Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR568C31530916230.0
KLLA0B08195g3302906614e-85
YOR292C3092396282e-80
Kwal_26.92183102586265e-80
Scas_665.293222515832e-73
CAGL0M11330g2962445681e-71
Scas_639.202081441547e-12
YLR251W1971381441e-10
Kwal_14.2632199901334e-09
AFR120C1821071253e-08
CAGL0B03465g2101071264e-08
KLLA0F22924g1951411239e-08
Sklu_1738.3200881175e-07
AFR488W36498671.6
Kwal_47.1657241843653.7
CAGL0M08008g138883637.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR568C
         (309 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)...   629   0.0  
KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyce...   259   4e-85
YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member...   246   2e-80
Kwal_26.9218                                                          245   5e-80
Scas_665.29                                                           229   2e-73
CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743 S...   223   1e-71
Scas_639.20                                                            64   7e-12
YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mp...    60   1e-10
Kwal_14.2632                                                           56   4e-09
AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [...    53   3e-08
CAGL0B03465g complement(343994..344626) highly similar to tr|Q06...    53   4e-08
KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomy...    52   9e-08
Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement         50   5e-07
AFR488W [3680] [Homologous to ScYBL013W (FMT1) - SH] complement(...    30   1.6  
Kwal_47.16572                                                          30   3.7  
CAGL0M08008g 795893..800059 similar to sp|P47104 Saccharomyces c...    29   7.3  

>AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)
           [948 bp, 315 aa]
          Length = 315

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MNVRVAVAAYGSKWCICGRVVAASAPPARMALPLGDEGRFREMLAQAGARAHRMHLLGVP 60
           MNVRVAVAAYGSKWCICGRVVAASAPPARMALPLGDEGRFREMLAQAGARAHRMHLLGVP
Sbjct: 1   MNVRVAVAAYGSKWCICGRVVAASAPPARMALPLGDEGRFREMLAQAGARAHRMHLLGVP 60

Query: 61  PTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASR 120
           PTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASR
Sbjct: 61  PTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASR 120

Query: 121 AGGPLAATRELLVQLRPQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEEEPRRFDF 180
           AGGPLAATRELLVQLRPQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEEEPRRFDF
Sbjct: 121 AGGPLAATRELLVQLRPQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEEEPRRFDF 180

Query: 181 YRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYS 240
           YRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYS
Sbjct: 181 YRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYS 240

Query: 241 NYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNI 300
           NYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNI
Sbjct: 241 NYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNI 300

Query: 301 FLSLRAASS 309
           FLSLRAASS
Sbjct: 301 FLSLRAASS 309

>KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyces
           cerevisiae YOR292c, start by similarity
          Length = 330

 Score =  259 bits (661), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 180/290 (62%), Gaps = 36/290 (12%)

Query: 53  RMHLLGVPPTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLA 112
           R  +L +   +W++    ++L+   T VYG LY+ S L+AT C+NVLLFG SDC AQ ++
Sbjct: 42  RFKILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCIS 101

Query: 113 CAATEASRAGGPL-----AATRELLVQLRPQPPVRLDEE--DELRAFSDYG---PRPESH 162
           C     S    P+       TR L+  L  +     D+   D +  F+DYG   P  E  
Sbjct: 102 CFL---SYKVDPVPEVVDKVTRNLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQ 158

Query: 163 M-TESEGVWVEEEPRR----------------------FDFYRWGCFMLWGPVMANFQVP 199
             T +    ++ E R                       F FYRW CFM WG  ++ FQVP
Sbjct: 159 TDTRNASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVP 218

Query: 200 WYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRV 259
           WY+ LNY YT+DPTVVQVLERVLSDQL+YSP+SLYCFF YSNY++E G  E+F +KI+ +
Sbjct: 219 WYKFLNYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNI 278

Query: 260 YVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLSLRAASS 309
           Y++TLGCNY VWPLVQF+NFL++PK LQVPFSSSVGVLWN FLS+R +S+
Sbjct: 279 YITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRNSSN 328

>YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member of
           the Mpv17 and PMP22 family, which are peroxisomal
           proteins, has moderate similarity to uncharacterized C.
           albicans Orf6.6217p [930 bp, 309 aa]
          Length = 309

 Score =  246 bits (628), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 121/239 (50%), Positives = 155/239 (64%), Gaps = 6/239 (2%)

