 90
           +V+  ++ VK   Q   +   Y   ++ A ++++ EEG++ GL+ G     L  FP +A+
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKYRN-MISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA-N 149
            +  YE  K ++  +   G  +  S                   P ++++TRL +Q   N
Sbjct: 160 FFGTYELTKRKL--IDDWGVNETLS--HLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYN 215

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGW---YRGVYPTSLGVVPFVALNFALY 206
               H    +   R   I  ++R        L GW   + G   T    +PF A  FA Y
Sbjct: 216 NPHFHSGYNYRNLRD-AITAIVR--------LEGWQTLFFGYKATLCRDLPFSAFQFAFY 266

Query: 207 ERLK--ALIPHDYDAGSVAAAKLAI------GAVSGGIAQTVVYPFDLLRRRFQV----- 253
           E+ +  A        G   +  L++      GA +GG+A  +  P D+++ R Q      
Sbjct: 267 EKFRQWAFTLE----GKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPST 322

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +    + L     S+   L  + R EG  G++ G+    +      ++   +Y++
Sbjct: 323 VASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQV 377

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 12/136 (8%)

Query: 177 EEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY-----DAGSVAAAKLAIGA 231
           ++ G RG Y GV P S+      A+    Y ++K L+  DY     D    +     +GA
Sbjct: 162 KDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLV-QDYTGAPKDKPLTSGLTFIVGA 220

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
            SG +      P D ++ R Q LT        +Y+S  +   TI ++EGL+ ++KG T  
Sbjct: 221 FSGVVTVYATMPIDTVKTRMQSLTAS------KYSSTLNCFTTIYKEEGLKTFWKGATPR 274

Query: 292 LVKVVPAMAVQWFVYE 307
           L +++ +  + + +YE
Sbjct: 275 LGRLILSGGIVFTIYE 290

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 73/186 (39%), Gaps = 20/186 (10%)

Query: 30  SRTVVSPVERVKILL--QVQSSTTAY-NGGLVHAVK--QVYKEEGVKGLFRGNGINCLRI 84
           S   V+P E +K +L    QS    Y N G   A     + K+EG +GL+ G     +R 
Sbjct: 121 SVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQ 180

Query: 85  FPYSAVQYAVYEFCKTRV-FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
               AV+   Y   K  V  + G    + L S                 T P+D V+TR+
Sbjct: 181 AANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
              TA+             +    +     I++EE GL+ +++G  P    ++    + F
Sbjct: 241 QSLTAS-------------KYSSTLNCFTTIYKEE-GLKTFWKGATPRLGRLILSGGIVF 286

Query: 204 ALYERL 209
            +YE +
Sbjct: 287 TIYENV 292

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GA++G +  ++ YPF+  + R Q++   +S    R   V   ++   + +G+   Y G  
Sbjct: 17  GALAGAVEASITYPFEFAKTRLQLID--KSSKASRNPLV--LIYNTAKTQGVGAIYVGCP 72

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A +V      A ++  Y+ I
Sbjct: 73  AFIVGNTAKAATRFLGYDTI 92

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 113/268 (42%), Gaps = 30/268 (11%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P +  K+ LQ   ++T      V  +K + K EG  G ++G     + +    ++Q+
Sbjct: 40  VGQPFDTTKVRLQTSETST----NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQF 95

Query: 93  AVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
            V E  K R FH   ++  + L   +                 P++ +R RL  QT + A
Sbjct: 96  GVNEAMK-RFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGA 154

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
                         G ++ ++++ R  G L    RG+ PT L       + F  YE   A
Sbjct: 155 TAEFK---------GPIDCIKKL-RVNGQL---MRGLTPTMLRESHGCGVYFLTYE---A 198

Query: 212 LIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYA 266
           LI H   +G     + A KL + GA SG +  T+VYP D+++   Q   +   + G    
Sbjct: 199 LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNIL 258

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVK 294
           +V   +  I RQ G+ G +KG    +++
Sbjct: 259 TVGRTI--IARQ-GVSGLFKGFAPTMLR 283

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAV-KQVYKEEGVKGLFRGNGINCLR 83
           T+V P++ +K ++Q  +  T  NG  +  V + +   +GV GLF+G     LR
Sbjct: 231 TMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 13/149 (8%)

Query: 166 GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY-----DAG 220
           G+V     + R++G   G YRGV P S+      A+    Y ++K LI  DY     D  
Sbjct: 154 GVVRNYSSLVRDKG-FSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLI-QDYTDSPKDKP 211

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
             +     +GA SG +      P D ++ R Q L         +Y+S  +   TI ++EG
Sbjct: 212 LSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLD------STKYSSTMNCFATIFKEEG 265

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           L+ ++KG T  L ++V +  + + +YE +
Sbjct: 266 LKTFWKGATPRLGRLVLSGGIVFTIYEKV 294

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 80/190 (42%), Gaps = 20/190 (10%)

Query: 30  SRTVVSPVERVKILL--QVQSSTTAY--NG-GLVHAVKQVYKEEGVKGLFRGNGINCLRI 84
           S   V+P E +K  L    QS+T  Y  NG G+V     + +++G  GL+RG     +R 
Sbjct: 123 SVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQ 182

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQ-LRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
               AV+   Y   KT +     S  ++ L S                 T PLD V+TR+
Sbjct: 183 AANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRM 242

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                        ++ D  +    +     IF+EE GL+ +++G  P    +V    + F
Sbjct: 243 -------------QSLDSTKYSSTMNCFATIFKEE-GLKTFWKGATPRLGRLVLSGGIVF 288

Query: 204 ALYERLKALI 213
            +YE++  ++
Sbjct: 289 TIYEKVLVML 298

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 12/135 (8%)

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY-----DAGSVAAAKLAIGAVSG 234
           GL G YRGV P S+      A+    Y ++K ++  DY     D    +     +GA SG
Sbjct: 164 GLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMV-QDYTNAPKDKPLSSGLTFVVGAFSG 222

Query: 235 GIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
            +      P D ++ R Q L         RY+S  +   TI ++EGL+ ++KG T  L +
Sbjct: 223 IVTVYTTMPIDTVKTRMQSLDSK------RYSSTINCFTTIFKEEGLKAFWKGATPRLGR 276

Query: 295 VVPAMAVQWFVYELI 309
           +  +  + + VYE +
Sbjct: 277 LFLSGGIVFTVYEKV 291

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ VK   ++QS  +      ++    ++KEEG+K  ++G      R+F    + + VY
Sbjct: 231 PIDTVKT--RMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVY 288

Query: 96  E 96
           E
Sbjct: 289 E 289

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G ++G +  +V YPF+  + R Q+L   ++    R   V   ++   + +G+   Y G  
Sbjct: 16  GCLAGAVEASVTYPFEFAKTRLQLLD--KASKASRNPLV--LIYNTAKTQGIGSVYVGCP 71

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A +V       V++  ++ I
Sbjct: 72  AFIVGNTAKAGVRFLGFDTI 91

>Kwal_26.7967
          Length = 297

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 12/137 (8%)

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDY-----DAGSVAAAKLAIGAV 232
           + G  G YRGV P S+      A+    Y ++K +I  DY     D    +     +GA 
Sbjct: 162 DKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMI-QDYTNSAKDKPLSSGMTFVVGAF 220

Query: 233 SGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292
           SG +      P D ++ R Q L         +Y+S  +   T+ R+EGL+ ++KG T  L
Sbjct: 221 SGIVTVYTTMPIDTVKTRMQSLDSS------KYSSTINCFATVFREEGLKTFWKGATPRL 274

Query: 293 VKVVPAMAVQWFVYELI 309
            +++ +  + + +YE +
Sbjct: 275 GRLILSGGIVFTIYEKV 291

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 24/156 (15%)

Query: 166 GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDA---GSV 222
           G+ E  R I+R EG  RG+++G   T+L   P+  L   LYE+ K ++P    A   G+ 
Sbjct: 141 GLAEATRHIWRSEGA-RGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGAD 199

Query: 223 AAAKLAIGA----------VSGGIAQTVVYPFDLLRRRFQVLTMGQSE-LGFRYASVADA 271
            + KL   A          +S  +A T+  PFD ++ R Q+    QS  +GF        
Sbjct: 200 ESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQL----QSHPVGF-----VQT 250

Query: 272 LWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           L  I  +E  R  + GL+  L +   +  + W +YE
Sbjct: 251 LRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYE 286

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 62/156 (39%), Gaps = 28/156 (17%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P+  +K+  + +S+  AYNG L  A + +++ EG +G F+G     LR  PY+ +  
Sbjct: 121 VTMPITVIKV--RYESTLYAYNG-LAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYV 177

Query: 93  AVYEFCK--------TRVFHVGQSGH--EQLRSWERXXXXXXXXXXXXXXTYPLDLVRTR 142
            +YE  K          +    +SG       +                 T P D ++TR
Sbjct: 178 LLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTR 237

Query: 143 LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREE 178
           + +Q+                P G V+ LR I  EE
Sbjct: 238 MQLQS---------------HPVGFVQTLRHIVCEE 258

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 77/181 (42%), Gaps = 35/181 (19%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLDL++TRL           +++A            LR + RE    R  +RG  P++L 
Sbjct: 28  PLDLLKTRL----------QQAQASS----------LRSVLREVRTTRELWRGTLPSALR 67

Query: 195 VVPFVALNFALYERLKALIPHDYDAGSVAA--------AKLAIGAVSGGIAQTVVYPFDL 246
                AL  +L    ++ +    +A + ++          L  GA+S      V  P  +
Sbjct: 68  TSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITV 127

Query: 247 LRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           ++ R++      S L + Y  +A+A   I R EG RG++KG  A  ++  P   +   +Y
Sbjct: 128 IKVRYE------STL-YAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY 180

Query: 307 E 307
           E
Sbjct: 181 E 181

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           T+ +P + +K  +Q+QS    +  G V  ++ +  EE  + LF G  +   R    + + 
Sbjct: 226 TLTAPFDTIKTRMQLQS----HPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIA 281

Query: 92  YAVYE 96
           + +YE
Sbjct: 282 WGIYE 286

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 111/271 (40%), Gaps = 24/271 (8%)

Query: 43  LLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRV 102
           + +V+  T+A +   V  V  + K EG+ G ++G     + +    + Q+ V E  K R 
Sbjct: 46  ITKVRMQTSAGSATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRF 105

Query: 103 FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIR 162
             +     + L   +                 P++ VR RL +QT +LA           
Sbjct: 106 RRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQ------ 159

Query: 163 RPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAG-- 220
              G ++ +R++ ++   +RG+   +  T  G      + F+ YE   ALI + +  G  
Sbjct: 160 ---GSLDCMRKLLKQGALMRGFTATLMRTCHG----FGIYFSTYE---ALIANQHKKGIP 209

Query: 221 --SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGR 277
              +A  K+ I GA SG     + YP D+++   Q   +     G     VA +++T   
Sbjct: 210 RKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYT--- 266

Query: 278 QEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             G R + KG    +++ +P     +  +E+
Sbjct: 267 TRGKRAFIKGFMPAMLRSLPVNGATFATFEM 297

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 224 AAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
           A K  +   +GGIAQ +V  PFD+ + R Q  + G        A+  D + ++ + EG+ 
Sbjct: 23  AIKDILSGTAGGIAQVLVGQPFDITKVRMQT-SAGS-------ATAVDVVTSLIKNEGIL 74

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYE 307
           G+YKG  A LV V   ++ Q+ V E
Sbjct: 75  GFYKGTLAPLVGVGACVSCQFGVNE 99

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 72/178 (40%), Gaps = 19/178 (10%)

Query: 33  VVSPVERVKILLQVQSSTTA---YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + +P+E V+I LQ+Q+ + A   Y G L   ++++ K+     L RG     +R      
Sbjct: 135 LATPIEHVRIRLQLQTKSLANAEYQGSL-DCMRKLLKQ---GALMRGFTATLMRTCHGFG 190

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           + ++ YE         G    + +  W+                YP+D+V++ +  Q+  
Sbjct: 191 IYFSTYEALIANQHKKGIP-RKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIM--QSDR 247

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
           L     S  H       + ++ + I+   G  R + +G  P  L  +P     FA +E
Sbjct: 248 LV----SPVHGTN----VWQVAKSIYTTRGK-RAFIKGFMPAMLRSLPVNGATFATFE 296

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQYAV 94
           P E VK   QV S+ +++    + ++ +   +EG+ K L+RG     +R  P++ +Q+ +
Sbjct: 114 PAEVVKQRTQVHSTNSSWQ--TLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPL 171

Query: 95  YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           YE+ K        +G  Q+  W+               T PLD ++TRL         L+
Sbjct: 172 YEYLKKT--WAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRL--------MLN 221

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
           ++ A        +  ++ RI+REEG    ++ GV P ++ +    A+   +YE + +L+ 
Sbjct: 222 KTTAS-------LGSVIIRIYREEGPAV-FFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

Query: 215 HDY 217
             +
Sbjct: 274 KSF 276

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 109/283 (38%), Gaps = 41/283 (14%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P++ +K  LQ +       GG        +   G KG++RG G   +   P +++ +
Sbjct: 21  VFFPIDTIKTRLQAK-------GGF-------FANGGYKGIYRGLGSAVVASAPGASLFF 66

Query: 93  AVYEFCKTR----VFHVGQSGHEQL-RSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
             Y++ K +    +  +   G EQL  +                   P ++V+       
Sbjct: 67  ISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVK------- 119

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
                  R++ H        ++ + R   +EG  +  YRG   T +  +PF  + F LYE
Sbjct: 120 ------QRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYE 173

Query: 208 RLKALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYA 266
            LK           V   K AI G+++GGIA     P D L+ R          L    A
Sbjct: 174 YLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLM--------LNKTTA 225

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           S+   +  I R+EG   ++ G+    + +    A+   +YE +
Sbjct: 226 SLGSVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETV 268

>Kwal_23.4354
          Length = 343

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 115/276 (41%), Gaps = 25/276 (9%)

Query: 44  LQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF 103
           ++ ++S   YN     A  ++ K EGV+ L+RG  I  L   P + V +  YE  + +  
Sbjct: 75  VRCKTSPVRYNSTW-DAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDK-- 131

Query: 104 HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRR 163
                  ++  +                   PL+L RTRL  Q+   +    + A  I+ 
Sbjct: 132 ---SRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRL--QSIPRSSPKSTTAMMIK- 185

Query: 164 PPGIVELLRRIFRE--EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGS 221
                +L++    E  + G +  +RG+  T    VPF ++ +  YE  K+ +  D +   
Sbjct: 186 -----DLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSI 240

Query: 222 VAAAK---------LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADAL 272
           V ++             G+  G +A  + +PFD+ + R Q+  +  +       ++   L
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 273 WTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             + + EGL   Y GL   ++K+ P+ A+    YE+
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 20/193 (10%)

Query: 32  TVVSPVERVKILLQV------QSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           T V+P+E  +  LQ       +S+T      L+   +    + G K LFRG  I   R  
Sbjct: 156 TTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDV 215

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSG--HEQLRSWERXXXX----XXXXXXXXXXTYPLDLV 139
           P+S++ +  YEF K+ V    +    +    +W                    T+P D+ 
Sbjct: 216 PFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVG 275

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TR+ I   N + L +  + +      + + L ++ R+  GL   Y G+ P  + + P  
Sbjct: 276 KTRMQITYLN-STLEKKPSKN------MFKYLNQM-RKSEGLAALYTGLVPRVIKIAPSC 327

Query: 200 ALNFALYERLKAL 212
           A+  + YE  K L
Sbjct: 328 AIMISTYEVCKRL 340

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 77/184 (41%), Gaps = 24/184 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V +P ERVK++LQ     T+  G  + A K + KE G+  LF+G+     R  P SA+ +
Sbjct: 158 VTAPTERVKVVLQ-----TSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYF 212

Query: 93  AVYEFCK----TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
           A YE  K    +R         E +                    +P+D ++T+L     
Sbjct: 213 ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKL----- 267

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
                   +A   R+   ++   + I+ + GG++G++ G+ P  L   P  A  F   E 
Sbjct: 268 --------QASSTRQ--NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEM 317

Query: 209 LKAL 212
             +L
Sbjct: 318 THSL 321

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 73/177 (41%), Gaps = 15/177 (8%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRR--PPGIVELLRRIFREEGGLRGWYRGVYPT 191
           +P DL++ R     AN      S  H I         ++   +F     ++G+Y+GV P 
Sbjct: 54  HPFDLIKVRCQNGQAN------STVHAITNIIKEAKTQVKGTLFTNS--VKGFYKGVIPP 105

Query: 192 SLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRF 251
            LGV P  A++F  Y+  K L+  +   G      +   A +G I+            R 
Sbjct: 106 LLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERV 165

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +V+    S+      S   A  TI ++ G+   +KG  A L +  P  A+ +  YE+
Sbjct: 166 KVVLQTSSK-----GSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEI 217

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 20/90 (22%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQ----------- 278
           G V G  A    +PFDL++ R Q    GQ+       S   A+  I ++           
Sbjct: 42  GGVGGVCAVFTGHPFDLIKVRCQ---NGQAN------STVHAITNIIKEAKTQVKGTLFT 92

Query: 279 EGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             ++G+YKG+   L+ V P  AV ++ Y++
Sbjct: 93  NSVKGFYKGVIPPLLGVTPIFAVSFWGYDV 122

>Kwal_33.12988
          Length = 303

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 114/279 (40%), Gaps = 30/279 (10%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P +  K+ LQ  S+ T      +  V+ + K EG++G ++G  +  + +    + Q+   
Sbjct: 43  PFDITKVRLQTSSTPTT----ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTN 98

Query: 96  EFCKTRVFHVGQSGHE-QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           E  K R FH   +     LR  E                 P++ VR  L +QT + A   
Sbjct: 99  EAMK-RYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAE 157

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
              A D          ++++ +E   +RG+   +  TS G      + F  YE   A+I 
Sbjct: 158 YQGAMDC---------IKKLLKEGKLMRGFTPTILRTSHGF----GVYFTSYE---AMIC 201

Query: 215 HDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
            +   G     + A KL + GA SG +   +VYPFD+++   Q   +     G     VA
Sbjct: 202 SEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVA 261

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             ++    + G + + KG    +++ +P     +  +E+
Sbjct: 262 KNIY---NERGPKAFVKGFGPTMLRSLPVNGATFTAFEM 297

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 230 GAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGL 288
              +GGIAQ +V  PFD+ + R Q  +   + L          +  + + EGLRG+YKG 
Sbjct: 29  AGTTGGIAQVLVGQPFDITKVRLQTSSTPTTAL--------RVVQDLVKNEGLRGFYKGT 80

Query: 289 TANLVKVVPAMAVQWFVYE 307
           T  L+ V   ++ Q+   E
Sbjct: 81  TLPLIGVGLCVSSQFGTNE 99

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 118/284 (41%), Gaps = 35/284 (12%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P +  K+ LQ    T+    G++  V+ + + EG    ++G     L +    +VQ+ V 
Sbjct: 46  PFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN 101

Query: 96  EFCKTRVF------HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           E  K R F       V    H  L   +                 P++ VR RL  QT+ 
Sbjct: 102 ESMK-RFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQ 160

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                     + R+  G  + ++++ +     +   RG+ PT +     +   FA YE  
Sbjct: 161 ---------GNERQFKGPFDCIKKLAKA----KALMRGLLPTMIRAGHGLGTYFAAYE-- 205

Query: 210 KALIPHDYDAGS----VAAAKL-AIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR 264
            AL+  +++ G+    + A KL + GA+SG I    VYP D+++   Q  ++   +    
Sbjct: 206 -ALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNS 264

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
                 AL+   +Q G+  ++KG    +++  PA A  +  +E+
Sbjct: 265 IIKATRALY---KQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 34  VSPVERVKILLQVQS-STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V PV+ VK +LQ  S     Y   ++ A + +YK+ G+   F+G     +R  P +A  +
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 93  AVYEF 97
             +E 
Sbjct: 301 VSFEM 305

>Kwal_26.7653
          Length = 325

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 87/185 (47%), Gaps = 21/185 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P++LV+TR+ +Q    A   R     I + P  ++ L+ IF+ EG +RG  +G+    
Sbjct: 42  TNPIELVKTRMQLQGEMSADAQR-----IYKNP--MQALKVIFKNEG-IRGLQKGLSCAY 93

Query: 193 LGVVPFVALNFALYERLKALIPHDY----DAGSV--AAAKLAIGAVSGGIAQTVVYPFDL 246
           +  +         YE +++++   +    D   V   A  +  GA SG I   +  P  L
Sbjct: 94  IYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFL 153

