Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR567W1449142272610.0
Kwal_26.92071469144945270.0
YOR291W1472141143580.0
CAGL0M11308g1452143142800.0
KLLA0B08217g1439118041250.0
Scas_665.301439121241060.0
KLLA0E22352g12067678264e-91
CAGL0L01419g12147448239e-91
AFR354C12107668043e-88
YEL031W (SPF1)12157517742e-84
Scas_583.14*8755435713e-60
Kwal_14.14989398743301e-30
CAGL0A00517g11228413221e-29
KLLA0A08910g12808283168e-29
YGL006W (PMC1)11738183033e-27
AEL301W9577642908e-26
YGL167C (PMR1)9508622899e-26
KLLA0A03157g9387722782e-24
Scas_707.48*7417922719e-24
ADL079C11667892721e-23
Sklu_2193.111437142721e-23
CAGL0I04312g9518042711e-23
Kwal_23.578911337082551e-21
YIL048W (NEO1)11517812542e-21
AFL011W12428322523e-21
Scas_704.3811617052505e-21
KLLA0C08393g11487872495e-21
YDR039C (ENA2)10918432406e-20
YDR038C (ENA5)10918432398e-20
YDR040C (ENA1)10918412372e-19
CAGL0L00715g11447212362e-19
CAGL0J01870g9463012138e-17
Scas_499.33461831934e-15
ADR350W13113301994e-15
Kwal_47.1754712403051995e-15
KLLA0A04015g13438291995e-15
Kwal_26.707013153271871e-13
Scas_576.815913241842e-13
KLLA0E14630g10828371833e-13
AGL085C9096751824e-13
Kwal_23.316011003201791e-12
KLLA0C17644g15763181781e-12
CAGL0G06270g13283231782e-12
Scas_297.18001801682e-11
CAGL0L11814g15763241682e-11
YER166W (DNF1)15714231663e-11
YAL026C (DRS2)13552971645e-11
Scas_636.1615543221647e-11
AFL191W15752011647e-11
CAGL0H04477g16262501629e-11
Scas_710.419042601621e-10
Scas_89.12712081541e-10
AGR120C15474291612e-10
AGL097C10963211556e-10
CAGL0K12034g10873151557e-10
CAGL0G08085g15783191558e-10
YMR162C (DNF3)16562031549e-10
KLLA0A09031g8993201531e-09
KLLA0F20658g10823291512e-09
YGL008C (PMA1)9182641502e-09
YDR093W (DNF2)16123221503e-09
Scas_669.316381921423e-08
KLLA0E01650g15501991404e-08
Kwal_23.355615972011404e-08
Scas_688.19132921387e-08
YPL036W (PMA2)9473121332e-07
Kwal_47.175228993171305e-07
KLLA0D04092g11523481297e-07
CAGL0A00495g9023151181e-05
YBR295W (PCA1)12162331119e-05
CAGL0M08602g1012751111e-04
KLLA0F07447g9753251101e-04
Kwal_55.21575989491063e-04
Scas_569.0d468891020.001
Scas_615.994250980.003
YDR270W (CCC2)100450870.060
AGL041C123371840.16
ACR086C81048800.41
Scas_505.4102561761.1
Scas_666.2633568723.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR567W
         (1422 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  2801   0.0  
Kwal_26.9207                                                         1748   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  1683   0.0  
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  1653   0.0  
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  1593   0.0  
Scas_665.30                                                          1586   0.0  
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   322   4e-91
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   321   9e-91
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   314   3e-88
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   302   2e-84
Scas_583.14*                                                          224   3e-60
Kwal_14.1498                                                          131   1e-30
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   128   1e-29
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   126   8e-29
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   121   3e-27
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   116   8e-26
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   115   9e-26
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   111   2e-24
Scas_707.48*                                                          108   9e-24
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   109   1e-23
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         109   1e-23
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   108   1e-23
Kwal_23.5789                                                          102   1e-21
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   102   2e-21
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   101   3e-21
Scas_704.38                                                           100   5e-21
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   100   5e-21
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    97   6e-20
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    97   8e-20
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    96   2e-19
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    96   2e-19
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    87   8e-17
Scas_499.3                                                             79   4e-15
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    81   4e-15
Kwal_47.17547                                                          81   5e-15
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    81   5e-15
Kwal_26.7070                                                           77   1e-13
Scas_576.8                                                             75   2e-13
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    75   3e-13
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    75   4e-13
Kwal_23.3160                                                           74   1e-12
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    73   1e-12
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    73   2e-12
Scas_297.1                                                             69   2e-11
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    69   2e-11
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    69   3e-11
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    68   5e-11
Scas_636.16                                                            68   7e-11
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    68   7e-11
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    67   9e-11
Scas_710.41                                                            67   1e-10
Scas_89.1                                                              64   1e-10
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    67   2e-10
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    64   6e-10
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    64   7e-10
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    64   8e-10
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    64   9e-10
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    64   1e-09
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    63   2e-09
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    62   2e-09
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    62   3e-09
Scas_669.3                                                             59   3e-08
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    59   4e-08
Kwal_23.3556                                                           59   4e-08
Scas_688.1                                                             58   7e-08
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    56   2e-07
Kwal_47.17522                                                          55   5e-07
KLLA0D04092g complement(344666..348124) some similarities with s...    54   7e-07
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    50   1e-05
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    47   9e-05
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    47   1e-04
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    47   1e-04
Kwal_55.21575                                                          45   3e-04
Scas_569.0d                                                            44   0.001
Scas_615.9                                                             42   0.003
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    38   0.060
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    37   0.16 
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    35   0.41 
Scas_505.4                                                             34   1.1  
Scas_666.26                                                            32   3.0  