Query: 77  LTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAAT-EASRAGGPLAATRELLVQL 135
            T  Y  LY  S + AT C+N+LLFG+SD  AQ +AC  +         L  T   +   
Sbjct: 71  FTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQILNDTFHHVQNN 130

Query: 136 RPQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEE-----EPRRFDFYRWGCFMLWG 190
           R        E DEL  F+D+     S+    +   ++      +   FDF+RWGCFM WG
Sbjct: 131 RDVENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDRPLATFKTDTFDFFRWGCFMFWG 190

Query: 191 PVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEE 250
             ++ FQ PWY+ LN+ YT+DPTVVQV ERVLSDQLLYSP+SLYCFF +SNYV+EGG ++
Sbjct: 191 FFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFSNYVMEGGDKD 250

Query: 251 TFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLSLRAASS 309
           T   KIQR+Y+STLGCNY VWP+VQF+NFL++P+  Q PFSSSVGV+WN FLS+R AS 
Sbjct: 251 TLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFLSMRNASK 309

>Kwal_26.9218
          Length = 310

 Score =  245 bits (626), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 167/258 (64%), Gaps = 8/258 (3%)

Query: 56  LLGVPPTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQG-LACA 114
           LL V   +W +    +ML+  +  VYG +Y+RS L  T C+N +LFG SD  AQ  L   
Sbjct: 52  LLHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYT 111

Query: 115 ATEASRAGGPLAATRELLVQLRP--QPPVRLDEEDELRAFSDYGP--RPESHMTESEGVW 170
                     L AT   LV             E D +  +++YGP    +S +   +   
Sbjct: 112 WDPVDPTPAALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSA- 170

Query: 171 VEEEPRRFDFYRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSP 230
             + P RFDF+RW CFM WG  ++ FQVPWY++LN+ YT+DPTVVQVLERVLSDQL+YSP
Sbjct: 171 --QHPPRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSP 228

Query: 231 LSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPF 290
           +SLYCFF YSNY+++ G   +F +KIQ+VY+ TLGCNY VWP VQF+NFLV+PK LQVPF
Sbjct: 229 ISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPF 288

Query: 291 SSSVGVLWNIFLSLRAAS 308
           SSSVGV+WN FLS+R AS
Sbjct: 289 SSSVGVVWNCFLSMRNAS 306

>Scas_665.29
          Length = 322

 Score =  229 bits (583), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 158/251 (62%), Gaps = 26/251 (10%)

Query: 78  TRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASRAGGPLA--------ATR 129
           T  Y  +Y ++ LVAT   N +LFG+SDC AQ + C  +      GPL           R
Sbjct: 72  TSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFS------GPLDPVPKIVDDTAR 125

Query: 130 ELLVQLRPQPPVRLD-----EEDELRAFSDYGPRP-ESHMTESEGVWVEEE------PRR 177
            ++ Q R      LD     E D L  F+DYG  P  S +   EG    EE         
Sbjct: 126 HIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGTTRTYL 185

Query: 178 FDFYRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFF 237
           F+F R+  FM WG  ++ FQVPWY++LN+ YT+DPTV+QVLERVLSDQL YSP+ LY FF
Sbjct: 186 FNFRRFFSFMFWGFFISFFQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSPVQLYFFF 245

Query: 238 WYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVL 297
            Y+NY++EGG  ETFA KI+ +Y+STLGCNY VWP VQF+NFL++PK  QVPFSSSVGVL
Sbjct: 246 MYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSSSVGVL 305

Query: 298 WNIFLSLRAAS 308
           WN FLS+R AS
Sbjct: 306 WNCFLSMRNAS 316

>CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743
           Saccharomyces cerevisiae YOR292c, hypothetical start
          Length = 296

 Score =  223 bits (568), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 158/244 (64%), Gaps = 20/244 (8%)

Query: 81  YGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASRAGGPLAATRELLVQ------ 134
           Y  LY+ + L+A+  SN +LFGLSD  AQ + C     SR   P+    +  VQ      
Sbjct: 58  YKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYF---SREMDPVPRIIDETVQNLIPYN 114

Query: 135 LRPQPP---------VRLDEEDELRAFSDYGPRPESHMTESEGVWVEEEPRRFDFYRWGC 185
           + P P          +  D +D L  F+DYG    S+  E E    E+    F F RW  
Sbjct: 115 VMPLPGGIFEANEELLDSDNDDNLSVFNDYGEYDNSN-DEIEYNHTEKVAT-FHFRRWLG 172