Query: 247 LRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           ++ R Q     + +GQ      Y S+ + L +I R EG +G Y+G+ A +++     +VQ
Sbjct: 154 IKTRMQSYSNAIQIGQQT---HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQ 210

Query: 303 WFVYE 307
             +Y 
Sbjct: 211 LPIYN 215

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 113/277 (40%), Gaps = 28/277 (10%)

Query: 32  TVVSPVERVKILLQVQSSTTA-----YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86
           TV +P+E VK  +Q+Q   +A     Y   +  A+K ++K EG++GL +G  ++C  I+ 
Sbjct: 40  TVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQKG--LSCAYIYQ 96

Query: 87  --YSAVQYAVYEFCKT---RVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRT 141
              +  +   YE  ++   + F+     H+                       PL L++T
Sbjct: 97  IGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKT 156

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVAL 201
           R+    +N  ++ +   +       I   L  I+R EG  +G YRGV    L      ++
Sbjct: 157 RMQ-SYSNAIQIGQQTHYT-----SIWNGLSSIYRAEG-FKGLYRGVDAAILRTGAGSSV 209

Query: 202 NFALYERLKA-LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE 260
              +Y   K  L+ HD          L    VSG     V+ P+D+      +LT   ++
Sbjct: 210 QLPIYNTAKHFLLKHDLMKEGTGL-HLVASTVSGFGVGVVMNPWDV------ILTRVYNQ 262

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
            G  Y    D      R EG+   YKG  A + ++ P
Sbjct: 263 KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G ++  IA TV  P +L++ R Q+     ++    Y +   AL  I + EG+RG  KGL+
Sbjct: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90

Query: 290 A 290
            
Sbjct: 91  C 91

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 68/154 (44%), Gaps = 21/154 (13%)

Query: 167 IVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH---------DY 217
           I E  + I  +EG +RG++RG  PT L   P+  L   LYE+LK  +P          D 
Sbjct: 145 IAEAAKSIAAQEG-IRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDS 203

Query: 218 DAGSVAAAKLAIGA----VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALW 273
           +    A    AI +    +S  +A TV  PFD ++ R Q+          ++ +    L 
Sbjct: 204 EGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPT-------KFKTFWSTLT 256

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           TI  QE     + GL+  L +   +  + W +YE
Sbjct: 257 TIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 11/115 (9%)

Query: 43  LLQVQSSTTAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTR 101
           +++V+  +T YN   +  A K +  +EG++G FRG G  CLR  PYS +   +YE  K  
Sbjct: 130 IIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHT 189

Query: 102 VFHVGQSGHEQLRSWER----------XXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
           +  +      QL S  R                        T P D ++TR+ ++
Sbjct: 190 LPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLE 244

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
            L  GA + G    +  P  +++ R++      S L + Y S+A+A  +I  QEG+RG++
Sbjct: 110 NLVTGAFARGTVGYITMPITIIKVRYE------STL-YNYKSIAEAAKSIAAQEGIRGFF 162

Query: 286 KGLTANLVKVVPAMAVQWFVYE 307
           +G     ++  P   +   +YE
Sbjct: 163 RGFGPTCLRDAPYSGLYVLLYE 184

>Scas_697.47
          Length = 328

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 24/176 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V +P ER+K++LQ   + +  +   + A K + K+ GVK LF+G+     R  P SA+ +
Sbjct: 157 VTAPTERIKVVLQTAGANSKTS--FIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYF 214

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXT-----YPLDLVRTRLSIQT 147
           A YE  K   F   ++   + ++ E               +     +P+D ++T+L   +
Sbjct: 215 ASYEISKK--FLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSS 272

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
            + +               +V   R I+ + GG++G++ G+ P  L   P  A  F
Sbjct: 273 GSQS---------------MVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATF 313

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 118/292 (40%), Gaps = 48/292 (16%)

Query: 36  PVERVKILLQV-QSSTTAYNGGLVHAVKQVYKE-----------EGVKGLFRGNGINCLR 83
           P + +K+  Q  Q+S+T      +HA+K + K+             VKG ++G     L 
Sbjct: 56  PFDLIKVRCQSGQASST------IHAIKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLG 109

Query: 84  IFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
           + P  AV +  Y+  K ++     S   QL   +               T P + ++  L
Sbjct: 110 VTPIFAVSFWGYDVGK-KIVTRSDSSSAQLTMGQMAAAGFISAIPTTLVTAPTERIKVVL 168

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
               AN      SK   I     IV+        +GG++  ++G   T     P  AL F
Sbjct: 169 QTAGAN------SKTSFIGAAKNIVK--------DGGVKSLFKGSLATLARDGPGSALYF 214

Query: 204 ALYERLKALIPHDYDA------GSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTM 256
           A YE  K  + +D +A      G V  A + + G ++G     VV+P D ++ + Q  + 
Sbjct: 215 ASYEISKKFL-NDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSG 273

Query: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            QS        VA       ++ G++G++ GL   L++  PA A  +   EL
Sbjct: 274 SQSM-------VAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 18/179 (10%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKA--HDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           +P DL++ R     A+ + +H  K    D R  P    L+  +       +G+Y+GV P 
Sbjct: 55  HPFDLIKVRCQSGQAS-STIHAIKIILKDARAIPTSNMLVNSV-------KGFYKGVIPP 106

Query: 192 SLGVVPFVALNFALYERLKALIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVY-PFDLLRR 249
            LGV P  A++F  Y+  K ++   D  +  +   ++A       I  T+V  P + ++ 
Sbjct: 107 LLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTLVTAPTERIKV 166

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             Q  T G +       S   A   I +  G++  +KG  A L +  P  A+ +  YE+
Sbjct: 167 VLQ--TAGANS----KTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEI 219

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 8/87 (9%)

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV----ADALWTIGRQ-EGL 281
           L  G V G  A    +PFDL++ R Q    GQ+        +    A A+ T       +
Sbjct: 40  LVAGGVGGVCAVLTGHPFDLIKVRCQ---SGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 282 RGYYKGLTANLVKVVPAMAVQWFVYEL 308
           +G+YKG+   L+ V P  AV ++ Y++
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDV 123

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 85/186 (45%), Gaps = 21/186 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P D V+TR+ +Q     +LH + A     P   ++    IF+ EG + G  +G+    
Sbjct: 38  TNPFDCVKTRMQLQ----GELHANAAKVYTNP---IQAFGVIFKNEG-IAGLQKGLASAY 89

Query: 193 LGVVPFVALNFALYERLKALIPH----DYDAGSVA--AAKLAIGAVSGGIAQTVVYPFDL 246
           L  +         YE ++ ++ +    + ++  V      +A GA SG +   +  P  L
Sbjct: 90  LYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFL 149

Query: 247 LRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           ++ R Q     + +GQ      Y S  + L TI R EG++G ++G+ A +++     AVQ
Sbjct: 150 VKTRMQSYSNAIHIGQQT---HYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQ 206

Query: 303 WFVYEL 308
             +Y +
Sbjct: 207 LPIYNI 212

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 106/276 (38%), Gaps = 26/276 (9%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           TV +P + VK  +Q+Q    A    +    + A   ++K EG+ GL +G     L     
Sbjct: 36  TVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIAL 95

Query: 88  SAVQYAVYEFCK---TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
           +  +   YE  +     VF+     H+                       PL LV+TR+ 
Sbjct: 96  NGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRM- 154

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
            Q+ + A     + H      G    L  IFR EG ++G +RGV    L      A+   
Sbjct: 155 -QSYSNAIHIGQQTHYTSAFNG----LATIFRSEG-IKGLFRGVDAAMLRTGIGSAVQLP 208

Query: 205 LYERLKA-LIPHDY--DAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSEL 261
           +Y   K  L+ HD   D   +      I     G+A     P+D+      VLT   ++ 
Sbjct: 209 IYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN---PWDV------VLTRVYNQK 259

Query: 262 GFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           G  Y+   D      R EGL   YKG  A ++++ P
Sbjct: 260 GNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP 295

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 113/284 (39%), Gaps = 45/284 (15%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P++ +K  LQ +       GG        ++  G +G++RG G   +   P +++ +
Sbjct: 22  VFFPIDTLKTRLQAK-------GGF-------FRNGGYRGVYRGLGSAVVASAPGASLFF 67

Query: 93  AVYEFCK--TRVFHVGQSGHEQLRSW-ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             Y+ CK  TR F  G      +                      P ++V+ R       
Sbjct: 68  ITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVVKQR------- 120

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGG---LRGWYRGVYPTSLGVVPFVALNFALY 206
            ++ H S +          E LR I + E G    R  YRG   T +  +PF  + F LY
Sbjct: 121 -SQTHASHSS--------WETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLY 171

Query: 207 ERLKALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           E +K +     ++  V   K A+ G+++GGIA     P D L+ R  +          + 
Sbjct: 172 EYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCK--------KS 223

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             +   + TI ++EG + ++ G+    + +    A+   +YE +
Sbjct: 224 IPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETV 267

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKG----LFRGNGINCLRIFPYSAVQ 91
           P E VK   Q  +S +++       ++++ K E  +G    L+RG     +R  P++ +Q
Sbjct: 113 PAEVVKQRSQTHASHSSW-----ETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQ 167

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           + +YE+ K     + +S  +++  W+               T PLD ++TRL +   ++ 
Sbjct: 168 FPLYEYMKKVWAELDES--DRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSI- 224

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
                       P G   L+  I++EE G + ++ GV P ++ +    A+   +YE + +
Sbjct: 225 ------------PLGT--LVSTIYKEE-GFKVFFSGVGPRTMWISAGGAIFLGIYETVHS 269

Query: 212 LIPHD 216
           L+  +
Sbjct: 270 LLSTN 274

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 124/295 (42%), Gaps = 57/295 (19%)

Query: 36  PVERVKILLQVQSST---TAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQ 91
           P + VK+ LQ Q+S    T ++      +K  Y+ EG+ +G F+G     +     +A  
Sbjct: 33  PFDTVKVRLQTQASNVFPTTWS-----CIKFTYQNEGIARGFFQGIASPLVGACLENATL 87

Query: 92  YAVYEFCK------TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
           +  Y  C       T VF +GQ                           P++LV+ +L  
Sbjct: 88  FVSYNQCSKFLEKHTNVFPLGQ----------ILISGGVAGSCASLVLTPVELVKCKL-- 135

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT----SLGVVPFVAL 201
           Q ANL ++  +K    +  P I  ++      E GL G ++G   T    S G V +   
Sbjct: 136 QVANL-QVASAKTKHTKVLPTIKAIIT-----ERGLAGLWQGQSGTFIRESFGGVAW--- 186

Query: 202 NFALYERLKALIP--HDYDAGSVAAAKLAIGAVSGGIA----QTVVYPFDLLRRRFQVLT 255
            FA YE +K  +   H  D      +K+    +SGG A       ++P D ++   Q   
Sbjct: 187 -FATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQT-- 243

Query: 256 MGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
                    + S+ +A+  I  + GL+G+Y+GL   L + VPA A  ++++E +S
Sbjct: 244 --------EHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLS 290

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 25/187 (13%)

Query: 33  VVSPVERVKILLQVQ----SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           V++PVE VK  LQV     +S    +  ++  +K +  E G+ GL++G     +R     
Sbjct: 124 VLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGG 183

Query: 89  AVQYAVYEFCKTRV---FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
              +A YE  K  +     +     ++ + WE                +P D V++ +  
Sbjct: 184 VAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVM-- 241

Query: 146 QTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFAL 205
           QT +++               +   +++IF + G L+G+YRG+  T    VP  A  F +
Sbjct: 242 QTEHIS---------------LTNAVKKIFGKFG-LKGFYRGLGITLFRAVPANAAVFYI 285

Query: 206 YERLKAL 212
           +E L AL
Sbjct: 286 FETLSAL 292

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 113/278 (40%), Gaps = 30/278 (10%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKGLFRG--------NGI 79
           TV +P+E +KI +Q+Q   +A    +    +  +  ++K EG+KGL +G         G+
Sbjct: 38  TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGL 97

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           N  R+  Y  ++ ++      ++F   Q  H+                       PL LV
Sbjct: 98  NGSRLGFYEPIRSSL-----NQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLV 152

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TRL    +   K+     +      G+   L  IF+ EG ++G +RG+    L      
Sbjct: 153 KTRLQ-SYSEFIKIGEQTHYT-----GVWNGLVTIFKTEG-VKGLFRGIDAAILRTGAGS 205

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
           ++   +Y   K ++  +       A  L    +SG     V+ P+D+      +LT   +
Sbjct: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV------ILTRIYN 259

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           + G  Y    D L    R EG+   YKG  A + ++ P
Sbjct: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P++L++ R+ +Q     ++  S A   + P   ++ +  IF+ EG ++G  +G+    
Sbjct: 40  TNPIELIKIRMQLQ----GEMSASAAKVYKNP---IQGMAVIFKNEG-IKGLQKGLNAAY 91

Query: 193 LGVVPFVALNFALYE----RLKALIPHDYDAGSVAAAKLAI--GAVSGGIAQTVVYPFDL 246
           +  +         YE     L  L   D +   V +  + +  GA SG I   +  P  L
Sbjct: 92  IYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFL 151

Query: 247 LRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           ++ R Q     + +G+      Y  V + L TI + EG++G ++G+ A +++     +VQ
Sbjct: 152 VKTRLQSYSEFIKIGEQT---HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208

Query: 303 WFVYE 307
             +Y 
Sbjct: 209 LPIYN 213

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G ++  IA TV  P +L++ R Q+     +     Y +    +  I + EG++G  KGL 
Sbjct: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88

Query: 290 A 290
           A
Sbjct: 89  A 89

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 115/298 (38%), Gaps = 50/298 (16%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S  V+ P + +K  LQ    TT +       +K++      K L+RG   + LR    SA
Sbjct: 21  SAIVLQPFDLLKTRLQQNKDTTLWG-----TLKEI---RSPKQLWRGALPSSLRTSIGSA 72

Query: 90  VQYAVYEFC-------KTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTR 142
           +  +            KT+  + G S   QL  +E               T P+ +++ R
Sbjct: 73  LYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVR 132

Query: 143 LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALN 202
                      + S  +  +    + E  R I+  EG +RG++ G   T +   P+  L 
Sbjct: 133 -----------YESTMYSYK---SLGEATRHIYSTEG-IRGFFNGCGATVMRDAPYAGLY 177

Query: 203 FALYERLKALIPHDYDAGSVAAAKLAI-------------GAVSGGIAQTVVYPFDLLRR 249
             LYE+ K L+P    + +++  +  +               +S  +A T+  PFD ++ 
Sbjct: 178 VLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKT 237

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           R Q+          +++     L  I  +E  +  + GLT  L +   +  + W +YE
Sbjct: 238 RMQLDPT-------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYE 288

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 87/182 (47%), Gaps = 27/182 (14%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKE---EGV-KGLFRGNGINCLRIFPYSAVQ 91
           P E +K     Q + T +    +  ++ + ++   EGV +GL+RG     +R  P++ +Q
Sbjct: 113 PAEVIK-----QRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQ 167

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           + +YE+ K +      +  E++ +W+               T PLD+++TR+ +      
Sbjct: 168 FPLYEYLKKK--WAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMML------ 219

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
                  H+ R P  ++ L R +FREEG  R ++RG+ P ++ +    A+   +YE + +
Sbjct: 220 -------HERRVP--MLHLARTLFREEGA-RVFFRGIGPRTMWISAGGAIFLGVYEAVHS 269

Query: 212 LI 213
           L 
Sbjct: 270 LF 271

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 116/284 (40%), Gaps = 45/284 (15%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P++ +K  LQ +       GG  H         G +G++RG G   +   P +++ +
Sbjct: 22  VFFPIDTLKTRLQAK-------GGFFH-------NGGYRGIYRGLGSAVVASAPGASLFF 67

Query: 93  AVYEFCKTRVFHVG--QSGHEQLRS-WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
             Y+  K ++  V    +  EQL                      P ++++ R      N
Sbjct: 68  VTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTN 127

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFRE---EGGLRGWYRGVYPTSLGVVPFVALNFALY 206
            +                ++ LR I R+   EG +RG YRG + T +  +PF  + F LY
Sbjct: 128 SS----------------LQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLY 171

Query: 207 ERLKALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           E LK       +   V+A + A+ G+++GGIA     P D+L+ R          L  R 
Sbjct: 172 EYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMM--------LHERR 223

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             +     T+ R+EG R +++G+    + +    A+   VYE +
Sbjct: 224 VPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 18/87 (20%)

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG 280
           S   A L  GA +G     V +P D L+ R Q      ++ GF +              G
Sbjct: 3   STFLASLVSGAAAGTSTDVVFFPIDTLKTRLQ------AKGGFFH------------NGG 44

Query: 281 LRGYYKGLTANLVKVVPAMAVQWFVYE 307
            RG Y+GL + +V   P  ++ +  Y+
Sbjct: 45  YRGIYRGLGSAVVASAPGASLFFVTYD 71

>Scas_669.6
          Length = 373

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 4/139 (2%)

Query: 172 RRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGA 231
           R IF EEG  RG Y G +   LG  P  A+ F  YE  K  +  D        + L+ G 
Sbjct: 96  RTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDT-VSHLSAGL 154

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSEL---GFRYASVADALWTIGRQEGLRGYYKGL 288
           +   ++  V  P ++L+ R Q+     +     G+ Y S+  A+  I   EG++  + G 
Sbjct: 155 LGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGY 214

Query: 289 TANLVKVVPAMAVQWFVYE 307
            A L + +P  A+Q+  YE
Sbjct: 215 KATLARDLPFSALQFGFYE 233

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 94/224 (41%), Gaps = 18/224 (8%)

Query: 37  VERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQYAVY 95
           ++ VK   Q    T  Y   +  A + ++ EEG+ +GL+ G     L  FP +A+ +  Y
Sbjct: 72  LDTVKTRQQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTY 130

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
           E+CK ++  +G  G     S                   P ++++TRL +Q        +
Sbjct: 131 EWCKRKM--IGDLGFNDTVS--HLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQ 186

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH 215
           S  ++ R     +    RI     G++  + G   T    +PF AL F  YE+ +     
Sbjct: 187 S-GYNYRS----LRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQ-TAF 240

Query: 216 DYDAGSVAAAKLAI------GAVSGGIAQTVVYPFDLLRRRFQV 253
             +   +    L+I      GA++GG+A  +  P D+++ R Q 
Sbjct: 241 KLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQT 284

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 23/182 (12%)

Query: 30  SRTVVSPVERVKILLQVQSST------TAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           S  V  P E +K  LQ+Q         + YN   L  A++ +   EGVK LF G      
Sbjct: 160 SSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLA 219

Query: 83  RIFPYSAVQYAVYEFCKTRVFHVGQSG--HEQLRSWERXXXXXXXXXXXXXXTYPLDLVR 140
           R  P+SA+Q+  YE  +   F + +       L                   T P+D+++
Sbjct: 220 RDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIK 279

Query: 141 TRLSIQTANL------------AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188
           TRL  Q A++            AK ++ K+  I     I   L+ +++ EG + G++ GV
Sbjct: 280 TRLQTQQADINPNSATTVGAISAKTNK-KSRPIVLSNSIFRSLKLVYQSEGVI-GFFSGV 337

Query: 189 YP 190
            P
Sbjct: 338 GP 339

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 114/277 (41%), Gaps = 22/277 (7%)

Query: 33  VVSPVERVK--ILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           V+ P++ VK  + LQVQ     +  G+V  +K++   EGV  L++G     L   P  A 
Sbjct: 28  VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87

Query: 91  QYAVY-EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           ++A   EF K    +    G E+L                     P +LV+ RL   +++
Sbjct: 88  KFACNDEFQK---LYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS 144

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                           G V+++R+I   EG L   Y G+  T      +    F +  + 
Sbjct: 145 YK--------------GPVDVVRKIVAREGVL-AMYNGLESTLWRHALWNGGYFGIIFQA 189

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
           +AL+P  ++        L   ++   I   +  PFD+++ R Q   +    +  +Y    
Sbjct: 190 RALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVR-KYNWSL 248

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
            +L TI R+EG R  YKG    ++++ P   +   V+
Sbjct: 249 PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GAV+G     V+YP D+++ R Q+   G +  G  Y  V D L  I   EG+   YKG++
Sbjct: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGRLYKGIS 75

