Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR665C37636919840.0
YGR046W38532512251e-169
Scas_640.1939438312241e-168
Kwal_33.1342238237412071e-166
KLLA0C02409g39333911911e-163
CAGL0G03861g3102809121e-122
Scas_707.28881109750.31
YDL040C (NAT1)85450681.9
YNR067C (DSE4)1117109672.5
Kwal_56.2284184854663.3
CAGL0L04554g56037663.7
YMR134W23725644.4
AGR206C65175654.5
ADR310W84356655.1
CAGL0C05313g83939638.0
Sklu_2077.3108947639.7
Sklu_2077.2108947639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR665C
         (369 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR665C [3858] [Homologous to ScYGR046W - SH] (1651993..1653123)...   768   0.0  
YGR046W (YGR046W) [2011] chr7 (584897..586054) Protein of unknow...   476   e-169
Scas_640.19                                                           476   e-168
Kwal_33.13422                                                         469   e-166
KLLA0C02409g 214337..215518 similar to sp|P53230 Saccharomyces c...   463   e-163
CAGL0G03861g 365892..366824 similar to sp|P53230 Saccharomyces c...   355   e-122
Scas_707.28                                                            33   0.31 
YDL040C (NAT1) [824] chr4 complement(378871..381435) Protein N-a...    31   1.9  
YNR067C (DSE4) [4650] chr14 complement(755743..759096) Endo-beta...    30   2.5  
Kwal_56.22841                                                          30   3.3  
CAGL0L04554g complement(524738..526420) similar to tr|Q12246 Sac...    30   3.7  
YMR134W (YMR134W) [4091] chr13 (537837..538550) Protein involved...    29   4.4  
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    30   4.5  
ADR310W [2051] [Homologous to ScYDL040C (NAT1) - SH] complement(...    30   5.1  
CAGL0C05313g 506270..508789 similar to sp|P12945 Saccharomyces c...    29   8.0  
Sklu_2077.3 YML002W, Contig c2077 1119-4388                            29   9.7  
Sklu_2077.2 YML003W, Contig c2077 1119-4388                            29   9.7  

>AFR665C [3858] [Homologous to ScYGR046W - SH] (1651993..1653123)
           [1131 bp, 376 aa]
          Length = 376

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MLRGSKLQSTQCIRTWIAIRQQSQLASRSSTEVPGRLRPSLLPRESVVKASAEVKEFSLL 60
           MLRGSKLQSTQCIRTWIAIRQQSQLASRSSTEVPGRLRPSLLPRESVVKASAEVKEFSLL
Sbjct: 1   MLRGSKLQSTQCIRTWIAIRQQSQLASRSSTEVPGRLRPSLLPRESVVKASAEVKEFSLL 60

Query: 61  EQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAELRGIMGHFQAPVRYAFG 120
           EQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAELRGIMGHFQAPVRYAFG
Sbjct: 61  EQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAELRGIMGHFQAPVRYAFG 120

Query: 121 YGSGVFEQAGAHKSDGRPQMDLILGVTHPEHFHSLNMRQNAHHYSTMRYFGSDAISKLQA 180
           YGSGVFEQAGAHKSDGRPQMDLILGVTHPEHFHSLNMRQNAHHYSTMRYFGSDAISKLQA
Sbjct: 121 YGSGVFEQAGAHKSDGRPQMDLILGVTHPEHFHSLNMRQNAHHYSTMRYFGSDAISKLQA 180

Query: 181 VGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDLRVQFW 240
           VGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDLRVQFW
Sbjct: 181 VGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDLRVQFW 240

Query: 241 NQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVEK 300
           NQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVEK
Sbjct: 241 NQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVEK 300

Query: 301 NYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWNSTVQTVKGVVTAGVAK 360
           NYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWNSTVQTVKGVVTAGVAK
Sbjct: 301 NYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWNSTVQTVKGVVTAGVAK 360

Query: 361 SVKYAWAKK 369
           SVKYAWAKK
Sbjct: 361 SVKYAWAKK 369

>YGR046W (YGR046W) [2011] chr7 (584897..586054) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.6613p [1158 bp, 385 aa]
          Length = 385

 Score =  476 bits (1225), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 217/325 (66%), Positives = 264/325 (81%), Gaps = 4/325 (1%)

Query: 45  ESVVKASAEVKEFSLLEQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAEL 104
           E + K S    +  LLE+GIRKTD+  S + NY YKF RLP NYGSNQL+ I +E+  EL
Sbjct: 58  EGITKGS----DLDLLEKGIRKTDEMTSNFTNYMYKFHRLPPNYGSNQLITIDKELQKEL 113

Query: 105 RGIMGHFQAPVRYAFGYGSGVFEQAGAHKSDGRPQMDLILGVTHPEHFHSLNMRQNAHHY 164
            G+M  F+AP R+ FGYGSGVFEQAG  KS  +PQ+D+ILGVT+P HFHS+NMRQN  HY
Sbjct: 114 DGVMSSFKAPCRFVFGYGSGVFEQAGYSKSHSKPQIDIILGVTYPSHFHSINMRQNPQHY 173

Query: 165 STMRYFGSDAISKLQAVGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRL 224
           S+++YFGS+ +SK Q +GAGVYFNPF +INGH VKYGVVSME LLKD+ATW+TFYLAGRL
Sbjct: 174 SSLKYFGSEFVSKFQQIGAGVYFNPFANINGHDVKYGVVSMETLLKDIATWNTFYLAGRL 233

Query: 225 QKPVKVLKNDLRVQFWNQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRY 284
           QKPVK+LKNDLRVQ+WNQLNLK+AATLAKH  L K+  K DEF+FYK++TALSY GD+RY
Sbjct: 234 QKPVKILKNDLRVQYWNQLNLKAAATLAKHYTLEKNNNKFDEFQFYKEITALSYAGDIRY 293

Query: 285 KLGGENPSKVTNIVEKNYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWN 344
           KLGGENP KV NIV KN+E FQ YY+PIY++V++ND  YLP+GFT+ N  +LL  RIS +
Sbjct: 294 KLGGENPDKVNNIVTKNFERFQEYYKPIYKEVVLNDSFYLPKGFTLKNTQRLLLSRISKS 353

Query: 345 STVQTVKGVVTAGVAKSVKYAWAKK 369
           S +QT+KGV TAG+ KS+KYAWAKK
Sbjct: 354 SALQTIKGVFTAGITKSIKYAWAKK 378

>Scas_640.19
          Length = 394

 Score =  476 bits (1224), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 290/383 (75%), Gaps = 17/383 (4%)

Query: 2   LRGSKLQSTQCIR---TWIAIRQQSQLASRSSTEVPGRLRPSLLPRESVV---------- 48
           +R   L+ T  I    ++  IR QS   + +  E  G   P LL  E+++          
Sbjct: 8   IRSLSLRKTVVISKLPSFSTIRHQST-TTTTKNESAGA-EPDLLIHEALIHHQKPDIAGS 65

Query: 49  KASAEVKEFSLLEQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAELRGIM 108
             +A+     LLE+GIRK+D+  S + +Y ++F RLP N+ SNQ + + +E+  EL  IM
Sbjct: 66  SLAADDVRLPLLEEGIRKSDELTSNFTDYMFRFNRLPPNFASNQFMSLDQELQRELTQIM 125

Query: 109 GHFQAPVRYAFGYGSGVFEQAGAHKSDGRP--QMDLILGVTHPEHFHSLNMRQNAHHYST 166
            +F AP+RYAFGYGSGVFEQ G    D  P  Q+D+I GVT+PEHFHSLNMRQN HHYST
Sbjct: 126 DNFDAPIRYAFGYGSGVFEQKGYETGDSSPLPQIDMIFGVTYPEHFHSLNMRQNPHHYST 185

Query: 167 MRYFGSDAISKLQAVGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQK 226
           ++YFGS  +SK Q +GAG+YFNPFV+INGH+VKYGVVSM+ LLKDLATWD+FYLAGRLQK
Sbjct: 186 LKYFGSKFVSKFQEIGAGIYFNPFVEINGHEVKYGVVSMKRLLKDLATWDSFYLAGRLQK 245

Query: 227 PVKVLKNDLRVQFWNQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKL 286
           PVK+LKNDLRVQ+WNQLNLK+AATLAKH+ L ++ GK DEF+FYK++T LSY+GD+RY L
Sbjct: 246 PVKILKNDLRVQYWNQLNLKAAATLAKHLTLKRNKGKFDEFQFYKEITGLSYLGDIRYTL 305

Query: 287 GGENPSKVTNIVEKNYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWNST 346
           GGENP+KV NIVEKN+E FQ YY+PIY+DVIIN+  YLP+G+TVDNA ++L  RIS +S 
Sbjct: 306 GGENPNKVHNIVEKNFERFQLYYKPIYKDVIINNSTYLPKGYTVDNATRILRGRISKSSV 365

Query: 347 VQTVKGVVTAGVAKSVKYAWAKK 369
           +QT+KGV+TAGV+KSV+YAWAKK
Sbjct: 366 LQTLKGVLTAGVSKSVRYAWAKK 388

>Kwal_33.13422
          Length = 382

 Score =  469 bits (1207), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/374 (58%), Positives = 286/374 (76%), Gaps = 6/374 (1%)

Query: 1   MLRGSKLQSTQC--IRTWIAIRQQSQLASRSSTEV---PGRLRPSLLPRESVVKASAEVK 55
           MLR S+  +     ++  +AIR QS   S    E    P    P +  R  + +  ++  
Sbjct: 1   MLRLSQRSNNLSLQVKNLVAIRLQSTHFSHQRNEETFQPIVHGPIMTSRHELAQNISK-D 59

Query: 56  EFSLLEQGIRKTDQALSEYANYRYKFKRLPANYGSNQLLKIGREIDAELRGIMGHFQAPV 115
           E  LL++GIRK+D+  S+++NYRYKFK+LP NYGSNQL++I  E+  +L  ++  F+APV
Sbjct: 60  ELYLLDEGIRKSDELTSQFSNYRYKFKKLPLNYGSNQLIEIDSELQRDLENVVSTFKAPV 119

Query: 116 RYAFGYGSGVFEQAGAHKSDGRPQMDLILGVTHPEHFHSLNMRQNAHHYSTMRYFGSDAI 175
           +YAFGYGSGVF+Q+G   +   PQ+DLI GV+HPEHFHSLNMRQN HHYS++R+FGS  +
Sbjct: 120 KYAFGYGSGVFQQSGYSNAKDAPQIDLIFGVSHPEHFHSLNMRQNPHHYSSLRHFGSQFV 179

Query: 176 SKLQAVGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDL 235
           SK Q +GAG+YFNPFV+I G  VKYG+VSM+ LLKD+ATW++FYLAGRLQKPVKVLKNDL
Sbjct: 180 SKFQEIGAGIYFNPFVEIEGQIVKYGIVSMDTLLKDVATWNSFYLAGRLQKPVKVLKNDL 239

Query: 236 RVQFWNQLNLKSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVT 295
            VQ+WNQLNLK+AATLAKH+++  S   +DEFEFYKQ+TALSY+GD+RYK+G ENP+KV 
Sbjct: 240 SVQYWNQLNLKAAATLAKHLIIKNSDKPLDEFEFYKQITALSYLGDIRYKVGAENPNKVN 299