Query: 186 FMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIE 245
           FM WG  ++ FQVPWY +LN +YT+DPTVVQVLERVL+DQLLYSP+SLY FF YSNYVIE
Sbjct: 173 FMGWGGFISFFQVPWYIILNTIYTEDPTVVQVLERVLTDQLLYSPVSLYFFFMYSNYVIE 232

Query: 246 GGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLSLR 305
            G   TF++KI+R+YV+TLGCNY +WP++QF+NFLVIPK  QVPFSSSVGV+WN FLS+R
Sbjct: 233 QGDRYTFSMKIRRLYVTTLGCNYMIWPMMQFINFLVIPKHYQVPFSSSVGVVWNCFLSMR 292

Query: 306 AASS 309
            A+ 
Sbjct: 293 NAAK 296

>Scas_639.20
          Length = 208

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 77/144 (53%), Gaps = 7/144 (4%)

Query: 166 SEGVWVEEEPRRFDFYRWGCFMLWGPVMANF-QVPWYRLLNY-----LYTDDPTVVQVLE 219
            +G  +E++ + FD++R    +++G ++ +F    WY++L       L       + +L 
Sbjct: 45  KQGDEIEQKKKNFDWHRTSRAVIYGSMIFSFIGDKWYKILQNNVKLPLRFQHNKSLSMLY 104

Query: 220 RVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNF 279
           +V  DQL ++PL +  F++    ++EGGT +    KI+  +  TL  N+ VWPL Q +NF
Sbjct: 105 KVSVDQLAFAPLGV-PFYFSCMTIMEGGTMKDVETKIKTQWWRTLVTNWCVWPLFQMVNF 163

Query: 280 LVIPKSLQVPFSSSVGVLWNIFLS 303
             +P   ++   + V + WN +LS
Sbjct: 164 TWVPLQHRLLAVNVVAIFWNTYLS 187

>YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mpv17
           and PMP22 family, which are peroxisomal proteins, has
           low similarity to mouse Mpv17, which functions in
           peroxisomal reactive oxygen metabolism and is associated
           with glomerulosclerosis and inner ear defects [594 bp,
           197 aa]
          Length = 197

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 76/138 (55%), Gaps = 6/138 (4%)

Query: 176 RRFDFYRWGCFMLWGPVMANF-QVPWYRLLN-YLYTDDPTVVQ---VLERVLSDQLLYSP 230
           + +D+ R    +++G ++ +F    WY++LN  +Y  +        ++ RV  DQL ++P
Sbjct: 45  KGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAP 104

Query: 231 LSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPF 290
           L L  F++    ++EG + +   LKI+  +  TL  N+AVWPL Q +NF V+P   ++  
Sbjct: 105 LGL-PFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLA 163

Query: 291 SSSVGVLWNIFLSLRAAS 308
            + V + WN +LS + + 
Sbjct: 164 VNVVAIFWNTYLSYKNSK 181

>Kwal_14.2632
          Length = 199

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 220 RVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNF 279
           RV +DQLL++PL +  +F     ++EG + +    KI+ V+   L  N+ VWP VQ +NF
Sbjct: 95  RVGTDQLLFAPLCVPFYFGILT-LMEGKSPKHAENKIRNVWWDILKTNWMVWPAVQIINF 153

Query: 280 LVIPKSLQVPFSSSVGVLWNIFLSLRAASS 309
            ++P   ++   + V + WN FLS R + +
Sbjct: 154 SLVPVQHRLLAVNLVAIFWNTFLSFRNSEA 183

>AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [549
           bp, 182 aa]
          Length = 182

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 200 WYRLLNYLYTD---DPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKI 256
           WYR L+ +            VL RV  DQL+++P+ +   ++ +  ++EGG+ E   +++
Sbjct: 69  WYRFLSTVRLGRLPQAHWANVLARVACDQLIFAPIGV-PLYYTAMALMEGGSLEDVRIRL 127

Query: 257 QRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLS 303
              + STL  N+ VWP  Q  NF ++P   ++   + + + WN +LS
Sbjct: 128 SEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLLTVNVLSIFWNTYLS 174

>CAGL0B03465g complement(343994..344626) highly similar to tr|Q06563
           Saccharomyces cerevisiae YLR251w, hypothetical start
          Length = 210