Query: 290 ANLVKVVPAMAVQW 303
           + ++   P  A ++
Sbjct: 76  SPILMEAPKRATKF 89

>Kwal_0.232
          Length = 274

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 27/182 (14%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKG----LFRGNGINCLRIFPYSAVQ 91
           P E +K   Q   S ++     +  +K++ + E  +G    L+RG     +R  P++ +Q
Sbjct: 115 PAEVIKQRTQTHKSDSS-----LQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQ 169

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           + +YEF K +    G  G EQ+  W+               T PLD+++TRL +   ++ 
Sbjct: 170 FPLYEFLKKQWAISG--GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP 227

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
            LH               L R+I+  E G + ++ GV P ++ +    A+   +YE + +
Sbjct: 228 VLH---------------LARQIYATE-GWKVFFSGVGPRTVWISAGGAIFLGVYETVHS 271

Query: 212 LI 213
           ++
Sbjct: 272 IL 273

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 154 HRSKAHDIRRPPGIVELLRRIFREEGG---LRGWYRGVYPTSLGVVPFVALNFALYERLK 210
            R++ H   +    ++ L+++ + E G    R  YRG   T +  +PF  + F LYE LK
Sbjct: 121 QRTQTH---KSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLK 177

Query: 211 ALIPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLLRRRFQV 253
                      VA  + A  G V+GGIA     P D+L+ R  +
Sbjct: 178 KQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLML 221

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 175 FREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL---IPHDYDAGSVAAAKLA--- 228
           F   GG  G YRG+    +   P  +L F  Y+ +K+    I ++    S   A+ A   
Sbjct: 40  FFANGGYLGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHM 99

Query: 229 IGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL-RGYYK 286
             + +G IA  +V  P +++++R Q      S    +       L      EG+ R  Y+
Sbjct: 100 FSSSAGEIAACMVRVPAEVIKQRTQTHKSDSSLQTLK------KLLQNENGEGIRRNLYR 153

Query: 287 GLTANLVKVVPAMAVQWFVYELI 309
           G +  +++ +P   +Q+ +YE +
Sbjct: 154 GWSTTVMREIPFTCIQFPLYEFL 176

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 77/177 (43%), Gaps = 18/177 (10%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T+PLDL + RL  QTA   K            P +V +  +I R EG + G Y G+    
Sbjct: 26  THPLDLAKVRL--QTAPAPK------------PTLVRMASQILRNEG-VPGLYSGLTAAI 70

Query: 193 LGVVPFVALNFALYERLKA-LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRF 251
           L    +    F +Y+ +K   IP +Y    +    L     SG +   +  P D++  R 
Sbjct: 71  LRQCTYTTARFGVYDFVKERYIPKEYLNSMLYL--LPCSMFSGAVGGLIGNPADVVNIRM 128

Query: 252 QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           Q  +   +EL   Y + AD L+ I   EG+   + G   NLV+ +   + Q   Y++
Sbjct: 129 QNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDI 185

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 111/281 (39%), Gaps = 38/281 (13%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++  K+ LQ   +  A    LV    Q+ + EGV GL+ G     LR   Y+  ++ VY
Sbjct: 28  PLDLAKVRLQ---TAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQCTYTTARFGVY 84

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXT-YPLDLVRTRLSIQTANLAKLH 154
           +F K R         E L S                    P D+V  R+   ++  A+L 
Sbjct: 85  DFVKERYIP-----KEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQNDSSLPAELR 139

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLR---GW----YRGVYPTSLGVVPF-VALNFALY 206
           R+  +         + L +I   EG  +   GW     RG+  TS  VV + +A N+ + 
Sbjct: 140 RNYKN-------AADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYLVQ 192

Query: 207 ERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYA 266
                 +  D D  S      A   ++G +A TV  P D+++ R         +   R  
Sbjct: 193 N-----VGLDKDNKST---HFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRI- 243

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            + DA+    +QEG    ++G   + V++ P   + +   E
Sbjct: 244 -LLDAV----KQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G   G +A    +P DL + R Q     +  L  R AS       I R EG+ G Y GLT
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTL-VRMAS------QILRNEGVPGLYSGLT 67

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A +++       ++ VY+ +
Sbjct: 68  AAILRQCTYTTARFGVYDFV 87

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 107/290 (36%), Gaps = 42/290 (14%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + + P++ VK  +Q++   T YN G++ + KQ+   EG   L  G G   L      +
Sbjct: 27  THSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXX---XXXXXXXXXXXXTYPLDLVRTRLSIQ 146
            ++  YE  K     V   G++Q  +++                    PL+  R RL  Q
Sbjct: 85  FKFGGYEVFKKLFIDV--LGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

Query: 147 T--ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
              AN                G+V    RI +EEG    +Y G  P     +P+    F 
Sbjct: 143 PTFAN----------------GLVGGFSRILKEEGA-GSFYNGFTPILFKQIPYNIAKFL 185

Query: 205 LYERLK------ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM-- 256
           ++ER        A         S     L  G  +G  A  V  P D L  +        
Sbjct: 186 VFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAP 245

Query: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           GQS +G         L  + +Q G  G + GL   LV V    ++Q+ +Y
Sbjct: 246 GQSTIGL--------LAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 67/177 (37%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G++   ++I   EG       G  PT LG
Sbjct: 33  PIDVVKTRIQLEPTVYNK-------------GMISSFKQIISSEGA-GALLTGFGPTLLG 78

Query: 195 VVPFVALNFALYERLKALIPH--DYDAGSVAAAKLAIG--AVSGGIAQTVVYPFDLLRRR 250
                +  F  YE  K L      YD        + IG  A++   A   + P +  R R
Sbjct: 79  YSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIR 138

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+  F    V      I ++EG   +Y G T  L K +P    ++ V+E
Sbjct: 139 LV------SQPTFANGLVG-GFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFE 188

>Kwal_55.21338
          Length = 323

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 115/282 (40%), Gaps = 27/282 (9%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S T+  P+  V   LQ Q +       L   +K +Y+++G  G F G           + 
Sbjct: 36  SMTLTYPLIVVTTKLQTQDAK-GEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNF 94

Query: 90  VQYAVYEF---CKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
           V Y  YE    C  R  H      ++L + E                 PL +  TR+++Q
Sbjct: 95  VYYYCYEASSRCVLRARHT-----QRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQ 149

Query: 147 TANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
            ++                G +  +  I ++EG + G ++G+ P  + V+  + + + +Y
Sbjct: 150 KSD---------------RGTLSTIFDIVKDEG-ISGLFKGLNPALILVINPI-IQYTVY 192

Query: 207 ERLKALIPHDYDAGSVAAA-KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           E+LK  I       +++ +    +GAV    A    YP+  ++ R  +L   +S      
Sbjct: 193 EQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPP 252

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            S+   +  I +++G+ G Y+G+   LV+ +   A  +F  E
Sbjct: 253 RSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKE 294

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 236 IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKV 295
           I+ T+ YP  ++  + Q       +L     S+AD +  I R++G  G++ GL + L   
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGEKL-----SLADTIKDIYRKDGAMGFFAGLESALFGT 89

Query: 296 VPAMAVQWFVYE 307
             +  V ++ YE
Sbjct: 90  TLSNFVYYYCYE 101

>Scas_489.4
          Length = 297

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 19/178 (10%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P + ++T L      L   +++    + R  G   L+R     + G+ G YRGV P S+ 
Sbjct: 127 PFEAIKTALIDDKQALKPKYQNNGRGMLRNYG--SLVR-----DQGIMGLYRGVLPVSMR 179

Query: 195 VVPFVALNFALYERLKALIPHDY-----DAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRR 249
                A+    Y ++K ++  DY     D    +     +GA SG +      P D ++ 
Sbjct: 180 QAANQAVRLGCYNKIKTMV-QDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKT 238

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           R Q L         +Y S  +    I ++EGL+ ++KG T  L +++ +  + + +YE
Sbjct: 239 RMQSLD------ATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 75/186 (40%), Gaps = 20/186 (10%)

Query: 30  SRTVVSPVERVKILL----QVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRI 84
           S   V+P E +K  L    Q        NG G++     + +++G+ GL+RG     +R 
Sbjct: 121 SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQ 180

Query: 85  FPYSAVQYAVYEFCKTRVFHVGQSGHEQ-LRSWERXXXXXXXXXXXXXXTYPLDLVRTRL 143
               AV+   Y   KT V     +  ++ L S                 T P+D V+TR+
Sbjct: 181 AANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRM 240

Query: 144 SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                        ++ D  +    V    +IF+EE GL+ +++G  P    ++    + F
Sbjct: 241 -------------QSLDATKYTSTVNCFAKIFKEE-GLKTFWKGATPRLGRLILSGGIVF 286

Query: 204 ALYERL 209
            +YE +
Sbjct: 287 TIYENV 292

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 110/286 (38%), Gaps = 35/286 (12%)

Query: 44  LQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVF 103
           +Q ++S   +N     A  ++ + EG+  L+RG  I  L   P + V ++ YE     +F
Sbjct: 88  IQCKNSALRFNSTW-EAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYE-----MF 141

Query: 104 HVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRR 163
                  +   S                   PL+L++TRL         + RS+  D   
Sbjct: 142 RDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQ-------SIPRSR-KDTTT 193

Query: 164 PPGIVELLRRIFRE--EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGS 221
                +LL+    E   GG +  ++G+  T    VPF A+ +  YE  K     D+    
Sbjct: 194 QMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQC 253

Query: 222 VA----------AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVL---------TMGQSELG 262
           +                 G+VSG  A  + +PFD+ + R Q+          T+   +  
Sbjct: 254 LRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKR 313

Query: 263 FRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
                +   L+ I + EG    Y GL   ++K+ P+ A+    YEL
Sbjct: 314 VSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYEL 359

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 81/200 (40%), Gaps = 24/200 (12%)

Query: 32  TVVSPVERVKILLQV------QSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIF 85
           T V+P+E +K  LQ        ++T      L+   +   +  G K LF+G  I   R  
Sbjct: 169 TTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDV 228

Query: 86  PYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW----------ERXXXXXXXXXXXXXXTYP 135
           P+SA+ +  YEF K + F +  S  EQ   W                          T+P
Sbjct: 229 PFSAIYWGSYEFYK-KNFWIDFS--EQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHP 285

Query: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRR---PPGIVELLRRIFREEGGLRGWYRGVYPTS 192
            D+ +TR+ I T ++    R+     ++     G+ + L  I + E G    Y G+ P  
Sbjct: 286 FDVGKTRMQI-TMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTE-GYGALYTGLIPRV 343

Query: 193 LGVVPFVALNFALYERLKAL 212
           + + P  A+  + YE  K L
Sbjct: 344 MKIAPSCAIMISTYELSKRL 363

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 56/132 (42%), Gaps = 22/132 (16%)

Query: 187 GVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246
           G + TS  + P   +   L +++  ++P   D    AA++L      G +   V+Y   +
Sbjct: 21  GSFLTSFFLTPMDVVRIRLQQQV--MLP---DCSCGAASEL-----KGSVGTEVIYDHVV 70

Query: 247 LRRR----------FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296
             +           FQ +    S L  R+ S  +A   I   EGL   ++GL+  L+  +
Sbjct: 71  ANKNSPKIFWQDVCFQDIQCKNSAL--RFNSTWEAFTKISEVEGLATLWRGLSITLLMAI 128

Query: 297 PAMAVQWFVYEL 308
           PA  V +  YE+
Sbjct: 129 PANVVYFSGYEM 140

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 106/282 (37%), Gaps = 38/282 (13%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ VK  +Q++   T YN G+V + KQ+   EG   L  G G   L      A ++  Y
Sbjct: 37  PIDVVKTRIQLEP--TVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 96  E-FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT--ANLAK 152
           E F K  + ++G     + ++                   PL+  R RL  Q   AN   
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFAN--- 151

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK-- 210
                        G+V    RI +EE G+  +Y G  P     +P+    F ++ER    
Sbjct: 152 -------------GLVGGFSRILKEE-GIGSFYSGFTPILFKQIPYNIAKFLVFERASEF 197

Query: 211 ----ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM--GQSELGFR 264
               A       + S     L  G  +G  A  V  P D L  +        GQS +G  
Sbjct: 198 YYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGL- 256

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                  L  + +Q G  G + GL   LV V    ++Q+ +Y
Sbjct: 257 -------LAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIY 291

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 70/177 (39%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G+V   ++I   EG       G  PT LG
Sbjct: 37  PIDVVKTRIQLEPTVYNK-------------GMVGSFKQIIAGEGA-GALLTGFGPTLLG 82

Query: 195 VVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAIG--AVSGGIAQTVVYPFDLLRRR 250
                A  F  YE  K     +  YD  S     + +G  A++  +A   + P +  R R
Sbjct: 83  YSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIR 142

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                + Q +       +      I ++EG+  +Y G T  L K +P    ++ V+E
Sbjct: 143 L----VSQPQFA---NGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 110/278 (39%), Gaps = 30/278 (10%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKGLFRG--------NGI 79
           TV +P E VK  +Q+Q   +A N  +      A+  ++K EGVKGL RG         G+
Sbjct: 39  TVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGL 98

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           N  R+  Y  ++  +      + F      H+                       PL LV
Sbjct: 99  NGSRLGFYEPIRTVL-----NKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLV 153

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TR+    +N  K+   + H      G    L  IF++EG L G +RGV    L      
Sbjct: 154 KTRMQ-SYSNAIKIGE-QTHYTSMSNG----LATIFKKEGVL-GLFRGVDAAILRTGAGS 206

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
           ++   +Y   K  +  +       A  L    V+G     V+ P+D+      VLT   +
Sbjct: 207 SVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDV------VLTRVYN 260

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           + G  Y    D ++   + EG+   YKG  A L ++ P
Sbjct: 261 QKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAP 298

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 27/188 (14%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P +LV+TR+ +Q    A   R     I R P   + L  IF+ EG ++G  RG+    
Sbjct: 41  TNPFELVKTRMQLQGEMSATNQR-----IYRNP--FQALGVIFKNEG-VKGLQRGLVSAY 92

Query: 193 LGVVPFVALNFALYERLKALI---------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYP 243
           +  +         YE ++ ++         PH        A  +  GA SG I   V  P
Sbjct: 93  VYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQN---VAVNVTAGATSGIIGAIVGSP 149

Query: 244 FDLLRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299
             L++ R Q     + +G+      Y S+++ L TI ++EG+ G ++G+ A +++     
Sbjct: 150 LFLVKTRMQSYSNAIKIGEQT---HYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGS 206

Query: 300 AVQWFVYE 307
           +VQ  +Y 
Sbjct: 207 SVQLPIYN 214

>Kwal_33.15597
          Length = 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 116/290 (40%), Gaps = 42/290 (14%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + + P++ VK  +Q++   T YN G++ + KQ+   EG   L  G G   L      +
Sbjct: 27  THSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 90  VQYAVYEFCKTRVFHVGQSGHEQLRSWERXX---XXXXXXXXXXXXTYPLDLVRTRLSIQ 146
            ++  YE  K ++F +   G++Q  +++                    PL+  R RL  Q
Sbjct: 85  FKFGGYEVFK-KLF-IDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

Query: 147 T--ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
              AN                G+V    RI +EE GL  +Y G  P     +P+    F 
Sbjct: 143 PTFAN----------------GLVGGFSRILKEE-GLSSFYNGFTPILFKQIPYNIAKFL 185

Query: 205 LYERLKALI-----PHDYDAGSVAAAKLAIGAVSGGIAQTVVY-PFDLLRRRFQVLTM-- 256
           ++ER   +      P +  + S       +  ++ G+A  +V  P D L  +        
Sbjct: 186 VFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAP 245

Query: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           GQS +G         L  + ++ G  G + GL   LV V    ++Q+ +Y
Sbjct: 246 GQSTIGL--------LGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 68/177 (38%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G++   ++I   EG       G  PT LG
Sbjct: 33  PIDVVKTRIQLEPTVYNK-------------GMISSFKQIISSEGA-GALLTGFGPTLLG 78

Query: 195 VVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAIG--AVSGGIAQTVVYPFDLLRRR 250
                +  F  YE  K L      YD        + IG  A++   A   + P +  R R
Sbjct: 79  YSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIR 138

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+  F    V      I ++EGL  +Y G T  L K +P    ++ V+E
Sbjct: 139 LV------SQPTFANGLVG-GFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFE 188

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 35/187 (18%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YP D V+ RL  Q A+L              P     +R  + +EG  +G+Y+G+     
Sbjct: 26  YPFDTVKVRLQTQPAHLY-------------PTTWSCIRSTYTDEGIWKGFYQGIASPLF 72

Query: 194 G-----VVPFVALN-----FALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYP 243
           G      V FV+ N        + +LK L    Y            GA +G  A  ++ P
Sbjct: 73  GAALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYS-----------GAFAGACASFILTP 121

Query: 244 FDLLRRRFQVLTMGQS-ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
            +L++ + QV  +  S     R+ SV   + ++ +++GL G ++G  +  V+     AV 
Sbjct: 122 VELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVW 181

Query: 303 WFVYELI 309
           +  YE++
Sbjct: 182 FTTYEIM 188

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 24/185 (12%)

Query: 33  VVSPVERVKILLQVQS-----STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           +++PVE VK  LQV +     S T  +  +   +K V KE+G+ GL++G     +R    
Sbjct: 118 ILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
            AV +  YE  K + F       ++  +WE                +P D V++    QT
Sbjct: 178 GAVWFTTYEIMKMK-FASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKS--VCQT 234

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
            +++               IV  L+++ R   G+ G+YRG+  T +   P  A  F  YE
Sbjct: 235 EHVS---------------IVNALKKVLRTH-GITGFYRGLGITLIRAAPANATVFYTYE 278

Query: 208 RLKAL 212
            LK +
Sbjct: 279 TLKKM 283

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 118/282 (41%), Gaps = 36/282 (12%)

Query: 36  PVERVKILLQVQSS---TTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQ 91
           P + VK+ LQ Q +    T ++      ++  Y +EG+ KG ++G           +AV 
Sbjct: 27  PFDTVKVRLQTQPAHLYPTTWS-----CIRSTYTDEGIWKGFYQGIASPLFGAALENAVL 81

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTY-PLDLVRTRLSIQTANL 150
           +  +  C   +         QL+   +                 P++LV+ +L  Q +N+
Sbjct: 82  FVSFNQCTNFL-----DEFTQLKPLTKTIYSGAFAGACASFILTPVELVKCKL--QVSNI 134

Query: 151 AK-LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE-- 207
           +  L ++  H    P      ++ + +E+G L G ++G   T +      A+ F  YE  
Sbjct: 135 SNSLSQTTRHTSVWPT-----IKSVIKEKG-LLGLWQGQLSTFVRECLGGAVWFTTYEIM 188

Query: 208 RLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYAS 267
           ++K    H  +  +     L  GA +G +    V+P D ++   Q            + S
Sbjct: 189 KMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQT----------EHVS 238

Query: 268 VADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           + +AL  + R  G+ G+Y+GL   L++  PA A  ++ YE +
Sbjct: 239 IVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETL 280

 Score = 34.3 bits (77), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 223 AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL- 281
           A   +A G+V+G I + + YPFD ++ R       Q++    Y +    + +    EG+ 
Sbjct: 7   ALKDIAYGSVAGAIGKVIEYPFDTVKVRL------QTQPAHLYPTTWSCIRSTYTDEGIW 60

Query: 282 RGYYKGLTANL 292
           +G+Y+G+ + L
Sbjct: 61  KGFYQGIASPL 71

>Kwal_56.23011
          Length = 303

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 109/275 (39%), Gaps = 22/275 (8%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P +  K+ LQ     T         +K + K EG+   ++G       +    + Q+ V 
Sbjct: 43  PFDITKVRLQTSPVPTT----AAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVN 98

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
           E  K        +  + L   +                 P++ VR RL +QTA+      
Sbjct: 99  EALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTAS------ 152

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA-LIP 214
           S A +     G ++  R++ ++   +RG+      TS G      + F  YE L A    
Sbjct: 153 SSAAEYH---GSLDCARKLLKQGALMRGFTATTLRTSHGF----GIYFLTYETLIANQAH 205

Query: 215 HDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALW 273
           H     ++ A K+ + GA SG     + YPFD+++   Q   +     G    +VA A++
Sbjct: 206 HGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIY 265

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
              R+ G R + KG T  +++ +P     +  +E+
Sbjct: 266 ---RERGPRAFTKGFTPTMLRSLPVNGATFAAFEI 297

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 13/96 (13%)