Query: 296 NIVEKNYENFQRYYEPIYRDVIINDHGYLPRGFTVDNAVKLLEDRISWNSTVQTVKGVVT 355
           NIVEKN+  FQ YY PIY+DV++N+  YLP+GFTV+N+  LLE RI   S +QTVKGV T
Sbjct: 300 NIVEKNFAQFQEYYRPIYKDVVVNNSHYLPQGFTVENSTSLLERRIFRTSALQTVKGVFT 359

Query: 356 AGVAKSVKYAWAKK 369
           AG+ KS++YAWAKK
Sbjct: 360 AGITKSIRYAWAKK 373

>KLLA0C02409g 214337..215518 similar to sp|P53230 Saccharomyces
           cerevisiae YGR046w singleton, hypothetical start
          Length = 393

 Score =  463 bits (1191), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/339 (62%), Positives = 268/339 (79%), Gaps = 3/339 (0%)

Query: 34  PGRLRPSLLPR--ESVVKASAEVKEFSLLEQGIRKTDQALSEYANYRYKFKRLPANYGSN 91
           P + R   + +  E +V       +  LLE+G++K D+  S + NY +K  RLP NYG N
Sbjct: 48  PNKFRRRAIAKLNEDIVAEKTGDADLYLLEKGLKKIDERTSRFTNYLFKINRLPPNYGDN 107

Query: 92  QLLKIGREIDAELRGIMGHFQAPVRYAFGYGSGVFEQAGAHKSDGRPQMDLILGVTHPEH 151
           QL+ + + ++ +L+ I+GHF++P++YAFGYGSGVF+QAG  KS  +PQ+D+I GVTHPEH
Sbjct: 108 QLITVDKSLERDLQSILGHFKSPIKYAFGYGSGVFQQAGYSKSSEKPQIDMIFGVTHPEH 167

Query: 152 FHSLNMRQNAHHYSTMRYFGSDAISKLQAVGAGVYFNPFVDINGHQVKYGVVSMENLLKD 211
           FHSLNMRQN  HYS++RYFGS+ +SK Q VGAGVYFNPF++INGH VKYGVVSM  LLKD
Sbjct: 168 FHSLNMRQNPGHYSSLRYFGSEFVSKFQEVGAGVYFNPFININGHDVKYGVVSMSRLLKD 227

Query: 212 LATWDTFYLAGRLQKPVKVLKNDLRVQFWNQLNLKSAATLAKHMLLAKSPG-KIDEFEFY 270
           LATWDTFYLAGRLQKPVKVLKNDLRVQ+WNQLNLK+AATLAKH L  K  G    EF+FY
Sbjct: 228 LATWDTFYLAGRLQKPVKVLKNDLRVQYWNQLNLKAAATLAKHKLSKKFNGDSFTEFDFY 287

Query: 271 KQVTALSYIGDVRYKLGGENPSKVTNIVEKNYENFQRYYEPIYRDVIINDHGYLPRGFTV 330
           K++TALSY+GD+RYKLGGENP K+ NIVEKN +NF+ YY+PIY+DV +N+  YLP+ FT+
Sbjct: 288 KEITALSYLGDIRYKLGGENPKKIDNIVEKNLDNFKFYYKPIYKDVFLNNSTYLPQNFTL 347

Query: 331 DNAVKLLEDRISWNSTVQTVKGVVTAGVAKSVKYAWAKK 369
           DNA   L +RIS  ST+QT KGV++AG+ KS+KYAWAKK
Sbjct: 348 DNATDQLTERISRGSTIQTAKGVLSAGLMKSIKYAWAKK 386

>CAGL0G03861g 365892..366824 similar to sp|P53230 Saccharomyces
           cerevisiae YGR046w, hypothetical start
          Length = 310

 Score =  355 bits (912), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 215/280 (76%), Gaps = 1/280 (0%)

Query: 90  SNQLLKIGREIDAELRGIMGHFQAPVRYAFGYGSGVFEQAGAHKSDGRPQMDLILGVTHP 149
           SNQ ++I   +  EL GI+  F AP+ YAFGYGSGVF+Q G   +D +PQ+DLIL V  P
Sbjct: 26  SNQAIEIESGLQRELDGILNSFDAPITYAFGYGSGVFKQVGYDSTD-KPQIDLILAVEDP 84