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 200 WYRLLNYL-YTDDPTV--VQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKI 256
           WYR L  + +++ P      ++ RV  DQL ++PL L  F++    ++EG        KI
Sbjct: 83  WYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGL-PFYFGCMSLLEGHGLGAAREKI 141

Query: 257 QRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLS 303
           +  +  TL  N+ VWPL Q +NF ++P   ++  ++ V + WN FLS
Sbjct: 142 KLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVAIFWNTFLS 188

>KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomyces
           cerevisiae YLR251w, hypothetical start
          Length = 195

 Score = 52.0 bits (123), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 70/141 (49%), Gaps = 4/141 (2%)

Query: 172 EEEPRRFDFYRWGCFMLWGP-VMANFQVPWYRLLNYLYTDDPTV--VQVLERVLSDQLLY 228
           E++ +++D  R    +++G  + +     WY+ LN      P         RV  DQLL+
Sbjct: 41  EKKGQKYDLARTVRAVVYGSLIFSIIGDSWYKFLNQKVIVKPGKHWTNTAARVGCDQLLF 100

Query: 229 SPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQV 288
           +P+ +  ++   + ++EG +      KI+  +  TL  N+ VWP  Q +NF ++P   ++
Sbjct: 101 APVGIPMYYGVMS-ILEGKSLVDAKKKIEDNWWPTLVTNWYVWPAFQLINFSLVPVHHRL 159

Query: 289 PFSSSVGVLWNIFLSLRAASS 309
              + + + WN FLS + + S
Sbjct: 160 FSVNIISIFWNAFLSFKNSIS 180

>Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement
          Length = 200

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 220 RVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNF 279
           RV  DQL +SP+ +  +F     ++EG   +    +I   +  TL  N+AVWP  Q +NF
Sbjct: 96  RVGVDQLGFSPIGVPLYFGIMT-ILEGRNIDEARTRISDNWWPTLVTNWAVWPAFQLVNF 154

Query: 280 LVIPKSLQVPFSSSVGVLWNIFLSLRAA 307
            ++P S ++   + V + WN FLS + +
Sbjct: 155 SLVPLSHRLLAVNVVSIFWNTFLSYKNS 182

>AFR488W [3680] [Homologous to ScYBL013W (FMT1) - SH]
           complement(1314051..1315145) [1095 bp, 364 aa]
          Length = 364

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 40/98 (40%), Gaps = 20/98 (20%)

Query: 97  NVLLFGLSDCAAQGL-ACAATE--------------ASRAGGPLAATRELLV-----QLR 136
           NVL FG    +A  L A AA +              A R G  L ATREL V     +L 
Sbjct: 26  NVLFFGSDQFSAHSLRALAALQSGRIVGDIQLVTRPAKRCGRYLQATRELPVVAAARELA 85

Query: 137 PQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEEE 174
             PP+R D  D+L A     PR    +  S G  +  E
Sbjct: 86  LPPPLRCDTRDDLLALRARAPRTNLLVAVSYGQLIPAE 123

>Kwal_47.16572
          Length = 418

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 208 YTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEE 250
           +TDD T+ + L+  LS   L   +SLY F+ ++ +  +  TE+
Sbjct: 176 FTDDSTLTETLQS-LSKSPLKETISLYGFYCHAGHSYQSSTED 217

>CAGL0M08008g 795893..800059 similar to sp|P47104 Saccharomyces
            cerevisiae YJR033c RAV1, start by similarity
          Length = 1388

 Score = 28.9 bits (63), Expect = 7.3,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 210  DDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVSTLGCNYA 269
            +DP ++ +   + +  L Y   SL     Y  Y+I   TE           +  +GC+Y 
Sbjct: 1139 EDPALLFLYNHLRNRNLRYFLASLDLSNEYERYLILRATE----------ILCRMGCDYL 1188

Query: 270  VWPLVQFLNFLVIPK-SLQVPFS 291
               LV+  NF+  PK + ++PFS
Sbjct: 1189 AISLVKNWNFIDKPKVATKLPFS 1211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,643,659
Number of extensions: 392525
Number of successful extensions: 994
Number of sequences better than 10.0: 16
Number of HSP's gapped: 993
Number of HSP's successfully gapped: 18
Length of query: 309
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 208
Effective length of database: 13,099,691
Effective search space: 2724735728
Effective search space used: 2724735728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)