Query: 215 HDYDAGSVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALW 273
           HD+      A K       GG+AQ +V  PFD+ + R Q   +          + A  + 
Sbjct: 18  HDFKQ----ALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVP--------TTAAQVIK 65

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           ++ + EGL  +YKG  A L  V   ++ Q+ V E +
Sbjct: 66  SLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEAL 101

>Scas_632.9
          Length = 292

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 121/287 (42%), Gaps = 45/287 (15%)

Query: 36  PVERVKILLQVQSS---TTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQ 91
           P + VK+ LQ Q S    T ++      +K  Y  EGV +G F+G G         +A  
Sbjct: 37  PFDTVKVRLQTQGSHIFPTTWS-----CIKYTYHNEGVWRGFFQGIGSPLFGAALENATL 91

Query: 92  YAVYEFCKT---RVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
           +  Y  C     +  +V    +  L                     P++L++ +L  Q +
Sbjct: 92  FVSYNQCSNVLEKFTNVSPLSNILLSG-------AFAGSCASFVLTPVELIKCKL--QVS 142

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT----SLGVVPFVALNFA 204
           NL      +    +  P ++ +LR     E G+ G ++G   T    SLG V +    FA
Sbjct: 143 NLQTAVEGQIKHTKIIPTLMYVLR-----EKGILGLWQGQSSTFIRESLGGVAW----FA 193

Query: 205 LYERLKALIPHDYDAGSVAAAKLAIGAVSGGIA-QTVVYPFDLLRRRFQVLTMGQSELGF 263
            YE +K  +            +L +   S G+A    ++P D ++      +M Q+E   
Sbjct: 194 TYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVK------SMMQTE--- 244

Query: 264 RYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            + ++ +A+  +    G+ G+Y+GL   L++ VPA A  +++YE +S
Sbjct: 245 -HITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETLS 290

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 25/185 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHA-----VKQVYKEEGVKGLFRGNGINCLRIFPY 87
           V++PVE +K  LQV +  TA  G + H      +  V +E+G+ GL++G     +R    
Sbjct: 128 VLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLG 187

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
               +A YE  K  +    +    + ++WE                +P D V++ +  QT
Sbjct: 188 GVAWFATYEVMKQGL--KDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMM--QT 243

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
            ++                ++  ++++    G + G+YRG+  T +  VP  A  F +YE
Sbjct: 244 EHIT---------------LINAVKKVLTTYG-ITGFYRGLGITLIRAVPANATVFYMYE 287

Query: 208 RLKAL 212
            L  +
Sbjct: 288 TLSKM 292

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 213 IPHDYDAGSV--AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVAD 270
           I H  +  SV  A + +  G+++G   + + YPFD ++ R Q  T G       ++ +  
Sbjct: 5   IDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQ--TQGSHIFPTTWSCIK- 61

Query: 271 ALWTIGRQEGLRGYYKGLTANL 292
             +T   +   RG+++G+ + L
Sbjct: 62  --YTYHNEGVWRGFFQGIGSPL 81

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 108/281 (38%), Gaps = 25/281 (8%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P + +K+ LQ    T   N     A+  + K EG  G ++G     + +    + Q+
Sbjct: 41  VGQPFDIIKVRLQ----TMPGNATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQF 96

Query: 93  AVYEFCKTRVFHVGQSG---HEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
            + E  K     + +S       L   +                 P++ VR RL +Q   
Sbjct: 97  GINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEA 156

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
           LA        D            ++ ++   +RG+   +  TS G      + F  YE L
Sbjct: 157 LANAEYKSTLDCTE---------KLLKQGSLMRGFTATLMRTSHGF----GIYFLTYETL 203

Query: 210 KAL-IPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYAS 267
            A  + H +    ++A K  + GA+SG     + YPFD+++   Q   +     G     
Sbjct: 204 IASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQ 263

Query: 268 VADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
           VA  ++   R+ GLR + KG    +++ +P     +  +E+
Sbjct: 264 VAKNIY---RERGLRAFTKGFMPTMLRSLPVNGATFAAFEV 301

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 9/75 (12%)

Query: 234 GGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292
           GG+AQ +V  PFD+++ R Q +           A+  +A+  + + EG  G+YKG  A L
Sbjct: 34  GGVAQVLVGQPFDIIKVRLQTMPGN--------ATAWEAITDLVKYEGFMGFYKGTMAPL 85

Query: 293 VKVVPAMAVQWFVYE 307
           V V   ++ Q+ + E
Sbjct: 86  VGVGACVSCQFGINE 100

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 79/179 (44%), Gaps = 21/179 (11%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVK-GLFRGNGINCLRIFPYSAVQYAV 94
           P E +K   Q   + ++     + A+ +    EG++  L+RG     +R  P++ +Q+ +
Sbjct: 116 PAEVIKQRTQTHRTNSSLQ--TLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPL 173

Query: 95  YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           YE+ K R   V   G E+   W+               T PLD+++TR+ +   +++ LH
Sbjct: 174 YEYMKKRWAEV--QGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSALH 231

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
                           L +   +E G++ ++ GV P ++ +    A+   +YE + +L 
Sbjct: 232 ----------------LAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVHSLF 274

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 15/142 (10%)

Query: 175 FREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA--------LIPHDYDAGSVAAAK 226
           F   GG +G YRG+    +   P  +L F  Y+ +K         L+P   D  +   + 
Sbjct: 40  FFANGGYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSH 99

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL-RGYY 285
           +   +     A  V  P +++++R Q      S           AL      EGL R  Y
Sbjct: 100 MVSSSFGEISACMVRVPAEVIKQRTQTHRTNSS------LQTLQALLRNENGEGLRRNLY 153

Query: 286 KGLTANLVKVVPAMAVQWFVYE 307
           +G +  +++ +P   +Q+ +YE
Sbjct: 154 RGWSTTIMREIPFTCIQFPLYE 175

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 66/182 (36%), Gaps = 36/182 (19%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ +K  LQ +       GG        +   G KG++RG G   +   P +++ +  Y
Sbjct: 26  PIDTLKTRLQAK-------GGF-------FANGGYKGVYRGLGSAVVASAPSASLFFVAY 71

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLD-LVRTRLSIQTANLAKL- 153
           +                ++ W R                 L  +V +     +A + ++ 
Sbjct: 72  D---------------SMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVP 116

Query: 154 -----HRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
                 R++ H        ++ L R    EG  R  YRG   T +  +PF  + F LYE 
Sbjct: 117 AEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEY 176

Query: 209 LK 210
           +K
Sbjct: 177 MK 178

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 105/255 (41%), Gaps = 34/255 (13%)

Query: 53  YNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVG--QSGH 110
           YN     A+ ++YK+EG++GL++G   + +  F  +   +  Y F +   F V      +
Sbjct: 75  YNSTF-DAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKN 133

Query: 111 EQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVEL 170
            +  + E               T P+ L+  R            +     I      + +
Sbjct: 134 TKFTTIEELLLGIVAAATSQIFTNPISLISAR------------QQTRQGIDGDNDFLTV 181

Query: 171 LRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK-ALIPHD--------YDAGS 221
            + I++E+  ++G+++G+   SL +    ++ +  YE+LK AL   D         D+ S
Sbjct: 182 AKEIYKEQRSIKGFWKGL-KVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSS 240

Query: 222 VAA--AKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQE 279
             +      +G +S  I+  +  P  + +   Q         G  ++S    L+ + + E
Sbjct: 241 QLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-------RNGSNFSSFQQVLYYLYKNE 293

Query: 280 GLRGYYKGLTANLVK 294
           GLR ++KGL+  L K
Sbjct: 294 GLRSWWKGLSPQLAK 308

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 30/94 (31%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELG--------------------------- 262
           GAV+  +A TVVYP DL++   Q       +L                            
Sbjct: 10  GAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKLNE 69

Query: 263 ---FRYASVADALWTIGRQEGLRGYYKGLTANLV 293
               +Y S  DA++ I +QEG+RG Y+GLT +++
Sbjct: 70  NNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVM 103

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 82/194 (42%), Gaps = 39/194 (20%)

Query: 134 YPLDLVRTRLSIQTANLAKLH--------RSKAHDIRR-PPGIVEL-------------- 170
           YPLDLV+T +  Q     +L         + K   ++  PP  ++L              
Sbjct: 22  YPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKLNENNYLQYNSTFDA 81

Query: 171 LRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF--------ALYERLKALIPHDYDAGSV 222
           + +I+++E G+RG Y+G+  TS+    F   ++          Y R+K +  +  +    
Sbjct: 82  IYKIYKQE-GIRGLYQGL-TTSVMAGFFQTFSYFFWYSFVRKCYFRVKLI--NRKNTKFT 137

Query: 223 AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
              +L +G V+   +Q    P  L+  R Q       +  F   +VA  ++    Q  ++
Sbjct: 138 TIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF--LTVAKEIY--KEQRSIK 193

Query: 283 GYYKGLTANLVKVV 296
           G++KGL  +L+  +
Sbjct: 194 GFWKGLKVSLMLTI 207

>Scas_673.17
          Length = 314

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 105/282 (37%), Gaps = 38/282 (13%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           PV+ VK  +Q++   T YN G+V + K++  +EG   L  G G   L      A ++  Y
Sbjct: 40  PVDVVKTRIQLEP--TVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 96  E-FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT--ANLAK 152
           E F K  +  +G       ++                   PL+  R RL  Q   AN   
Sbjct: 98  EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFAN--- 154

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
                        G+V    RI +EE G+  +Y G  P     +P+    F ++ER   +
Sbjct: 155 -------------GLVGGFSRILKEE-GVGSFYSGFTPILFKQIPYNIAKFLVFERASEV 200

Query: 213 ------IPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM--GQSELGFR 264
                         +     L  G  +G  A  V  P D L  +        GQS +G  
Sbjct: 201 YYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGL- 259

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                  L  + +Q G+ G + GL   L+ V    ++Q+ +Y
Sbjct: 260 -------LAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIY 294

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 70/177 (39%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G+V   ++I  +EG       G  PT LG
Sbjct: 40  PVDVVKTRIQLEPTVYNK-------------GMVGSFKKIIADEGA-GALLTGFGPTLLG 85

Query: 195 VVPFVALNFALYERLKAL----IPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
                A  F  YE  K L    I ++       +  +   AV+  +A   + P +  R R
Sbjct: 86  YSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIR 145

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+  F    V      I ++EG+  +Y G T  L K +P    ++ V+E
Sbjct: 146 LV------SQPTFANGLVG-GFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 4/139 (2%)

Query: 172 RRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGA 231
           R I  EEG  +G Y G     LG  P  A+ FA YE  K  +  ++      +  L  G 
Sbjct: 100 RTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFS-HLTAGF 158

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSEL---GFRYASVADALWTIGRQEGLRGYYKGL 288
           +   I+  V  P ++L+ R Q+     +     G+ Y ++ DA+ TI R+EG    + G 
Sbjct: 159 LGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGY 218

Query: 289 TANLVKVVPAMAVQWFVYE 307
            A L + +P   +Q+  YE
Sbjct: 219 KATLSRDLPFSGLQFAFYE 237

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 120/290 (41%), Gaps = 34/290 (11%)

Query: 37  VERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQYAVY 95
           ++ VK   Q   ST  Y   ++ A + +  EEG+ KGL+ G     L  FP +A+ +A Y
Sbjct: 76  LDTVKTRQQGAPSTVKYKN-MIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATY 134

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
           E+ K ++  +G+ G  +  ++                  P ++++TRL +Q        R
Sbjct: 135 EYTKRKM--IGEWGINE--TFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFR 190

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGW---YRGVYPTSLGVVPFVALNFALYERLKAL 212
           S  +       +  ++RR         GW   + G   T    +PF  L FA YE+ + L
Sbjct: 191 SGYNYKNLTDAVTTIVRR--------EGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQL 242

Query: 213 I----PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV----------LTMGQ 258
                   +D     + ++  GA +GG+A  +  P D+++ R Q             + Q
Sbjct: 243 AFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQ 302

Query: 259 SELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
             L     S+   + T+ + EGL G + G+    +      ++   +Y++
Sbjct: 303 QTLT---NSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQV 349

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 68/169 (40%), Gaps = 9/169 (5%)

Query: 30  SRTVVSPVERVKILLQVQSS------TTAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCL 82
           S  V  P E +K  LQ+Q         + YN   L  AV  + + EG   LF G      
Sbjct: 164 SSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLS 223

Query: 83  RIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRT 141
           R  P+S +Q+A YE  +   F V  ++  E L                   T PLD+V+T
Sbjct: 224 RDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKT 283

Query: 142 RLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190
           R+  Q  ++ +              I + +  +++ E GL G + GV P
Sbjct: 284 RIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTE-GLAGLFSGVGP 331

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 110/279 (39%), Gaps = 30/279 (10%)

Query: 36  PVERVKILLQVQS-STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAV 94
           P +  K+ +Q  S S TA     +  +K + K EG+   ++G  +  + +    + Q+ V
Sbjct: 43  PFDITKVRMQTSSGSPTA-----IEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGV 97

Query: 95  YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
            E  K     V     + L   +                 P++ VR RL +QT  LAK  
Sbjct: 98  NEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAE 157

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
                      G ++ ++++ +++  +RG+   +  TS G      + F  YE   ALI 
Sbjct: 158 YR---------GSLDCMKKLLKQKALMRGFTATLMRTSHG----FGVYFLTYE---ALIM 201

Query: 215 HDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
           +    G     +   K+ + GA SG     + YPFD+++   Q   +     G     VA
Sbjct: 202 NQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVA 261

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
               +I    G   + KG    +++ +P     +  +E+
Sbjct: 262 K---SIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEV 297

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 224 AAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282
           A K  I   SGGIAQ +V  PFD+ + R Q  +   + +        + +  + + EGL 
Sbjct: 23  AIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTAI--------EVIKNLVKNEGLL 74

Query: 283 GYYKGLTANLVKVVPAMAVQWFVYE 307
            +YKG    L+ V   ++ Q+ V E
Sbjct: 75  AFYKGTLVPLIGVGACVSCQFGVNE 99

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 114/277 (41%), Gaps = 22/277 (7%)

Query: 33  VVSPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           V+ P++ VK ++Q+Q S  +     G+   +KQ+  +EG   L++G     L   P  A 
Sbjct: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRAT 85

Query: 91  QYAVY-EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
           ++A   EF K    +    G E+L                     P +LV+ RL      
Sbjct: 86  KFACNDEFQK---IYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRL------ 136

Query: 150 LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                +  +     P   + +++ I  +EG L   Y G+  T      + A  F +  ++
Sbjct: 137 -----QDVSSKFTSP---IAVVKNIVEKEGIL-AMYNGLESTMWRHGIWNAGYFGIIFQV 187

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
           +AL+P            L  G V G ++  +  PFD+++ R Q  T     +  +Y    
Sbjct: 188 RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN-TAVIPGVPRKYNWSW 246

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
            AL TI ++EG +  YKG    ++++ P   +   V+
Sbjct: 247 PALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GAV+G     V+YP D+++   Q+   G S  G +Y  V D L  I  +EG    YKG++
Sbjct: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSRLYKGIS 73

Query: 290 ANLVKVVPAMAVQW 303
           + ++   P  A ++
Sbjct: 74  SPILMEAPKRATKF 87

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 109/273 (39%), Gaps = 20/273 (7%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           TV +P+E VKI +Q+Q    A N  +      A+  V++ EG++GL +G     +     
Sbjct: 34  TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIAL 93

Query: 88  SAVQYAVYEFCK---TRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLS 144
           +  +   YE  +    + F+  Q  H+                       PL LV+TRL 
Sbjct: 94  NGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ 153

Query: 145 IQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFA 204
              +N  K+     +      G+   L+ I+  EG ++G +RG+    L      ++   
Sbjct: 154 -SYSNAIKIGEQTHYT-----GVWNGLKTIYMTEG-VKGLFRGIDAAILRTGAGSSVQLP 206

Query: 205 LYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR 264
           +Y   K  +  +       +  L    +SG     V+ P+D+      +LT   ++ G  
Sbjct: 207 IYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDV------ILTRIYNQKGDL 260

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           Y    D L    + EG+   YKG  A + ++ P
Sbjct: 261 YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 21/185 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P+++V+ R+ +Q   +A   R     I   P   + +  +FR EG +RG  +G+    
Sbjct: 36  TNPIEVVKIRMQLQGELMAANQR-----IYTNP--FQAMGVVFRNEG-IRGLQKGLVAAY 87

Query: 193 LGVVPFVALNFALYERLKALIPH----DYDAGSVAAAKLAI--GAVSGGIAQTVVYPFDL 246
           +  +         YE ++A++      D ++  V +  + +  GA SG I   +  P  L
Sbjct: 88  IYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFL 147

Query: 247 LRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           ++ R Q     + +G+      Y  V + L TI   EG++G ++G+ A +++     +VQ
Sbjct: 148 VKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQ 204

Query: 303 WFVYE 307
             +Y 
Sbjct: 205 LPIYN 209

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR----YASVADALWTIGRQEGLRGYY 285
           G ++  IA TV  P ++++ R Q+    Q EL       Y +   A+  + R EG+RG  
Sbjct: 25  GGLAACIAVTVTNPIEVVKIRMQL----QGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80

Query: 286 KGLTA 290
           KGL A
Sbjct: 81  KGLVA 85

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 24/180 (13%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P++ +R RL  QT+N          + + P   ++ L+     +GGL    RG++PT + 
Sbjct: 162 PIEQIRIRLQTQTSN------GGDREFKGPWDCIKKLK----AQGGL---MRGLFPTMIR 208

Query: 195 VVPFVALNFALYERLKALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRR 249
               +   F +YE   AL+  +   G     +   KL + GA SG +    VYP D+++ 
Sbjct: 209 AGHGLGTYFLVYE---ALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS 265

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             Q   + + +     + VA  ++    +EG+R ++KG    +V+  P     +  +EL+
Sbjct: 266 IIQNDDLRKPKYKNSISYVAKTIYA---KEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 33  VVSPVERVKILLQVQS-STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
            V P++ VK ++Q        Y   + +  K +Y +EG++  F+G G   +R  P +   
Sbjct: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315

Query: 92  YAVYEF 97
           +  +E 
Sbjct: 316 FLTFEL 321

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 69/158 (43%), Gaps = 22/158 (13%)

Query: 168 VELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK------------ALIPH 215
           +E+LR + + EG +  +Y+G     LGV   V++ F + E +K             +   
Sbjct: 72  LEVLRNLVKNEG-VFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQ 130

Query: 216 DYD---AGSVAAAKLAIGAVSGGIAQT-VVYPFDLLRRRFQVLTMGQSELGFRYASVADA 271
           D D   + ++  ++  +  ++GG+  + +  P + +R R Q  T    +  F+     D 
Sbjct: 131 DVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFK--GPWDC 188

Query: 272 LWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           +  +  Q GL    +GL   +++    +   + VYE +
Sbjct: 189 IKKLKAQGGL---MRGLFPTMIRAGHGLGTYFLVYEAL 223

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 10/105 (9%)

Query: 205 LYERLKALIPHDY-DAGSVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELG 262
           L ++ K   P++  +  S    K       GGIAQ +V  PFD  + R Q  T   + L 
Sbjct: 14  LEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTL- 72

Query: 263 FRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                  + L  + + EG+  +YKG    L+ V   ++VQ+ V E
Sbjct: 73  -------EVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNE 110

>Kwal_23.2913
          Length = 320

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 71/171 (41%), Gaps = 23/171 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           + +P ERVK++LQ     T+ +G  + A + + +E GV+ LF+G      R  P SA+ +
Sbjct: 158 ITAPTERVKVVLQ-----TSESGSFLGAARTLIREGGVRSLFQGTLATLARDGPGSALYF 212

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
           A YE  K R     Q   + L                    +P+D ++T+L         
Sbjct: 213 ASYEVSK-RFLSRNQD-TDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKL--------- 261

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNF 203
                     R   +V+  R I+    GLRG++ G+ P  +   P  A  F
Sbjct: 262 ------QSSSRSQSMVQAAREIY-TRAGLRGFFPGLGPALMRSFPANAATF 305

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 9/137 (6%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAI-GA 231
           R    EGG+R  ++G   T     P  AL FA YE  K  +  + D  +++   + + G 
Sbjct: 182 RTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGG 241

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
           V+G      V+P D ++ + Q  +        R  S+  A   I  + GLRG++ GL   
Sbjct: 242 VAGMSMWIGVFPIDTIKTKLQSSS--------RSQSMVQAAREIYTRAGLRGFFPGLGPA 293