Query: 150 EHFHSLNMRQNAHHYSTMRYFGSDAISKLQAVGAGVYFNPFVDINGHQVKYGVVSMENLL 209
             FHS N++QN+HHYS+++YFG   IS+ Q VGAG+YFNP+ +ING++VKYG+VSM+ +L
Sbjct: 85  VEFHSRNIKQNSHHYSSLKYFGPKVISRFQDVGAGIYFNPYANINGNEVKYGIVSMKRIL 144

Query: 210 KDLATWDTFYLAGRLQKPVKVLKNDLRVQFWNQLNLKSAATLAKHMLLAKSPGKIDEFEF 269
            DL  W++FY+AGRLQKPVKVLK +  ++ +N LNLK+AATLAKH++  K P K DEF+F
Sbjct: 145 NDLKNWESFYIAGRLQKPVKVLKTNPTIEHYNHLNLKAAATLAKHLISVKYPEKFDEFQF 204

Query: 270 YKQVTALSYIGDVRYKLGGENPSKVTNIVEKNYENFQRYYEPIYRDVIINDHGYLPRGFT 329
           YK++T LSY+GD+RY LG ENP KV NIV KN++ F+ YY+PIY DV++N+  YLP GFT
Sbjct: 205 YKEITGLSYLGDIRYHLGAENPKKVENIVTKNFDKFRMYYKPIYEDVVVNNGYYLPPGFT 264

Query: 330 VDNAVKLLEDRISWNSTVQTVKGVVTAGVAKSVKYAWAKK 369
           + N++K ++ RI   S  Q +KGV TAG+ KSVKYAWAK+
Sbjct: 265 LKNSLKKIQYRIQRTSLTQMLKGVATAGITKSVKYAWAKR 304

>Scas_707.28
          Length = 881

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 19/109 (17%)

Query: 36  RLRPSLLPRESVVKASAEVKEFSLLEQGIRKTDQALSEY---------ANYRYKFKRLPA 86
           RL+  L P E   +   EVK+     + I + +Q +++Y         +N   K ++  A
Sbjct: 387 RLKAILEPIEFESRLLQEVKKI-FFNESITEIEQCINKYINEDCIWASSNLELKNQQTYA 445

Query: 87  -NYGSNQLLKIGR--------EIDAELRGIMGHFQAPVRYAFGYGSGVF 126
            N  +N LL+I R        +I  E+ G+   F  P+ Y+F    G F
Sbjct: 446 VNDSANSLLEISRQLYKNLMNDIMEEIEGLSKEFDLPLDYSFDSNRGFF 494

>YDL040C (NAT1) [824] chr4 complement(378871..381435) Protein
           N-acetyltransferase subunit, mating functions are
           reduced in mutants due to derepression of silent mating
           type loci [2565 bp, 854 aa]
          Length = 854

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 250 TLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVE 299
           TL++   LA+  GKI + E Y+    L Y  D+ YK   +N  K+ N+++
Sbjct: 181 TLSQFEKLAE--GKISDSEKYEHSECLMYKNDIMYKAASDNQDKLQNVLK 228

>YNR067C (DSE4) [4650] chr14 complement(755743..759096)
           Endo-beta-1,3-glucanase, plays a role in cell separation
           [3354 bp, 1117 aa]
          Length = 1117

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 181 VGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDLRVQFW 240
           +G+ V FN  V  +   +  G++     L +  TW  + +      P  +   D  ++  
Sbjct: 562 IGSSVGFNTIVSESSSNLAQGILKYRITLLNGVTWLCYVIG-----PDDLTSTDFSLEVS 616