Query: 292 LVKVVPAMAVQWFVYEL 308
           L++  PA A  +   E 
Sbjct: 294 LMRSFPANAATFLGVEF 310

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 32/189 (16%)

Query: 134 YPLDLVRTRLSIQTAN--LAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           +P DL++ R     A+  L  + R   H+ +   G + L +        ++G+YRGV P 
Sbjct: 47  HPFDLLKVRCQSNQASGTLDAISR-VLHEAKSKSGPLPLNQ--------IKGFYRGVIPP 97

Query: 192 SLGVVPFVALNFALYERLKALI-----PHDYDAGS------VAAAKLAIGAVSGGIAQTV 240
            LGV P  A++F  Y+  K L+     P    AGS      +  ++LA+      I  T+
Sbjct: 98  LLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFSAIPTTL 157

Query: 241 VY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299
           +  P + ++   Q      SE G    S   A  T+ R+ G+R  ++G  A L +  P  
Sbjct: 158 ITAPTERVKVVLQT-----SESG----SFLGAARTLIREGGVRSLFQGTLATLARDGPGS 208

Query: 300 AVQWFVYEL 308
           A+ +  YE+
Sbjct: 209 ALYFASYEV 217

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYA 93
           V P++ +K  LQ  S + +    +V A +++Y   G++G F G G   +R FP +A  + 
Sbjct: 251 VFPIDTIKTKLQSSSRSQS----MVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFL 306

Query: 94  VYEF 97
             EF
Sbjct: 307 GVEF 310

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 226 KLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG----- 280
            LA G V G  A    +PFDLL+ R Q      ++      +++  L     + G     
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLLKVRCQ-----SNQASGTLDAISRVLHEAKSKSGPLPLN 85

Query: 281 -LRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            ++G+Y+G+   L+ V P  AV ++ Y++
Sbjct: 86  QIKGFYRGVIPPLLGVTPIFAVSFWGYDV 114

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 80/179 (44%), Gaps = 21/179 (11%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGV-KGLFRGNGINCLRIFPYSAVQYAV 94
           P E +K   Q   + +++       + Q    EGV + L+RG     +R  P++ +Q+ +
Sbjct: 115 PAEVIKQRTQTHKTNSSWQ--TFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPL 172

Query: 95  YEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           YEF K       ++G + +  W+               T PLD+++TRL +        H
Sbjct: 173 YEFLKKT--WAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLS-------H 223

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
           +S          + +L + I+ EE G + ++ GV P ++ +    A+   +YE + +++
Sbjct: 224 KSIP--------VAQLAKNIYAEE-GFKVFFSGVGPRTMWISAGGAIFLGVYETVHSIL 273

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 104/282 (36%), Gaps = 46/282 (16%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ +K  LQ +       GG        +   G KG++RG G   +   P +++ +  Y
Sbjct: 26  PIDTLKTRLQAK-------GGF-------FANGGYKGVYRGLGSAVIASAPSASLFFVSY 71

Query: 96  E----FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +    + K  +     S ++   +                   P ++++ R      N +
Sbjct: 72  DSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQRTQTHKTNSS 131

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGG---LRGWYRGVYPTSLGVVPFVALNFALYER 208
                            +   +I + E G   LR  YRG   T +  +PF  + F LYE 
Sbjct: 132 ----------------WQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEF 175

Query: 209 LKALIPHDYDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYAS 267
           LK           VA  + ++ G+V+G IA     P D+L+ R          L  +   
Sbjct: 176 LKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLM--------LSHKSIP 227

Query: 268 VADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           VA     I  +EG + ++ G+    + +    A+   VYE +
Sbjct: 228 VAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

>Kwal_55.21335
          Length = 317

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YPLD ++ RL  Q A++              P     ++  +++EG ++G+Y+GV    +
Sbjct: 64  YPLDTIKVRLQTQPAHVF-------------PTSWSCIKYTYQKEGFVKGFYQGVASPLV 110

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
           G     A+ F  + R +  +   Y++ S  +  +  GA +G     V+ P +L++   QV
Sbjct: 111 GAALENAVLFVTFNRAQNFL-QQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQV 169

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             +  +    R++ +   +  I + +G+ G ++G ++  ++     AV +  YE
Sbjct: 170 SNLEGATT--RHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYE 221

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 22/182 (12%)

Query: 33  VVSPVERVKILLQVQS--STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           V++PVE +K  LQV +    T  +  +   VK + + +G+ GL++G     +R     AV
Sbjct: 156 VLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            +  YE  K+  +   +    +  +WE                +P D +++  + QT +L
Sbjct: 216 WFTTYESLKS--YLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKS--TAQTQHL 271

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
                          GIV+  +RI    G   G YRG+  T +   P  A+ F  YE L 
Sbjct: 272 ---------------GIVDATKRILARSGP-AGLYRGLGITLIRAAPANAIVFYTYETLS 315

Query: 211 AL 212
            L
Sbjct: 316 NL 317

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 115/284 (40%), Gaps = 42/284 (14%)

Query: 36  PVERVKILLQVQSS---TTAYNGGLVHAVKQVYKEEG-VKGLFRGNGINCLRIFPYSAVQ 91
           P++ +K+ LQ Q +    T+++      +K  Y++EG VKG ++G     +     +AV 
Sbjct: 65  PLDTIKVRLQTQPAHVFPTSWS-----CIKYTYQKEGFVKGFYQGVASPLVGAALENAVL 119

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXT----YPLDLVRTRLSIQT 147
           +          F+  Q+  +Q  S                 T     P++L++  L +  
Sbjct: 120 FVT--------FNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSN 171

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
              A    SK         I   ++ I + +G + G ++G   T +      A+ F  YE
Sbjct: 172 LEGATTRHSK---------IWPTVKHIVQHKG-IGGLWQGQSSTFIRECAGGAVWFTTYE 221

Query: 208 RLKA-LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYA 266
            LK+ L     D  +     LA GA +G      ++P D ++   Q   +G         
Sbjct: 222 SLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHLG--------- 272

Query: 267 SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            + DA   I  + G  G Y+GL   L++  PA A+ ++ YE +S
Sbjct: 273 -IVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLS 315

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 22/182 (12%)

Query: 33  VVSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           V++PVE +K  LQV   S+T   +  ++  +K V  E G  GL++G     +R     A 
Sbjct: 117 VLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAA 176

Query: 91  QYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANL 150
            +  YE  K  +    Q+  EQ  +WE                +P D +++ +     +L
Sbjct: 177 WFTTYEVVKNYLASRRQA--EQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDL 234

Query: 151 AKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK 210
           +   R                 +I+  +G + G+YRG+  T +  VP  A  F  YE L 
Sbjct: 235 SSATR-----------------KIYARQG-IAGFYRGLGITLIRAVPANAAIFYTYETLS 276

Query: 211 AL 212
           ++
Sbjct: 277 SV 278

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 21/177 (11%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P++L++ +L +   +  K   +K         I+  ++ +  E G L G ++G   T + 
Sbjct: 120 PVELIKCKLQVSNLSTTKTSHTK---------ILPTIKSVLSERGFL-GLWQGQSGTFIR 169

Query: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIA-QTVVYPFDLLRRRFQV 253
                A  F  YE +K  +     A      +L     S G+A    ++P D ++   Q 
Sbjct: 170 ESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQT 229

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
                      +  ++ A   I  ++G+ G+Y+GL   L++ VPA A  ++ YE +S
Sbjct: 230 ----------DHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETLS 276

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YP D V+ RL  Q A++              P     ++  +  EG  RG+Y+G+     
Sbjct: 25  YPFDTVKVRLQTQPAHMF-------------PTTWSCIKFTYDNEGLWRGFYQGIGSPLA 71

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
           G     A+ F  + + K L+  +     ++    A GA +G  A  V+ P +L++ + QV
Sbjct: 72  GAALENAVLFVSFNQAKRLLDVESLLSPLSKTVWA-GAFAGACASFVLTPVELIKCKLQV 130

Query: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             +  ++    +  +   + ++  + G  G ++G +   ++     A  +  YE++
Sbjct: 131 SNLSTTKT--SHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVV 184

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 15/84 (17%)

Query: 223 AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ-----VLTMGQSELGFRYASVADALWTIGR 277
           AA  +  G+++G + + + YPFD ++ R Q     +     S + F Y +  + LW    
Sbjct: 6   AAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDN--EGLW---- 59

Query: 278 QEGLRGYYKGLTANLVKVVPAMAV 301
               RG+Y+G+ + L       AV
Sbjct: 60  ----RGFYQGIGSPLAGAALENAV 79

>Scas_721.129
          Length = 323

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P++LV+ R+ +Q   LA +       + R P  ++ +  IFR EG +RG  +G+    
Sbjct: 39  TNPIELVKIRMQLQ-GELAAV----GQKVYRNP--IQGMGVIFRNEG-IRGLQKGLVAAY 90

Query: 193 LGVVPFVALNFALYERLKALIPHDYDAGSVA------AAKLAIGAVSGGIAQTVVYPFDL 246
           +  +         YE ++  +   +     +      +  +A GA SG I   +  P  L
Sbjct: 91  IYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVIGSPLFL 150

Query: 247 LRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           ++ R Q     + +G+      Y +V + L TI R EG +G ++G+ A +++     +VQ
Sbjct: 151 VKTRMQSYSDAIKIGEQT---HYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQ 207

Query: 303 WFVYE 307
             +Y 
Sbjct: 208 LPIYN 212

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 107/278 (38%), Gaps = 30/278 (10%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKGLFRG--------NGI 79
           T  +P+E VKI +Q+Q    A    +    +  +  +++ EG++GL +G         G+
Sbjct: 37  TFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGL 96

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           N  R+  Y  ++ A+        F+  +  H+  +                    PL LV
Sbjct: 97  NGSRLGFYEPIRNAL-----NSTFYPNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLV 151

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           +TR+   +  +    ++   ++         L  I R EG  +G +RG+    L      
Sbjct: 152 KTRMQSYSDAIKIGEQTHYRNVWNG------LSTIARTEG-FKGLFRGIDAAILRTGAGS 204

Query: 200 ALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQS 259
           ++   +Y   K  +  +          L    +SG     V+ P+D+      +LT   +
Sbjct: 205 SVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDV------ILTRIYN 258

Query: 260 ELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
           + G  Y    D      R EG+   YKG  A ++++ P
Sbjct: 259 QKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAP 296

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 88/190 (46%), Gaps = 31/190 (16%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHD---IRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191
           P++L++ +L  Q +NL  L    A       R   I+  ++ + +  G + G ++G   T
Sbjct: 127 PVELIKCKL--QVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFI-GLWQGQSGT 183

Query: 192 ----SLGVVPFVALNFALYERLKALIP--HDYDAGSVAAAK-----LAIGAVSGGIAQTV 240
               S G V +    FA YE +K  +   H+ +  S+         LA GA +G      
Sbjct: 184 FIRESFGGVAW----FATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNAS 239

Query: 241 VYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300
           ++P D ++   Q   +G          +  A+  I  ++GLRG+Y+GL   L++ +PA A
Sbjct: 240 IFPADTVKSMMQTEHLG----------LKTAIKKIFVEKGLRGFYRGLGITLIRAIPANA 289

Query: 301 VQWFVYELIS 310
             ++VYE +S
Sbjct: 290 TVFYVYETLS 299

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 82/196 (41%), Gaps = 34/196 (17%)

Query: 33  VVSPVERVKILLQV---QSSTTAYNGG---------LVHAVKQVYKEEGVKGLFRGNGIN 80
           V++PVE +K  LQV   QS      GG         ++  ++ V K  G  GL++G    
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGT 183

Query: 81  CLRIFPYSAVQYAVYE----FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPL 136
            +R        +A YE    + K+R      S     ++WE                +P 
Sbjct: 184 FIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPA 243

Query: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196
           D V++ +  QT +L               G+   +++IF E+G LRG+YRG+  T +  +
Sbjct: 244 DTVKSMM--QTEHL---------------GLKTAIKKIFVEKG-LRGFYRGLGITLIRAI 285

Query: 197 PFVALNFALYERLKAL 212
           P  A  F +YE L  L
Sbjct: 286 PANATVFYVYETLSKL 301

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G+++G + + + YPFD ++ R Q  T G+      ++ +    +T   +  ++G+++G+ 
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQ--TQGRHVFPDTWSCIT---YTYKNEGIIKGFFQGIA 74

Query: 290 ANLVKVVPAMAVQWFVYELIS 310
           + L       A  +  Y   S
Sbjct: 75  SPLAGAAIENAALFLSYNQCS 95

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 102/251 (40%), Gaps = 24/251 (9%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWE 117
           +  +K++Y + G+ G F G       +   + V Y  YE+C      +  +  + L +WE
Sbjct: 50  LETIKEIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTL--TTKQYLSTWE 107

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                          + P+ +  TR+++  +N + L      DI +  G + LL      
Sbjct: 108 SILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRT--VIDIVKTDGPLTLL------ 159

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAA-KLAIGAVSGGI 236
                    G+ P +L +V    + + +YE+LK L+        ++ +    +GA+    
Sbjct: 160 --------NGLKP-ALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLA 210

Query: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296
           A    YP+  L+ R  ++          ++ + +    I +++G+ G Y G+   LV+ +
Sbjct: 211 ATGTTYPYITLKTRMHLMQNDPKHQKSMWSLIVE----IVKKDGVSGLYNGVAVKLVQSI 266

Query: 297 PAMAVQWFVYE 307
              A  +F  E
Sbjct: 267 MTAAFLFFFKE 277

>Scas_715.45
          Length = 305

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/292 (19%), Positives = 113/292 (38%), Gaps = 42/292 (14%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + V+P++ +K  LQV  +    N      + Q+ K+EG+  LF G G  C+      A
Sbjct: 30  THSSVTPLDLIKCRLQVDPTLYRSN---TSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 90  VQYAVYEFCKTRVFHVGQSGHE----QLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSI 145
            +Y  YE  K R++       E    + R+                   P + ++ +   
Sbjct: 87  GKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK--- 142

Query: 146 QTANLAKLHRSKAHDIRRPP---GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALN 202
                             PP    ++E  ++++ +EG L G+Y+G+ P     +P+    
Sbjct: 143 -------------QQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPLWCRQIPYTMCK 188

Query: 203 FALYERLKALI-------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLT 255
           F  +ER+   I         +  A    +     G ++G +   V +P D++  +     
Sbjct: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN--- 245

Query: 256 MGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
             + ++     S+  AL  I  + G  G + GL   ++ +    + QW +Y+
Sbjct: 246 -NERKVN---ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 75/181 (41%), Gaps = 27/181 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLDL++ RL +       L+RS         GI+++L++      GL   + GV  T +G
Sbjct: 36  PLDLIKCRLQVDPT----LYRSNTS------GIIQILKK-----EGLGKLFTGVGATCIG 80

Query: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAK------LAIGAVSGGIAQTVVYPFDLLR 248
                A  +  YE  K L           A K      L   A +   A  ++ PF+ ++
Sbjct: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140

Query: 249 RRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308
            +       Q+ +     +V +    +  +EGL G+YKG+T    + +P    ++  +E 
Sbjct: 141 VK------QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194

Query: 309 I 309
           I
Sbjct: 195 I 195

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 109/278 (39%), Gaps = 26/278 (9%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V  P++  K+ LQ           L   ++ +   EGV GL+ G     LR   Y+ V++
Sbjct: 30  VTHPLDLAKVRLQAAPMPKPT---LFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRF 86

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPL-DLVRTRLSIQTANLA 151
             Y+  K  V        EQL +                      D+V  R+   +A  A
Sbjct: 87  GAYDLLKENVIP-----REQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEA 141

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
              R+  + I       + + +I+R EGGL+  + G  P  +  +   A     Y+  K 
Sbjct: 142 AKRRNYKNAI-------DGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKN 194

Query: 212 --LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
             +   D+DA S     L    ++G +A TV  P D+++ R   +  G  +       +A
Sbjct: 195 YLVTKLDFDA-SKNYTHLTASLLAGLVATTVCSPADVMKTR---IMNGSGDHQPALKILA 250

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           DA+    R+EG    ++G   +  ++ P   + +F  E
Sbjct: 251 DAV----RKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G  +G  A  V +P DL + R Q   M +  L FR       L +I   EG+ G Y GL+
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTL-FRM------LESILANEGVVGLYSGLS 72

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A +++      V++  Y+L+
Sbjct: 73  AAVLRQCTYTTVRFGAYDLL 92

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 107/281 (38%), Gaps = 41/281 (14%)

Query: 32  TVVSPVERVKILLQVQSSTTA----YNGGLVHAVKQVYKEEGVKGLFRGNG--------I 79
           T  +P+E VK  LQ+Q    A       G   AV  +Y+ EG++GL +G          +
Sbjct: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86

Query: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           N  R+  Y  ++ A+     +     G +      +                   PL LV
Sbjct: 87  NGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGS-----PLQLV 141

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR--EEGGLRGWYRGVYPTSLGVVP 197
           +TR+                  R PP    + RR+    ++ G+RG Y+GV    L    
Sbjct: 142 KTRMQALAPR------------RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGV 189

Query: 198 FVALNFALYERLK-ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM 256
             A+  A+Y   K AL  H  D  ++     A+ +V+  IA     PFD+       +T 
Sbjct: 190 GSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMN---PFDV------AMTR 240

Query: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
                G  Y    D L    RQEG    YKG  A L+++ P
Sbjct: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 78/187 (41%), Gaps = 28/187 (14%)

Query: 133 TYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTS 192
           T P++ V+TRL +Q   +A + R  +       G  + +  I+R EG LRG  +G+    
Sbjct: 29  TNPIETVKTRLQLQGELVAGVSRLYS-------GPAQAVSLIYRTEG-LRGLQQGLACAY 80

Query: 193 LGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVS-----------GGIAQTVV 241
              +        LY+ L+A +      G V + +   G  +           G I   + 
Sbjct: 81  AYQILLNGSRLGLYDPLRAAL-----GGCVLSDRRTYGTAALAVNATAGAAAGMIGAALG 135

Query: 242 YPFDLLRRRFQVLTMGQ-SELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMA 300
            P  L++ R Q L   +   L  R      AL+   +  G+RG Y+G+ A L++     A
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALF---KDRGVRGLYQGVDAALLRTGVGSA 192

Query: 301 VQWFVYE 307
           VQ  VY 
Sbjct: 193 VQLAVYS 199

>Kwal_27.11419
          Length = 298

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 113/301 (37%), Gaps = 53/301 (17%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           S  ++ P + +K  LQ   S+      L+  V+ +   E    L++G   + LR    SA
Sbjct: 21  SAVILQPFDLLKTRLQQNKSSN-----LLDVVRSI---ETPGQLWKGTLPSALRTSVGSA 72

Query: 90  VQYAVYEFCKTRVFH------VGQSGHE----QLRSWERXXXXXXXXXXXXXXTYPLDLV 139
           +  +     ++ +         G++G      QL  +E               T P+ ++
Sbjct: 73  LFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPITVL 132

Query: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199
           + R      N   L  +  H              I+R EG +RG + G   T +   P+ 
Sbjct: 133 KVRFESTMYNYKSLGEAATH--------------IYRSEG-IRGLFSGCGATVMRDAPYA 177

Query: 200 ALNFALYERLKALIPH-------DYDAGSVAAAKLA--IGAV----SGGIAQTVVYPFDL 246
            L    YE+ K  +P        +++   V + K +  I ++    S  +A T+  PFD 
Sbjct: 178 GLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDT 237

Query: 247 LRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
           ++ R Q L   Q      Y        +I R E  R  + GL+  L +   +  + W +Y
Sbjct: 238 IKTRMQ-LNPSQ------YYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIY 290

Query: 307 E 307
           E
Sbjct: 291 E 291

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 16/160 (10%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YPLD+V+TR+ +Q    +      A++     G+++ L +I + EG  R  Y+G+    L
Sbjct: 27  YPLDVVKTRMQLQVG--SGTGSGVAYN-----GVIDCLGQIVKREGFSR-LYKGISSPML 78

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAA-KLAIGAVSGGIAQTVVYPFDLLRRRFQ 252
              P  A  FA  +  + +    Y    +     +  G+++G     V+ PF+L++ R Q
Sbjct: 79  MEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ 138

Query: 253 VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANL 292
                  ++  ++    + ++   R+ G+   Y GL + +
Sbjct: 139 -------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM 171

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           GA +G     V+YP D+++ R Q+     +  G  Y  V D L  I ++EG    YKG++
Sbjct: 15  GAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGIS 74

Query: 290 ANLVKVVPAMAVQW 303
           + ++   P  A ++
Sbjct: 75  SPMLMEAPKRATKF 88

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 112/284 (39%), Gaps = 27/284 (9%)

Query: 33  VVSPVERVKILLQVQ-----SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPY 87
           V+ P++ VK  +Q+Q      S  AYNG ++  + Q+ K EG   L++G     L   P 
Sbjct: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYNG-VIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83

Query: 88  SAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
            A ++A  +    ++F     G ++L                     P +LV+ RL  Q 
Sbjct: 84  RATKFACND-SYQKMFK-DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRL--QD 139

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
            N      SK +      G +E++ +  RE G L   Y G+  T      +    F +  
Sbjct: 140 VN------SKFN------GPMEVVFKTIRETGILS-LYNGLESTMWRNAFWNGGYFGVIF 186

Query: 208 RLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYP-FDLLRRRFQ---VLTMGQSELGF 263
           +++AL+P            L  G + G    +  +    +++ R Q     T+    +  
Sbjct: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVP 246

Query: 264 RYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           +Y     +L+ I  +EG    YKG    ++++ P   +   V+ 
Sbjct: 247 KYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQV----LTMGQSELGFRYASVADALWTIGRQEGLRGYY 285
           GAV+  +A T VYP DL +   Q        G S+   +Y +V D +  I ++ G  G Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 286 KGLTANLVKVVPAMAVQWFVY 306
           +GL  N    V A  VQ F+Y
Sbjct: 70  QGLATN----VAANFVQNFIY 86

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 53/288 (18%), Positives = 107/288 (37%), Gaps = 46/288 (15%)

Query: 32  TVVSPVERVKILLQVQ--------SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINC-- 81
           T V P++  K L+Q Q        S        ++  + +++K+ G  GL++G   N   
Sbjct: 19  TTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAA 78

Query: 82  ------LRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYP 135
                 +  F YS ++   + F   R+     S   +L + E               T P
Sbjct: 79  NFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAGAMTQVVTNP 138

Query: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGG-LRGWYRGVYPTSLG 194
           + ++ TR  +                     +  ++++I+ E  G L  +++G +  +L 
Sbjct: 139 ISVISTRQQLTKDG-------------EDASLKAVIKQIYEESNGDLTAFWKG-FKVALV 184

Query: 195 VVPFVALNFALYERLKALI--------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246
           +    A+ +  Y++LK++I                 A     +G  S  I+  V  P  +
Sbjct: 185 LSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQPLIV 244

Query: 247 LRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
            +   Q    G+   G ++ +  + L  I + EG    +KG+   + K
Sbjct: 245 AKITLQ----GK---GSKFKTFQEVLQHIYQNEGFLSLWKGVIPQVSK 285

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 69/154 (44%), Gaps = 17/154 (11%)

Query: 164 PP---GIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE----RLKALIP-- 214
           PP    +V+  ++++ E GG++ +Y+G+ P     +P+    F  +E    ++ +++P  
Sbjct: 142 PPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK 201

Query: 215 -HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALW 273
             + +A    +     G ++G +   V +P D++  +          +     SVA    
Sbjct: 202 KEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESM-----SVASK-- 254

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            I ++ G  G + GL   +V +    + QW +Y+
Sbjct: 255 RIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYD 288

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 105/256 (41%), Gaps = 32/256 (12%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWE 117
           + AV+++Y++EGV G + G       +   S   Y  YE        V   G  +L + E
Sbjct: 61  LEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRV--RGSRRLNTSE 118

Query: 118 RXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFRE 177
                          + P+ +V TR+++  +  + L  +   DI R  G+  L       
Sbjct: 119 AILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTL--AVLLDIVRKDGVTAL------- 169

Query: 178 EGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA--IGAVSGG 235
                  + G+ P +L +V    + + ++E+LK ++   +    V     A  +GAV   
Sbjct: 170 -------FNGLRP-ALMLVSNPIIQYTVFEQLKNVV-LKWSGSDVLLPSWAFLLGAVGKL 220

Query: 236 IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWT----IGRQEGLRGYYKGLTAN 291
            A    YP+  L+ R   L  G+ +     A    ++W+    I ++EG++G Y G+   
Sbjct: 221 AATGSTYPYITLKTRMH-LAKGKED-----ADTQQSMWSLMVDIVKKEGIQGLYHGIGVK 274

Query: 292 LVKVVPAMAVQWFVYE 307
           L + +   A  ++  E
Sbjct: 275 LTQSILTAAFLFYFKE 290

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 236 IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKV 295
           ++  +  P   L  R QV +    E G R  S  +A+  I R+EG+ G+Y GL + +  +
Sbjct: 29  LSMALTMPLVTLATRMQV-SEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGM 87

Query: 296 VPAMAVQWFVYEL 308
                  ++ YEL
Sbjct: 88  AANSLNYYYFYEL 100

>Scas_714.18
          Length = 305

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 21/157 (13%)

Query: 57  LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW 116
           ++  +K + KE+G+ GL++G     +R    S V +A YE  K     +     E   +W
Sbjct: 170 IIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQT---LRDPKSEVNTTW 226

Query: 117 ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR 176
           +                +P D V++ +  QT +LA               ++E +R I  
Sbjct: 227 QLLISGATAGLAFNGSVFPADTVKSIM--QTEHLA---------------LMETVRSIL- 268

Query: 177 EEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
           E  G+ G+YRG+  T L  VP  A  F  YE+L  ++
Sbjct: 269 ERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLSKIL 305

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 85/193 (44%), Gaps = 33/193 (17%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIR-------------RPPGIVELLRRIFREEGGL 181
           P++L++ +L I   + + LH +                   R   I+  ++ I +E+G L
Sbjct: 126 PVELIKCKLQISNLHYS-LHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKG-L 183

Query: 182 RGWYRGVYPT----SLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIA 237
            G ++G   T    S+G V +    FA YE +K  +       +     L  GA +G   
Sbjct: 184 FGLWQGQSSTFIRESIGSVVW----FATYELMKQTLRDPKSEVNTTWQLLISGATAGLAF 239

Query: 238 QTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
              V+P D ++   Q            + ++ + + +I  ++G+ G+Y+GL   L++ VP
Sbjct: 240 NGSVFPADTVKSIMQT----------EHLALMETVRSILERDGVAGFYRGLGITLLRAVP 289

Query: 298 AMAVQWFVYELIS 310
           + A  ++ YE +S
Sbjct: 290 SNAAVFYTYEKLS 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 78/199 (39%), Gaps = 41/199 (20%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           YP D V+ RL  Q A +              P     ++  +  EG L G+Y+G+    +
Sbjct: 31  YPFDTVKVRLQTQEAYMF-------------PSTWSCIKYTYENEGILEGFYQGIESPLI 77

Query: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV 253
           G     A+ F  Y +  + + + +   S     L     +G  A  V+ P +L++ + Q+
Sbjct: 78  GAALENAILFLAYNQCSSFL-NAFTEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQI 136

Query: 254 -----------------------LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTA 290
                                  + +G+     R+  +   + +I +++GL G ++G ++
Sbjct: 137 SNLHYSLHDNDGEQQDEEDEDQGMVIGEG----RHTRIIPTIKSIIKEKGLFGLWQGQSS 192

Query: 291 NLVKVVPAMAVQWFVYELI 309
             ++      V +  YEL+
Sbjct: 193 TFIRESIGSVVWFATYELM 211

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYA 93
           V P + VK ++Q +      +  L+  V+ + + +GV G +RG GI  LR  P +A  + 
Sbjct: 243 VFPADTVKSIMQTE------HLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFY 296

Query: 94  VYE 96
            YE
Sbjct: 297 TYE 299

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEG-LRGYYKGL 288
           G+++G I + + YPFD ++ R       Q++  + + S    +      EG L G+Y+G+
Sbjct: 19  GSIAGAIGKFIEYPFDTVKVRL------QTQEAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 289 TANLVKVVPAMAVQWFVYELIS 310
            + L+      A+ +  Y   S
Sbjct: 73  ESPLIGAALENAILFLAYNQCS 94

>Kwal_33.15446
          Length = 305

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/275 (19%), Positives = 109/275 (39%), Gaps = 19/275 (6%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P + +K+ LQ    T  + G L   V Q  +++G++G + G     +      +V     
Sbjct: 38  PFDTIKVRLQTSQDTGRFKGPL-DCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCL 96

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
              +  +        E+L                     P++L + +L +Q       +R
Sbjct: 97  HNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYR 156

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH 215
                     G ++++++++  +G +RG Y+G+  T +    FV   +  YE L      
Sbjct: 157 ----------GPLDVIKKVYAADG-IRGMYKGLVSTLIFRTHFVYW-WGSYELLTRWFKA 204

Query: 216 DYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFR-YASVADALWT 274
           + +    A    A G  +     T  YP D++++   +L   + +   R + + A  +W 
Sbjct: 205 NTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQ--VILCNDKYDGSLRSWRNAASDIW- 261

Query: 275 IGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
             R  G+RG++KG   + ++  PA A     +E +
Sbjct: 262 --RTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 78/180 (43%), Gaps = 20/180 (11%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +P D ++ RL  QT+           D  R  G ++ + +  R++G +RG+Y G  P  +
Sbjct: 37  HPFDTIKVRL--QTS----------QDTGRFKGPLDCVYQTMRQQG-IRGFYLGFTPPLV 83

Query: 194 GVVPFVALNFALYERLKALIP---HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
           G +   ++        + L+    + ++     +  +  G ++G     +  P +L + +
Sbjct: 84  GWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAK 143

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            QV    Q+    RY    D +  +   +G+RG YKGL + L+         W  YEL++
Sbjct: 144 LQVQYDAQTT---RYRGPLDVIKKVYAADGIRGMYKGLVSTLI-FRTHFVYWWGSYELLT 199

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 73/180 (40%), Gaps = 25/180 (13%)

Query: 33  VVSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAV 90
           + +PVE  K  LQVQ  + TT Y G L   +K+VY  +G++G+++G  ++ L    +   
Sbjct: 133 IAAPVELAKAKLQVQYDAQTTRYRGPL-DVIKKVYAADGIRGMYKGL-VSTLIFRTHFVY 190

Query: 91  QYAVYEFCKTRVFHVGQS-GHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTAN 149
            +  YE   TR F    +     +  W                 YP D+++  +      
Sbjct: 191 WWGSYELL-TRWFKANTNLSDTAINFWA---GGFSASFGFWTTAYPSDVIKQVILCNDKY 246

Query: 150 LAKLH--RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
              L   R+ A DI R  GI              RG+++G  P+ L   P  A   A +E
Sbjct: 247 DGSLRSWRNAASDIWRTRGI--------------RGFFKGFVPSFLRSFPANAAALASFE 292

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 229 IGAVSG---GIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284
           +G VSG   GIA+  V +PFD ++ R Q      S+   R+    D ++   RQ+G+RG+
Sbjct: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQT-----SQDTGRFKGPLDCVYQTMRQQGIRGF 74

Query: 285 YKGLTANLV 293
           Y G T  LV
Sbjct: 75  YLGFTPPLV 83

>Kwal_47.19228
          Length = 281

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 8/140 (5%)

Query: 171 LRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIG 230
           ++ I+R  G +RG+ +G  PT +      A+ F  Y  LK +I  +       A   A+G
Sbjct: 135 VQEIYRSRG-IRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYA--FALG 191

Query: 231 AVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTA 290
            +S      V  P D+++ R Q      +     Y +  +  + I  +EG   ++KG   
Sbjct: 192 FISSCAVVAVTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFWKGWAP 246

Query: 291 NLVKVVPAMAVQWFVYELIS 310
            L+KV  +  V + VY+ + 
Sbjct: 247 RLMKVGLSGGVSFGVYQYVD 266

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 65/157 (41%), Gaps = 18/157 (11%)

Query: 57  LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW 116
            +  V+++Y+  G++G  +G     +R    SAV++  Y   K  +     S ++ L  +
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-----SPNKPLNEY 185

Query: 117 ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR 176
                           T P+D+++TR+       +K   S   +       +    RIF 
Sbjct: 186 YAFALGFISSCAVVAVTQPIDVIKTRMQ------SKYTWSNYKN------SLNCAYRIFV 233

Query: 177 EEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALI 213
           EEG  + W +G  P  + V     ++F +Y+ +  L+
Sbjct: 234 EEGFTKFW-KGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 108/292 (36%), Gaps = 46/292 (15%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + + P++ VK  +Q++     Y+ G+V + +++  EEG   L  G G   L      A
Sbjct: 29  THSAMVPIDVVKTRIQLEP--LKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGA 86

Query: 90  VQYAVYE-FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT- 147
            ++  YE F K  V  +G     Q R+                   PL+  R RL  Q  
Sbjct: 87  FKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQPT 146

Query: 148 -ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY 206
            AN                G+V    RI +EE G+  +Y G  P     +P+    F ++
Sbjct: 147 FAN----------------GLVGGFARILKEE-GIGSFYNGFTPILFKQIPYNIAKFVVF 189

Query: 207 ERLKALIPHDYDAGSVAAAKLAIGAVSG----------GIAQTVVYPFDLLRRRFQVLTM 256
           E       + Y   + +   L+  A +G            A  +  P D L  +      
Sbjct: 190 EHAA----NAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKK 245

Query: 257 --GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
             GQS  G         L  + +Q G  G + GL   LV V    ++Q+ +Y
Sbjct: 246 APGQSTFGL--------LMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 289

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 69/177 (38%), Gaps = 25/177 (14%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++              ++   G+V   R+I  EEG       G  PT LG
Sbjct: 35  PIDVVKTRIQLE-------------PLKYSSGMVGSFRKIVGEEGA-AALLTGFGPTLLG 80

Query: 195 VVPFVALNFALYERLKALIPH--DYDAGSVAAAKLAIG--AVSGGIAQTVVYPFDLLRRR 250
                A  F  YE  K        Y+        + IG  A++   A   + P +  R R
Sbjct: 81  YSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIR 140

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                   S+  F    V      I ++EG+  +Y G T  L K +P    ++ V+E
Sbjct: 141 LV------SQPTFANGLVG-GFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFE 190

>Scas_562.12
          Length = 300

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 84/183 (45%), Gaps = 26/183 (14%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V+ P++ +KI  + Q++  A+ G G V    ++ K+EG+  L+RG G    R  P S   
Sbjct: 135 VLLPLDVLKI--KRQTNPEAFKGRGFV----KILKDEGIFNLYRGWGWTAARNAPGSFAL 188

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +    F K  +  +G   + Q    +               + PLD+++TR+        
Sbjct: 189 FGGNAFAKEYI--LGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRI-------- 238

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
              ++++ D   P   + +++  F+ E G+  +++G+ P  L   P +  +FAL +   +
Sbjct: 239 ---QNRSFD--NPETGLTIVKNTFKNE-GITAFFKGLTPKLLTTGPKLVFSFALAQ---S 289

Query: 212 LIP 214
           LIP
Sbjct: 290 LIP 292

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 28/72 (38%), Gaps = 6/72 (8%)

Query: 232 VSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
           V    +  V  P D+++ R Q  +    E G              + EG+  ++KGLT  
Sbjct: 219 VGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVK------NTFKNEGITAFFKGLTPK 272

Query: 292 LVKVVPAMAVQW 303
           L+   P +   +
Sbjct: 273 LLTTGPKLVFSF 284

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 78/180 (43%), Gaps = 20/180 (11%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +P D ++ RL  QT+           D  R  G ++ + + F ++G +RG+Y G  P  +
Sbjct: 79  HPFDTIKVRL--QTS----------QDSTRFKGPLDCVYKTFTQQG-IRGFYLGFTPPLV 125

Query: 194 GVVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRR 250
           G +   ++        + L+     Y+   +  +   I G ++G     +  P +L + +
Sbjct: 126 GWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAK 185

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            QV    ++    +Y    D +  +    G+RG YKGLT+ L+         W  YEL++
Sbjct: 186 LQVQYDAKTT---KYTGPVDVIKKVYSSNGVRGLYKGLTSTLI-FRTNFVFWWGSYELLT 241

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 116/293 (39%), Gaps = 55/293 (18%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNG-------------INCL 82
           P + +K+ LQ    +T + G L   V + + ++G++G + G               + CL
Sbjct: 80  PFDTIKVRLQTSQDSTRFKGPL-DCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCL 138

Query: 83  RIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTR 142
             +     +Y  Y   K  +     SG   +  W                  P++L + +
Sbjct: 139 HNYRMLLKKYVYYNEEKLPLSGCIISG--VMAGWS-----------VSFIAAPVELAKAK 185

Query: 143 LSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALN 202
           L +Q       + +K      P   V+++++++    G+RG Y+G+  T +    FV   
Sbjct: 186 LQVQ-------YDAKTTKYTGP---VDVIKKVY-SSNGVRGLYKGLTSTLIFRTNFV-FW 233

Query: 203 FALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQ-----TVVYPFDLLRRRFQVLTMG 257
           +  YE L        +      +  AI   SGG +      T  YP D++++   VL   
Sbjct: 234 WGSYELLTRWFKEHTNM-----SDTAINFWSGGFSASFGFWTTAYPSDVIKQ--VVLCND 286

Query: 258 QSELGFR-YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           + +  FR +   A  +W   R  G RG++KG   + ++  PA A     +E +
Sbjct: 287 KYDGTFRSWKLAAKDIW---RTRGYRGFFKGFVPSFLRSFPANAAALAAFEFV 336

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 33  VVSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRG 76
           + +PVE  K  LQVQ  + TT Y G  V  +K+VY   GV+GL++G
Sbjct: 175 IAAPVELAKAKLQVQYDAKTTKYTGP-VDVIKKVYSSNGVRGLYKG 219

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 22/181 (12%)

Query: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193
           +P D ++ RL  QT+           +  R  G ++ + + FR +G +RG+Y G  P  +
Sbjct: 42  HPFDTIKVRL--QTS----------QNETRFKGPLDCVYKTFRNQG-IRGFYLGFTPPLV 88

Query: 194 GVVPFVALNFALYERLKALIPHDY----DAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRR 249
           G +   ++        + L+ H Y    D     +  +  G ++G     +  P +L + 
Sbjct: 89  GWILMDSVMLGCLHNYRMLM-HKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKA 147

Query: 250 RFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           + QV      +   RY    D +  I   +G+RG YKGL + L+         W  YEL+
Sbjct: 148 KLQV---QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRTHFVYWWGSYELL 203

Query: 310 S 310
           +
Sbjct: 204 T 204

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/275 (19%), Positives = 108/275 (39%), Gaps = 19/275 (6%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P + +K+ LQ   + T + G L   V + ++ +G++G + G     +      +V     
Sbjct: 43  PFDTIKVRLQTSQNETRFKGPL-DCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCL 101

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
              +  +        E+L                     P++L + +L +Q       ++
Sbjct: 102 HNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK 161

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH 215
                     G ++++++I+  +G +RG Y+G+  T +    FV   +  YE L      
Sbjct: 162 ----------GPLDVIKKIYSAQG-IRGLYKGLISTLIFRTHFVYW-WGSYELLTRWFRE 209

Query: 216 DYDAGSVAAAKLAIGAVSGGIA-QTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWT 274
           +    S AA     G  S      T  YP D+++   QV+       G  + S   A+  
Sbjct: 210 NTKM-SEAAINFWAGGFSASFGFWTTAYPSDVVK---QVVLCNDKYDG-SFKSWRTAVKD 264

Query: 275 IGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
           I + +G+ G++KG   + ++  PA A     +E +
Sbjct: 265 IYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFV 299

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 33  VVSPVERVKILLQVQ--SSTTAYNGGLVHAVKQVYKEEGVKGLFRG 76
           +  P+E  K  LQVQ   +TT Y G L   +K++Y  +G++GL++G
Sbjct: 138 IAPPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKG 182

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 62/146 (42%), Gaps = 8/146 (5%)

Query: 162 RRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGS 221
           + P  ++     ++R+ G LR +++G  PT +  V    + F  +  LK   P +Y    
Sbjct: 176 KLPTNVLTTAAELYRQHG-LRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNE 234

Query: 222 VAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL 281
             A  L  G +S         P D+++ R Q       +    Y +  +  + I  +EG 
Sbjct: 235 YFATLL--GLISSCAVVGATQPLDVIKTRMQA-----KDSVLLYRNSINCAYRIFVEEGF 287