Query: 241 NQLNLKSAATLAKHML-LAKSPGKIDEFEFYKQVTALSYIGDVRYKLGG 288
           ++  +K++A++   ++ LA +P + D   FY Q   + Y+    +KL G
Sbjct: 617 SEYEIKASASVDGLIIQLAVAPSETDYEVFYDQAAGM-YV--TNFKLQG 662

>Kwal_56.22841
          Length = 848

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 246 KSAATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVE 299
           +SA+ L K   LAK  GK+   E Y+    L Y  DV YK  G +  K+  +++
Sbjct: 179 ESASVLTKFEELAK--GKLGSSEAYEHNECLMYKNDVLYKAAGNDQKKLEKVLQ 230

>CAGL0L04554g complement(524738..526420) similar to tr|Q12246
           Saccharomyces cerevisiae YOR171c LCB4, hypothetical
           start
          Length = 560

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 286 LGGENPSKVTNIVEKNYENFQRYYEPIYRDVIINDHG 322
           +  ENP  V  I+EK+Y+N +R    +   VIIN HG
Sbjct: 145 MAHENPDLVELIIEKSYQNVKRNRSIL---VIINPHG 178

>YMR134W (YMR134W) [4091] chr13 (537837..538550) Protein involved in
           iron metabolism [714 bp, 237 aa]
          Length = 237

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 312 IYRDVIINDHGYLPRGFTVDNAVKL 336
           IYRD+I N+ G   R FT+ N VK+
Sbjct: 179 IYRDIIKNEGGEGARKFTISNGVKI 203

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 177 KLQAVGAGVYFNPFVDINGHQVKYGVVSMENLLKDLATWDTFYLAGRLQKPVKVLKNDLR 236
           K + VG G+ F    DING +++  +V  + LLK     D   + G+L +  K LK D +
Sbjct: 59  KPRKVGKGLVFGSLRDINGDKIQ--LVDSQALLKQSHVEDAVQIEGKLVQ--KRLKEDEK 114

Query: 237 VQFWNQLNLKSAATL 251
              + ++ L S  TL
Sbjct: 115 TPEY-EIQLTSLRTL 128

>ADR310W [2051] [Homologous to ScYDL040C (NAT1) - SH]
           complement(1248735..1251266) [2532 bp, 843 aa]
          Length = 843

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 248 AATLAKHMLLAKSPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIVEKNYE 303
           A  L++   LAK  GK+ E E Y+    L Y  D+ YK   ++ +K+  ++   YE
Sbjct: 181 AQLLSRFEELAK--GKLSEAEAYEHSECLMYKNDLLYKAAADDSAKLREVLAHLYE 234

>CAGL0C05313g 506270..508789 similar to sp|P12945 Saccharomyces
           cerevisiae YDL040c NAT1, start by similarity
          Length = 839

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 260 SPGKIDEFEFYKQVTALSYIGDVRYKLGGENPSKVTNIV 298
           + GKI E E Y+    L Y  D+ Y+  G N  K+  ++
Sbjct: 189 ASGKISEAEKYEHNECLMYKNDIMYRNAGSNADKLQKVL 227

>Sklu_2077.3 YML002W, Contig c2077 1119-4388
          Length = 1089

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 67  TDQALSEYANYRYKFKRLPANYGSNQLL---KIGREIDAELRGIMGH 110
           T   L EY N R ++KR  A+Y +  L    KIG   D E + I GH
Sbjct: 538 TINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGH 584

>Sklu_2077.2 YML003W, Contig c2077 1119-4388
          Length = 1089

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 67  TDQALSEYANYRYKFKRLPANYGSNQLL---KIGREIDAELRGIMGH 110
           T   L EY N R ++KR  A+Y +  L    KIG   D E + I GH
Sbjct: 538 TINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGH 584

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,602,968
Number of extensions: 494258
Number of successful extensions: 1318
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1336
Number of HSP's successfully gapped: 20
Length of query: 369
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 266
Effective length of database: 13,030,455
Effective search space: 3466101030
Effective search space used: 3466101030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)