Query: 282 RGYYKGLTANLVKVVPAMAVQWFVYE 307
              +KG    L+KV  + +V + +Y+
Sbjct: 288 AMLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 227 LAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYK 286
           +  G+VSG  + T+ YPF+ L+   Q+          R    A     +G Q  +R Y+ 
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQL---------HRNVVAAKPFEVLGYQ--VRTYFA 61

Query: 287 GLTANLVKVVPAMAVQWFVYE 307
           G +A  + VV   ++++  ++
Sbjct: 62  GCSAVNIGVVMKTSLRFLAFD 82

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/286 (18%), Positives = 116/286 (40%), Gaps = 31/286 (10%)

Query: 33  VVSPVERVKILLQVQSSTTAYN------------GGLVHAVKQVYKEEGVKGLFRGNGIN 80
           V+ P++ VK  +Q+Q +T  +              G++  + ++ K+EG   L++G    
Sbjct: 28  VMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSP 87

Query: 81  CLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVR 140
            L   P  A++++  +  +T    +  + + ++                     P +LV+
Sbjct: 88  ILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVK 147

Query: 141 TRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVA 200
            RL  Q  N            + P   +E+++     +GG+   + G+  T    V + A
Sbjct: 148 IRL--QDVN---------SQFKTP---IEVVKNSV-VKGGVLSLFNGLEATIWRHVLWNA 192

Query: 201 LNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE 260
             F +  +++ L+P    +       L  GA+ G +   +  PFD+++ R Q  +    +
Sbjct: 193 GYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRK 252

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
             +   SV      + R+EG +  YKG    ++++ P   +   V+
Sbjct: 253 YNWSLPSV----LLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 230 GAVSGGIAQTVVYPFDLLRRR--FQVLTMGQSELGF------RYASVADALWTIGRQEGL 281
           GA++G     V+YP D+++ R   QV T G   +         Y  V D L  I ++EG 
Sbjct: 18  GAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGF 77

Query: 282 RGYYKGLTANLVKVVPAMAVQW 303
              YKG+T+ ++   P  A+++
Sbjct: 78  SHLYKGITSPILMEAPKRAIKF 99

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 24/182 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V+ P++ +KI  + Q++  A+ G       ++ K+EG+  L+RG G    R  P S   +
Sbjct: 135 VLLPLDVLKI--KRQTNPEAFKG---RGFLKILKDEGIFNLYRGWGWTAARNAPGSFALF 189

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAK 152
               F K  +  +G   + Q    +               + PLD+++TR  IQ  N   
Sbjct: 190 GGNAFAKEYI--LGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTR--IQNRNF-- 243

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
                      P    ++++   + E G   +++G+ P  L   P +  +FAL +   +L
Sbjct: 244 ---------DNPESGFKIVKNTLKNE-GFTAFFKGLTPKLLTTGPKLVFSFALAQ---SL 290

Query: 213 IP 214
           IP
Sbjct: 291 IP 292

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 229 IGAVSGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
           I ++ G  A  +V  P D+++ R Q       E GF+   V + L    + EG   ++KG
Sbjct: 215 ISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKI--VKNTL----KNEGFTAFFKG 268

Query: 288 LTANLVKVVPAMAVQW 303
           LT  L+   P +   +
Sbjct: 269 LTPKLLTTGPKLVFSF 284

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 97/227 (42%), Gaps = 27/227 (11%)

Query: 38  ERVK-ILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYE 96
            R+K I L+   +   Y G L  A++++Y  EGV GL+RG G + +  F  S   +  Y 
Sbjct: 56  NRIKPIALRSPQAAEQYKGAL-DALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYT 114

Query: 97  FCKTRVFHVGQS--GHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
             +   F + Q+  G  +  + E                 P+++V TR   QT   A   
Sbjct: 115 LVRKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQ--QTRGQA--- 169

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK-ALI 213
            + A D+R        + R    E G RG++ G+   SL +    ++ +A YERL+ AL 
Sbjct: 170 -AGAADMRT-------VAREVHAENGWRGFWAGL-KVSLVLTVNPSITYATYERLREALF 220

Query: 214 P------HDYDAGSVAAA--KLAIGAVSGGIAQTVVYPFDLLRRRFQ 252
           P      H  D+ ++ +      +G +S  ++  +  P  + +   Q
Sbjct: 221 PTPAAASHLVDSAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQ 267

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 11/173 (6%)

Query: 139 VRTRLSIQTANLAKLHRSKAHDIRRPPG-IVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197
           VR     QT  ++   R   H    P       ++ I+   G LRG+ +G  PT    + 
Sbjct: 241 VRATFHKQTPGISPRERLFLHYEEHPTSRFFSTVKEIYLTRG-LRGFVQGTAPTIFRQMG 299

Query: 198 FVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMG 257
             A+ F  Y  LK LI  +       A    +G +S      V  P D+++ R Q     
Sbjct: 300 NSAVRFTTYTSLKQLISPNKPLNEYYA--FVLGFISSCAVVAVTQPIDVIKTRMQ----- 352

Query: 258 QSELGF-RYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
            S+  +  Y +  +  + I  +EG+  ++KG    L+KV  +  V + VY+ +
Sbjct: 353 -SKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYV 404

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 75/190 (39%), Gaps = 26/190 (13%)

Query: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYA 93
           +SP ER  + L  +   T+        VK++Y   G++G  +G      R    SAV++ 
Sbjct: 252 ISPRER--LFLHYEEHPTS---RFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFT 306

Query: 94  VYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKL 153
            Y   K  +     S ++ L  +                T P+D+++TR+  + A  A  
Sbjct: 307 TYTSLKQLI-----SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA-WANY 360

Query: 154 HRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY---ERLK 210
             S           +    RIF EEG  + W +G  P  + V     ++F +Y   E L 
Sbjct: 361 KNS-----------LNCAYRIFVEEGIPKFW-KGWAPRLMKVGLSGGVSFGVYQYVENLI 408

Query: 211 ALIPHDYDAG 220
            L+ H+   G
Sbjct: 409 KLMAHEKQLG 418

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (41%), Gaps = 14/124 (11%)

Query: 190 PTSLGVVPFVALNFALYERLK------ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYP 243
           P +L      A+ F  Y +LK      A  P D   GS       +GA+SG +      P
Sbjct: 174 PVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGS--GQTFLVGALSGIVTVYATMP 231

Query: 244 FDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQW 303
            D ++ R Q L         RY S       + R+EG+R  ++G T  L ++V +  + +
Sbjct: 232 VDTVKTRMQALDAA------RYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVF 285

Query: 304 FVYE 307
             YE
Sbjct: 286 TAYE 289

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 52/134 (38%), Gaps = 15/134 (11%)

Query: 82  LRIFPYSAVQYAVYEFCKTRV-FHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVR 140
           LR     AV++  Y   K  V  + G    + L S +               T P+D V+
Sbjct: 177 LRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVK 236

Query: 141 TRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVA 200
           TR+             +A D  R    V   R + REEG +R  +RG  P    +V    
Sbjct: 237 TRM-------------QALDAARYGSTVGCFRAVVREEG-VRALWRGATPRLGRLVLSGG 282

Query: 201 LNFALYERLKALIP 214
           + F  YE+L  L+P
Sbjct: 283 IVFTAYEKLLVLLP 296

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           PV+ VK   ++Q+   A  G  V   + V +EEGV+ L+RG      R+     + +  Y
Sbjct: 231 PVDTVKT--RMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAY 288

Query: 96  E 96
           E
Sbjct: 289 E 289

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 104/282 (36%), Gaps = 38/282 (13%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++ VK  +Q++   T YN G+V + KQ+   EG   L  G G   L      + ++  Y
Sbjct: 33  PIDVVKTRIQLEP--TVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 96  E-FCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT--ANLAK 152
           E F K  + ++G       ++                   PL+  R RL  Q   AN   
Sbjct: 91  ELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFAN--- 147

Query: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLK-- 210
                        G+     RI +EE G+  +Y G  P     +P+    F ++E     
Sbjct: 148 -------------GLFGGFSRILKEE-GVGSFYNGFTPILFKQIPYNIAKFFVFEHAANA 193

Query: 211 ----ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM--GQSELGFR 264
               A         +  A  LA G  +G  A  V  P D L  +        GQS +G  
Sbjct: 194 YFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPGQSTIGL- 252

Query: 265 YASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                  L  + +Q G  G + GL   LV V    ++Q+ +Y
Sbjct: 253 -------LAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIY 287

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 71/181 (39%), Gaps = 33/181 (18%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           P+D+V+TR+ ++     K             G+V   ++I   EG       G  PT LG
Sbjct: 33  PIDVVKTRIQLEPTVYNK-------------GMVSSFKQIISSEGA-GALLTGFGPTLLG 78

Query: 195 VVPFVALNFALYERLKALIPHD--YDAGSVAAAKLAIG--AVSGGIAQTVVYPFDLLRRR 250
                +  F  YE  K L   +  YD        + IG  A++   A   + P +  R R
Sbjct: 79  YSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIR 138

Query: 251 FQVLTMGQSELGFRYASVADALWT----IGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                           + A+ L+     I ++EG+  +Y G T  L K +P    ++FV+
Sbjct: 139 L-----------VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVF 187

Query: 307 E 307
           E
Sbjct: 188 E 188

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 76/178 (42%), Gaps = 24/178 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V+ P++ +KI  + Q++  A+ G G V    ++ K+EG+ GL+RG G    R  P S   
Sbjct: 134 VLLPLDVLKI--KRQTNPEAFKGRGFV----KILKDEGL-GLYRGWGWTAARNAPGSFAL 186

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +    F K  +  +G   + Q    +               + PLD+++TR  IQ  N  
Sbjct: 187 FGGNAFAKEYI--LGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTR--IQNKNF- 241

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                       P     +++   + EG    +++G+ P  L   P +  +FAL + L
Sbjct: 242 ----------ENPESGFTIVKNTLKNEG-FSAFFKGLTPKLLTTGPKLVFSFALAQTL 288

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 7/76 (9%)

Query: 229 IGAVSGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
           + ++ G  A  ++  P D+++ R Q       E GF    V + L    + EG   ++KG
Sbjct: 213 VSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTI--VKNTL----KNEGFSAFFKG 266

Query: 288 LTANLVKVVPAMAVQW 303
           LT  L+   P +   +
Sbjct: 267 LTPKLLTTGPKLVFSF 282

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 17/135 (12%)

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERL-KALIPH----DYDAGSVAAAKLAIGAVSG 234
           G+RG+ +G  PT    +    + F  Y  + ++L PH    +Y A        A GA+S 
Sbjct: 207 GVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQA-------FAAGALSS 259

Query: 235 GIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
                +  P D+++ R Q  T       F Y S  +  + I  +EG R  +KG    L K
Sbjct: 260 AAVVALTQPIDVIKTRMQSKTAW-----FTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFK 314

Query: 295 VVPAMAVQWFVYELI 309
           V  +  + + VY+ +
Sbjct: 315 VSLSGGISFGVYQYV 329

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 66/163 (40%), Gaps = 26/163 (15%)

Query: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERXX 120
           V ++Y+  GV+G  +G      R    S V++  Y +    +     S H+ L  ++   
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSL-----SPHKALDEYQAFA 253

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEG- 179
                       T P+D+++TR+  +TA     ++S           +    RIF EEG 
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFT--YKSS----------LNCAYRIFVEEGF 301

Query: 180 --GLRGWYRGVYPTSL------GVVPFVALNFALYERLKALIP 214
               +GW   ++  SL      GV  +V     L+E  ++L P
Sbjct: 302 RYMWKGWVPRLFKVSLSGGISFGVYQYVENLVLLWEHERSLAP 344

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/274 (19%), Positives = 104/274 (37%), Gaps = 20/274 (7%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++  K+ LQ           +V  ++ + K EG+ GL+ G   + LR   Y+  ++ +Y
Sbjct: 26  PLDLTKVRLQAAPIPKP---TIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFGMY 82

Query: 96  EFCKTRVFHVGQSGHEQLRS-WERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLH 154
           +  K  V        ++L + W                    DL+  R+   +A      
Sbjct: 83  DALKEHVIP-----RDKLTNMWYLLGASMVSGALGGLAGNFADLINIRMQNDSALPLDKR 137

Query: 155 RSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIP 214
           R+  + I    G+V    +I++ EG    +  G  P  +  V   A     Y+  K  + 
Sbjct: 138 RNYKNAID---GMV----KIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNFLV 190

Query: 215 HDYDAGSVA-AAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALW 273
             Y+      +  L    ++G +A TV  P D+++    ++     + G  + S    L 
Sbjct: 191 TKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIK---TIVMNAHKKPGHNHDSSFKILM 247

Query: 274 TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
               +EG    ++G   +  ++ P   + +F  E
Sbjct: 248 EAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G  +G  A    +P DL + R Q   + +        ++   L +I + EG+ G Y GL+
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKP-------TIVQMLRSILKNEGIVGLYAGLS 65

Query: 290 ANLVK 294
           A+L++
Sbjct: 66  ASLLR 70

>Scas_687.15*
          Length = 328

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 54/130 (41%), Gaps = 7/130 (5%)

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT 239
           GLRG+ +G  PT    V    + F  Y  LK LI        V A    IG  S      
Sbjct: 192 GLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYA--FGIGLFSSCAVVA 249

Query: 240 VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299
           +  P D+++ R Q  T       + Y +  +  + +  +EG+   +KG    L KV  + 
Sbjct: 250 LTQPIDVVKTRMQSKTA-----HYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSG 304

Query: 300 AVQWFVYELI 309
            + + VY+ +
Sbjct: 305 GISFGVYQYV 314

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 63/159 (39%), Gaps = 18/159 (11%)

Query: 54  NGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQL 113
           +  +   VK++Y   G++G  +G      R    S V++  Y   K  +     S  + L
Sbjct: 177 SSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPTQPL 231

Query: 114 RSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRR 173
                              T P+D+V+TR+  +TA+    +++           +    R
Sbjct: 232 NEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHY--FYKNS----------LNCAYR 279

Query: 174 IFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212
           +F EEG +  W +G  P    V     ++F +Y+ ++ L
Sbjct: 280 VFVEEGMVSLW-KGWLPRLFKVGLSGGISFGVYQYVENL 317

>Kwal_55.21106
          Length = 328

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 115/300 (38%), Gaps = 58/300 (19%)

Query: 30  SRTVVSPVERVKILLQVQSS--TTAYNGGL-----------------VHAVKQVYKEEGV 70
           +  VV P++ VK L+Q Q+         G+                 + A+ +++K +GV
Sbjct: 17  ANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIKIFKTKGV 76

Query: 71  KGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV----GQSGHEQLRSWERXXXXXXXX 126
            GL++G   + +  F  S   +  Y   +   F      G+ G  +  + E         
Sbjct: 77  LGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLG--KFSTPEELLLGIVAA 134

Query: 127 XXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYR 186
                 T P+ ++ TR    T+       SK        G  E+L +I+ E+  + G++R
Sbjct: 135 AVSQIFTSPIGVISTRQQTSTSG------SKG-------GFREVLHQIYSEQNNITGFWR 181

Query: 187 GVYPTSLGVVPFVALNFALYERLKALIPHDYDA-----------GSVAAAK-LAIGAVSG 234
           G +  SL +    ++ FA YE+L+ +      A           G ++  +   +G  S 
Sbjct: 182 G-FKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSK 240

Query: 235 GIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294
            I+  +  P  + +   Q         G  + S    L  + +QEGL   +KGL   L K
Sbjct: 241 VISTLITQPLIVSKAYLQ-------RTGSNFQSFQQVLLYLYKQEGLISLWKGLAPQLSK 293

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 15/79 (18%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQ---SELG------------FRYASVADALWT 274
           GAV+  +A  VVYP DL++   Q         SE G             RY    DAL  
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 275 IGRQEGLRGYYKGLTANLV 293
           I + +G+ G Y+GL  +++
Sbjct: 70  IFKTKGVLGLYQGLWTSII 88

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/287 (18%), Positives = 102/287 (35%), Gaps = 34/287 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + V+P++ VK  LQV       N   +   K + + EG+  +F G G   +      A
Sbjct: 29  THSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85

Query: 90  VQYAVYEFCKTRVFHV--GQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQT 147
            +Y  YE+ K    ++   ++ H   R+                   P + ++ +     
Sbjct: 86  CKYGGYEYFKQTYSNLLSPETAHRH-RTAVYLCASASAEFLADILLCPWEAIKVKQQTTI 144

Query: 148 ANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYE 207
               K               +E   +I   EG L G Y+G+ P     +P+    F  +E
Sbjct: 145 PPFCK-------------NFLEGWSKITAAEG-LSGLYKGITPLWCRQIPYTMCKFTSFE 190

Query: 208 RLKALI-------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSE 260
           R+  +I         +             G ++G +   V +P D++  +       Q E
Sbjct: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA-DRKQGE 249

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
                 S+ +A   I  + G  G + GL   +  +    + QW +Y+
Sbjct: 250 ------SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 73/179 (40%), Gaps = 25/179 (13%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLDLV+ RL +      +L+RS           ++  + I R EG L   + GV  T +G
Sbjct: 35  PLDLVKCRLQVN----PQLYRSN----------LDGWKTIVRSEG-LSKVFTGVGATFIG 79

Query: 195 VVPFVALNFALYERLKA----LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250
                A  +  YE  K     L+  +       A  L   A +  +A  ++ P++ ++ +
Sbjct: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139

Query: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309
                  Q+ +     +  +    I   EGL G YKG+T    + +P    ++  +E I
Sbjct: 140 ------QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 74/178 (41%), Gaps = 24/178 (13%)

Query: 33  VVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92
           V+ P++ +KI  + Q++  ++ G       ++ K+EG  GL+RG G    R  P S   +
Sbjct: 135 VLLPLDVLKI--KRQTNPESFKG---RGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALF 188

Query: 93  AVYEFCKTRVFHVGQSGHEQLRSW-ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
               F K  +  +   G     +W +               + PLD+++TR  IQ  N  
Sbjct: 189 GGNAFAKEYILGLKDYGQA---TWSQNFVSSIVGASASLIVSAPLDVIKTR--IQNRNF- 242

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL 209
                       P    ++++   + EG    +++G+ P  L   P +  +FAL + L
Sbjct: 243 ----------DNPESGFKIIKNTLKNEG-FTAFFKGLTPKLLTTGPKLVFSFALAQTL 289

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 55/132 (41%), Gaps = 9/132 (6%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAV 232
           +I ++EG   G YRG   T+    P     F      K  I    D G    ++  + ++
Sbjct: 160 KIIKDEG--FGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSI 217

Query: 233 SGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
            G  A  +V  P D+++ R Q       E GF+   + + L    + EG   ++KGLT  
Sbjct: 218 VGASASLIVSAPLDVIKTRIQNRNFDNPESGFKI--IKNTL----KNEGFTAFFKGLTPK 271

Query: 292 LVKVVPAMAVQW 303
           L+   P +   +
Sbjct: 272 LLTTGPKLVFSF 283

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 26/183 (14%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V+ P++ +KI  + Q++  ++ G G +    ++ ++EG+  L+RG G    R  P S   
Sbjct: 135 VLLPLDVLKI--KRQTNPESFKGRGFI----KILRDEGLFNLYRGWGWTAARNAPGSFAL 188

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +    F K  +  +G   + Q    +               + PLD+++TR  IQ  N  
Sbjct: 189 FGGNAFAKEYI--LGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTR--IQNRNF- 243

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
                       P   + +++   + E G+  +++G+ P  L   P +  +FAL +   +
Sbjct: 244 ----------DNPESGLRIVKNTLKNE-GVTAFFKGLTPKLLTTGPKLVFSFALAQ---S 289

Query: 212 LIP 214
           LIP
Sbjct: 290 LIP 292

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 8/132 (6%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAV 232
           +I R+EG L   YRG   T+    P     F      K  I    D      ++  I ++
Sbjct: 160 KILRDEG-LFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSI 218

Query: 233 SGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
            G  +  +V  P D+++ R Q       E G R   V + L    + EG+  ++KGLT  
Sbjct: 219 VGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRI--VKNTL----KNEGVTAFFKGLTPK 272

Query: 292 LVKVVPAMAVQW 303
           L+   P +   +
Sbjct: 273 LLTTGPKLVFSF 284

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 98/249 (39%), Gaps = 40/249 (16%)

Query: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLR--SWERXX 120
           +VY+ EG  GL+ G   + L  F  S   +  Y   +   F V +   E  R  + E   
Sbjct: 96  KVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFSTIEELL 155

Query: 121 XXXXXXXXXXXXTYPLDLV----RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR 176
                       T P+++V    +TR  ++  N  K    + +D                
Sbjct: 156 LSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYD---------------- 199

Query: 177 EEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH-DYDAGSVAAAKLA------- 228
            E G+ G+++ +   SL +    ++ +A  E+LK ++ H +++A  +  + L        
Sbjct: 200 -EDGITGFWKSL-KVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNF 257

Query: 229 -IGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKG 287
            IG +S  I+  + +P  + +   Q  +        ++ S  + L  + R EG    +KG
Sbjct: 258 LIGVLSKIISTCLTHPLIVAKASLQRSSS-------KFTSFQEVLTYLYRHEGAHALWKG 310

Query: 288 LTANLVKVV 296
           L   L K V
Sbjct: 311 LLPQLTKGV 319

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 39/123 (31%), Gaps = 42/123 (34%)

Query: 229 IGAVSGGIAQTVVYPFDLLRRRFQVL---------------------------------- 254
           +GAVS G A   VYP DL +   Q                                    
Sbjct: 9   VGAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGIQQ 68

Query: 255 --------TMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306
                   T  +  L  RY    D +  + R EG  G Y GL+A+L+         +F Y
Sbjct: 69  IKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWY 128

Query: 307 ELI 309
            LI
Sbjct: 129 TLI 131

>Kwal_23.5757
          Length = 307

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 104/287 (36%), Gaps = 33/287 (11%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSA 89
           + + V+P++ VK   QV +S    N   +   +Q+ + EG   +F G G   +      A
Sbjct: 33  THSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 90  VQYAVYEFCKTRVFH-VGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTA 148
            +Y  YEF K +    V        R+                   P + ++ R   QTA
Sbjct: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQ--QTA 147

Query: 149 NLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
                 R+          + +   ++   EG     Y+G+ P     +P+    F  +ER
Sbjct: 148 VPPPFARN----------VFDAYSKMVGAEG-FASLYKGITPLWFRQIPYTMCKFTSFER 196

Query: 209 LKALI-------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRF-QVLTMGQSE 260
           +  +I         +       +   A G ++G +   V +P D++  +       G+S 
Sbjct: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST 256

Query: 261 LGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
           L         A   I  + G  G + GL   ++ +    + QW +Y+
Sbjct: 257 L--------QATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 75/184 (40%), Gaps = 34/184 (18%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLDLV+ R  +     A L++S           ++  R+I R EG  +  + GV  T++G
Sbjct: 39  PLDLVKCRRQVD----ASLYKSN----------LDGWRQIVRSEGATK-VFTGVGATAIG 83

Query: 195 VVPFVALNFALYERLK--------ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246
                A  +  YE  K            H Y  G      LA  A +  IA   + P++ 
Sbjct: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF----LAASASAEFIADIFLCPWEA 139

Query: 247 LRRRFQVLTMGQSELGFRYA-SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305
           ++ R       Q+ +   +A +V DA   +   EG    YKG+T    + +P    ++  
Sbjct: 140 IKVR------QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193

Query: 306 YELI 309
           +E I
Sbjct: 194 FERI 197

>Scas_705.9
          Length = 323

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQ--SELG------FRYASVADALWTIGRQEGL 281
           GA++  +A  +VYP D+ +   Q  T  +   EL        R  +V   L  I R+ GL
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 282 RGYYKGLTANLVKVVPAMAVQWFVY 306
           RG Y+G++ +    V +  VQ F Y
Sbjct: 70  RGLYQGMSTS----VFSKFVQSFCY 90

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/253 (16%), Positives = 102/253 (40%), Gaps = 35/253 (13%)

Query: 56  GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLR- 114
            ++  + +++++ G++GL++G   +    F  S   +  Y F + + F +    + Q R 
Sbjct: 55  NVIRCLIRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARP 114

Query: 115 -----SWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVE 169
                + E                 P++++             L + +  D +       
Sbjct: 115 INSISTVEELIVGVGAAALTQVVNNPIEVI-------------LTKQQTTDDKDNVDFYS 161

Query: 170 LLRRIFREEGG-LRGWYRGVYPTSLGVVPFVALNFALYERLKALI-------PHDYDAGS 221
           +L++I+ E  G L  +++G +  SL +    ++ FA Y+R K ++          Y    
Sbjct: 162 VLKQIYVESNGKLSSYWKG-FKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQL 220

Query: 222 VAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL 281
                  +GA++  I+  +  P  + +     +++ +S   F++    + L  + ++EG+
Sbjct: 221 TVNQNFILGALAKIISTIITQPLIVAK-----VSLQRSNSKFKH--FEEVLRYLYKEEGV 273

Query: 282 RGYYKGLTANLVK 294
              +KG+   L K
Sbjct: 274 LALWKGVGPQLTK 286

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 32/187 (17%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREE-------GGLRGWYRG 187
           P++L + +L +Q       + +K      P   +++++++F++        GG+R  Y+G
Sbjct: 131 PVELAKAKLQVQ-------YDAKTTKYTGP---IDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 188 VYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQ-----TVVY 242
           +  T +        NF  +     LI   +   +  +A  AI   +GG++      T  Y
Sbjct: 181 LISTLI-----FRSNFVFWWGSYELITQWFQKNTNLSAP-AINFWAGGLSASFGFWTSAY 234

Query: 243 PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302
           P D+++   QV+       G  + S   A+  I RQ G+ G++KG   + ++  PA A  
Sbjct: 235 PSDVVK---QVVLCNDKYDG-SFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAA 290

Query: 303 WFVYELI 309
              +E +
Sbjct: 291 LAAFEFV 297

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G  SG    TV +PFD ++ R Q   +G S  G ++    D ++   + +G+RG Y G T
Sbjct: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVG-SGAGIQFKGPLDCVYKTLKNQGIRGLYLGFT 74

Query: 290 ANL 292
             L
Sbjct: 75  PPL 77

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 32  TVVSPVERVKILLQVQSSTTAYNGGLVH---AVKQVYKEEGVKGLFRGNGINCLRIFPYS 88
           T   P + VK   QV      Y+G       AV  +Y++ G+ G F+G   + LR FP +
Sbjct: 231 TSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPAN 287

Query: 89  AVQYAVYEF 97
           A   A +EF
Sbjct: 288 AAALAAFEF 296

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 53/130 (40%), Gaps = 20/130 (15%)

Query: 191 TSLGVVPFVALNFALYERLKALIP---------HDYDAG----SVAAAKLAIGAVSGGIA 237
           T L   P+  L   LYE+ K L+P         ++ + G    +          +S  +A
Sbjct: 178 TCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLA 237

Query: 238 QTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297
            TV  PFD ++ R Q+          ++ +  +   +I + E +   + GL+  L +   
Sbjct: 238 TTVTAPFDTIKTRMQLEPS-------KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAF 290

Query: 298 AMAVQWFVYE 307
           +  + W +YE
Sbjct: 291 SAGIAWGIYE 300

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 43  LLQVQSSTTAYN-GGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK-- 99
           +++V+  +T YN   L  A+  +Y +EG+ G FRG G  CLR  PY+ +   +YE  K  
Sbjct: 140 VIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQL 199

Query: 100 ------TRVFHVGQSG--HEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQ 146
                 +R  H    G       +                 T P D ++TR+ ++
Sbjct: 200 LPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLE 254

>Scas_702.10
          Length = 302

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289
           G  +G  A  + +P DL + R Q   + +  LG         L TI R E + G Y GL+
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLG-------RMLTTILRNENVMGLYSGLS 68

Query: 290 ANLVKVVPAMAVQWFVYELI 309
           A +++      V++  Y+L+
Sbjct: 69  AAVLRQCTYTTVRFGAYDLM 88

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 56/280 (20%), Positives = 107/280 (38%), Gaps = 35/280 (12%)

Query: 36  PVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVY 95
           P++  K+ LQ         G ++     + + E V GL+ G     LR   Y+ V++  Y
Sbjct: 29  PLDLAKVRLQAAPLPKPTLGRML---TTILRNENVMGLYSGLSAAVLRQCTYTTVRFGAY 85

Query: 96  EFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHR 155
           +  K  +      GH     +                 +  D+V  R+   +A   +L R
Sbjct: 86  DLMKENLI---PQGHINDMVYLLPCSMFSGAIGGLVGNFA-DVVNIRMQNDSALKPELRR 141

Query: 156 SKAHDIRRPPGIVELLRRIFREEGGLR----GW----YRGVYPTSLGVVPFVALNFALYE 207
           +  + I       + + +I+  EGG++    GW     RGV  T+  VV +      L  
Sbjct: 142 NYRNAI-------DGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVT 194

Query: 208 RLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYAS 267
           +L       +D     +  L+   ++G +A T+  P D+++ R       +SE   +  +
Sbjct: 195 KL------SFDPKK-NSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTESESAIKILT 247

Query: 268 VADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            A       ++EG    ++G      ++ P   + +F  E
Sbjct: 248 SAI------KKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 66/162 (40%), Gaps = 12/162 (7%)

Query: 151 AKLHR--SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208
           A  H+  +K+  + R   ++  ++ +++  G    + +G   T    +   ++ F  Y  
Sbjct: 125 ATFHKVATKSTPVARIEKLLPAVKHMYQTRGP-AAFVQGTTATIFRQIANTSIQFTAYTA 183

Query: 209 LKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASV 268
            K L+    D  S     LA       + Q    P D+++ R     M        Y + 
Sbjct: 184 FKRLLQARNDKASSVITGLATSFTLVAMTQ----PIDVVKTR-----MMSQNAKTEYKNT 234

Query: 269 ADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
            + ++ I  QEG+  ++KG     +KV  +  + + VYE +S
Sbjct: 235 LNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVS 276

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 61/158 (38%), Gaps = 22/158 (13%)

Query: 57  LVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSW 116
           L+ AVK +Y+  G     +G      R    +++Q+  Y   K     + Q+ +++  S 
Sbjct: 143 LLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFK----RLLQARNDKASS- 197

Query: 117 ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR 176
                           T P+D+V+TR+  Q A                   +  + RIF 
Sbjct: 198 --VITGLATSFTLVAMTQPIDVVKTRMMSQNAK------------TEYKNTLNCMYRIFV 243

Query: 177 EEGGLRGWYRGVYP-TSLGVVPFVALNFALYERLKALI 213
           +EG    W   ++    +G+     L F +YE++  L+
Sbjct: 244 QEGMATFWKGSIFRFMKVGISG--GLTFTVYEQVSLLL 279

>Kwal_27.11626
          Length = 299

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 9/132 (6%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAV 232
           +I ++EG   G YRG   T+    P     F      K  I    D  S   ++  + ++
Sbjct: 159 KILKDEG--FGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSI 216

Query: 233 SGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
            G  A  +V  P D+++ R Q       E GFR   V + L    + EG+  ++KGLT  
Sbjct: 217 VGASASLIVSAPLDVIKTRIQNRHFDNPESGFRI--VQNTL----KNEGITAFFKGLTPK 270

Query: 292 LVKVVPAMAVQW 303
           L+   P +   +
Sbjct: 271 LLTTGPKLVFSF 282

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 77/183 (42%), Gaps = 27/183 (14%)

Query: 33  VVSPVERVKILLQVQSSTTAYNG-GLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQ 91
           V+ P++ +KI  + Q++  ++ G G +    ++ K+EG  GL+RG G    R  P S   
Sbjct: 134 VLLPLDVLKI--KRQTNPESFKGRGFI----KILKDEGF-GLYRGWGWTAARNAPGSFAL 186

Query: 92  YAVYEFCKTRVFHVGQSGHEQLRSWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLA 151
           +    F K  +  +G   +      +               + PLD+++TR+        
Sbjct: 187 FGGNAFAKEYI--LGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRI-------- 236

Query: 152 KLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKA 211
                +      P     +++   + EG +  +++G+ P  L   P +  +FAL +   +
Sbjct: 237 -----QNRHFDNPESGFRIVQNTLKNEG-ITAFFKGLTPKLLTTGPKLVFSFALAQ---S 287

Query: 212 LIP 214
           LIP
Sbjct: 288 LIP 290

>Scas_613.24
          Length = 177

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 73/179 (40%), Gaps = 40/179 (22%)

Query: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194
           PLDL++TR  IQ    A L  S   DI+ P                ++ W RG  P++L 
Sbjct: 28  PLDLLKTR--IQQHKGATLW-SAIKDIKDP----------------IQFW-RGTLPSALR 67

Query: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAA----------KLAIGAVSGGIAQTVVYPF 244
                AL  +    ++  + H     + + +           L  GA++ G+   +  P 
Sbjct: 68  TSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITMPI 127

Query: 245 DLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQW 303
            +L+ R++          + Y S+ +A+  I + EG+ G++KG    +   +P    QW
Sbjct: 128 TILKVRYE-------STYYSYKSMNEAIKDIYKMEGISGFFKGFGPTVGIGIPP---QW 176

 Score = 30.8 bits (68), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 30  SRTVVSPVERVKILLQVQSSTTAYN-GGLVHAVKQVYKEEGVKGLFRGNG 78
           +R +V  +     +L+V+  +T Y+   +  A+K +YK EG+ G F+G G
Sbjct: 116 ARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFG 165

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 61/145 (42%), Gaps = 23/145 (15%)

Query: 58  VHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKT---RVFHVGQSGHEQLR 114
           +   KQ++  EG++G+ +G     +R       ++ +    +    RV H  +   E+L 
Sbjct: 154 LQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTH--KRSDEKLS 211

Query: 115 SWERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRI 174
           + E+                P++++R  +           +S+ +D  RP  +   + + 
Sbjct: 212 AMEKIVASALGGGLSAW-NQPIEVIRVEM-----------QSRTNDPNRPKNLT--VGKT 257

Query: 175 FR---EEGGLRGWYRGVYP-TSLGV 195
           FR   E  GLRG YRGV P   LGV
Sbjct: 258 FRYIYENNGLRGLYRGVTPRIGLGV 282

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 28/139 (20%)

Query: 165 PGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALY----ERLKALIPHDYDAG 220
           P  +++ ++IF  EG LRG  +GV   ++  +      F L     + ++ +     D  
Sbjct: 151 PSSLQVFKQIFAAEG-LRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEK 209

Query: 221 SVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQV----------LTMGQSELGFRYASVAD 270
             A  K+   A+ GG++     P +++R   Q           LT+G++   FRY     
Sbjct: 210 LSAMEKIVASALGGGLS-AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKT---FRY----- 260

Query: 271 ALWTIGRQEGLRGYYKGLT 289
               I    GLRG Y+G+T
Sbjct: 261 ----IYENNGLRGLYRGVT 275

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT 239
           G   +++G  PT    V   A+ F  Y  LK +I  +       A    IG  S      
Sbjct: 205 GFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLSEYYA--FGIGVFSSCAVVA 262

Query: 240 VVYPFDLLRRRFQVLTMGQSELGFR-YASVADALWTIGRQEGLRGYYKGLTANLVKVVPA 298
           +  P D+++ R Q      S+  +  Y +  + ++    +EGL   +KG    L KV  +
Sbjct: 263 LTQPIDVVKTRMQ------SKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLS 316

Query: 299 MAVQWFVYELIS 310
             V + VY+ + 
Sbjct: 317 GGVSFGVYQYVD 328

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 55/133 (41%), Gaps = 17/133 (12%)

Query: 62  KQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERXX 120
           K +YK+EG++G+ +G     +R       ++ +    +  +  + G++G +   +     
Sbjct: 153 KSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKI 212

Query: 121 XXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR---E 177
                         P++++R  +           +SK  D  RP  +   + + F+   +
Sbjct: 213 MASAIGGGLSAWNQPIEVIRVEM-----------QSKKEDPNRPKNLT--VGKTFKYIYQ 259

Query: 178 EGGLRGWYRGVYP 190
             GL+G YRGV P
Sbjct: 260 SNGLKGLYRGVTP 272

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 56/138 (40%), Gaps = 9/138 (6%)

Query: 173 RIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAV 232
           RI R+EG   G YRG   T+    P     F      K  I    D       +  + ++
Sbjct: 159 RILRDEG--MGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSI 216

Query: 233 SGGIAQTVVY-PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTAN 291
            G  A  +V  P D+++ R Q      +E GF    V + L    + EG   ++KGLT  
Sbjct: 217 FGASASLIVSAPLDVIKTRIQSRNFESAESGFTI--VKNTL----KNEGATAFFKGLTPK 270

Query: 292 LVKVVPAMAVQWFVYELI 309
           L+   P +   + + + +
Sbjct: 271 LLTTGPKLVFSFAIAQTL 288

>Scas_671.1*
          Length = 123

 Score = 30.4 bits (67), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/102 (20%), Positives = 44/102 (43%), Gaps = 11/102 (10%)

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSG----GIAQTVVYPFDLLRRRFQVLTMGQSELGFRY 265
           K+LI +  D     +    + +VS      +A  +  PFD ++ R Q+    + ++   +
Sbjct: 22  KSLIHYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQL----KPKV---F 74

Query: 266 ASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307
            +    L  I + E +   + GL+  L +   +  + W +YE
Sbjct: 75  TNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYE 116

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 58/134 (43%), Gaps = 19/134 (14%)

Query: 62  KQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSG-HEQLRSWERX 119
           K +YK+EG++G+ +G     +R       ++ +    +  +  + G++   ++L  +E+ 
Sbjct: 160 KNIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEK- 218

Query: 120 XXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR--- 176
                          P++++R  +           +SK  D  RP  +   + + F+   
Sbjct: 219 IGASALGGGLSAWNQPIEVIRVEM-----------QSKKEDPNRPKNLT--VGKTFKYIY 265

Query: 177 EEGGLRGWYRGVYP 190
           +  GL+G YRGV P
Sbjct: 266 QSNGLKGLYRGVTP 279

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 179 GGLRGWYRGVYP-------TSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGA 231
           GG+ G+Y+G+ P       T   V+ FV+   A Y R K+L  +++ +G        +G 
Sbjct: 67  GGILGYYQGLIPWAWIEASTKGAVLLFVSAE-AEY-RFKSLGLNNFASG-------ILGG 117

Query: 232 VSGGIAQT-VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTA 290
           V+GG+ Q  +   F    +  ++     +  G    S       I ++EG+RG  KG+ A
Sbjct: 118 VTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNA 177

>Kwal_34.15907
          Length = 312

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 59/142 (41%), Gaps = 18/142 (12%)

Query: 59  HAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCK--TRVFHVGQSGHEQLRSW 116
            A K++Y +EG+KG+ +G     +R       ++ +    +   R F    +  ++L + 
Sbjct: 155 SAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTAL 214

Query: 117 ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIV--ELLRRI 174
           E+                P++++R  +           +SK  D  RP  +      + I
Sbjct: 215 EKIFASALGGGLSAW-NQPIEVIRVEM-----------QSKKEDPNRPKKLTVGSAFKYI 262

Query: 175 FREEGGLRGWYRGVYP-TSLGV 195
           ++  G ++G YRGV P   LGV
Sbjct: 263 YQSSG-IKGLYRGVAPRIGLGV 283

>Scas_696.9
          Length = 312

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 56/135 (41%), Gaps = 15/135 (11%)

Query: 59  HAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFH-VGQSGHE-QLRSW 116
           +  + +Y +EG++G+++G     +R       ++      +  V    G++  E +L +W
Sbjct: 155 NVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAW 214

Query: 117 ERXXXXXXXXXXXXXXTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGI-VELLRRIF 175
           E+                P++++R  +           +SK  D  RP  + V    +  
Sbjct: 215 EK-IGATAVGGGLSAWNQPIEVIRVEM-----------QSKKEDPNRPKNLTVAKTFKYI 262

Query: 176 REEGGLRGWYRGVYP 190
            +  G++G YRGV P
Sbjct: 263 MKTNGVKGLYRGVTP 277

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 210 KALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVA 269
           K + P D D  + A A    GA+S      + YP   +  + Q  T G  E   +  S  
Sbjct: 4   KEICPSDVDELAHALAGAGGGALS----MALTYPLVTITTKLQ--TQGNDE-NNQVKSKL 56

Query: 270 DALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310
           + +  I R++GL G+Y GL + +  +     V ++ YEL S
Sbjct: 57  ETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYFYELTS 97

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,189,742
Number of extensions: 283950
Number of successful extensions: 2050
Number of sequences better than 10.0: 206
Number of HSP's gapped: 1229
Number of HSP's successfully gapped: 637
Length of query: 310
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 209
Effective length of database: 13,099,691
Effective search space: 2737835419
Effective search space used: 2737835419
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)