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 2801 bits (7261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1368/1422 (96%), Positives = 1368/1422 (96%)

Query: 1    MSFDSRNAGSFSSNNARFRAXXXXXXXXXXXXXXXXXXILEQRNSEAYAGASFEAVPSSI 60
            MSFDSRNAGSFSSNNARFRA                  ILEQRNSEAYAGASFEAVPSSI
Sbjct: 1    MSFDSRNAGSFSSNNARFRASFSSTKTTSSSNTMTSSTILEQRNSEAYAGASFEAVPSSI 60

Query: 61   VSFHHPHSYRSGAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQ 120
            VSFHHPHSYRSGAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQ
Sbjct: 61   VSFHHPHSYRSGAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQ 120

Query: 121  QLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGSVGRGPSSTRAQSI 180
            QLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGSVGRGPSSTRAQSI
Sbjct: 121  QLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGSVGRGPSSTRAQSI 180

Query: 181  QSYGAMDNHRGRAPYDGGSPRXXXXXXQYTFXXXXXXXXXXXXGSVELADDNISSGHSDA 240
            QSYGAMDNHRGRAPYDGGSPR      QYTF            GSVELADDNISSGHSDA
Sbjct: 181  QSYGAMDNHRGRAPYDGGSPRSSSSSSQYTFRERIPIEVEEEVGSVELADDNISSGHSDA 240

Query: 241  ESEDGLLNDDNRFTIDEVSEPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAE 300
            ESEDGLLNDDNRFTIDEVSEPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAE
Sbjct: 241  ESEDGLLNDDNRFTIDEVSEPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAE 300

Query: 301  EDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVV 360
            EDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVV
Sbjct: 301  EDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVV 360

Query: 361  ENQYSELSIINVKRIWYNRPLSTVLPLKRGLLNSRHYHHESEENPNIPILISFEYRYLTL 420
            ENQYSELSIINVKRIWYNRPLSTVLPLKRGLLNSRHYHHESEENPNIPILISFEYRYLTL
Sbjct: 361  ENQYSELSIINVKRIWYNRPLSTVLPLKRGLLNSRHYHHESEENPNIPILISFEYRYLTL 420

Query: 421  IYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFD 480
            IYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFD
Sbjct: 421  IYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFD 480

Query: 481  EALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCD 540
            EALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCD
Sbjct: 481  EALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCD 540

Query: 541  VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSK 600
            VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSK
Sbjct: 541  VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSK 600

Query: 601  VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTK 660
            VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTK
Sbjct: 601  VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTK 660

Query: 661  GSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDI 720
            GSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDI
Sbjct: 661  GSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDI 720

Query: 721  ITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLD 780
            ITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLD
Sbjct: 721  ITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLD 780

Query: 781  VLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVD 840
            VLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVD
Sbjct: 781  VLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVD 840

Query: 841  GELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR 900
            GELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR
Sbjct: 841  GELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR 900

Query: 901  FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD 960
            FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD
Sbjct: 901  FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD 960

Query: 961  YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK 1020
            YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK
Sbjct: 961  YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK 1020

Query: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN 1080
            ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN
Sbjct: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN 1080

Query: 1081 VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM 1140
            VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM
Sbjct: 1081 VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM 1140

Query: 1141 SPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEIS 1200
            SPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEIS
Sbjct: 1141 SPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEIS 1200

Query: 1201 CVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPL 1260
            CVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPL
Sbjct: 1201 CVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPL 1260

Query: 1261 AVFMSWSKPYEVLAKKRPTANLVSPKXXXXXXXXXXXXXXXXXXPWLAVQHMKWYRQPVV 1320
            AVFMSWSKPYEVLAKKRPTANLVSPK                  PWLAVQHMKWYRQPVV
Sbjct: 1261 AVFMSWSKPYEVLAKKRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMKWYRQPVV 1320

Query: 1321 GDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIM 1380
            GDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIM
Sbjct: 1321 GDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIM 1380

Query: 1381 FLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIPPA 1422
            FLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIPPA
Sbjct: 1381 FLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIPPA 1422

>Kwal_26.9207
          Length = 1469

 Score = 1748 bits (4527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 861/1449 (59%), Positives = 1077/1449 (74%), Gaps = 45/1449 (3%)

Query: 4    DSRNAGSFSSNNARFRAXXXXXXXXXXXXXXXXXXILEQRNSEAYAGASFEAVPSSIVSF 63
            D  + GS +  N+R R                   +++  ++EAYAGA+FE VPSSIVSF
Sbjct: 5    DLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSSIVSF 64

Query: 64   HHPHSYRSGAFGSVDMLERSR----RNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSE 119
            HHPHS+ +     ++    S     R+  +ES+L S  R   S  S+ PSR  +FR+FSE
Sbjct: 65   HHPHSFHTNGNSMLESASNSNELHSRSHEAESLLSS--RHSYSR-SQGPSRTPNFRYFSE 121

Query: 120  QQLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLRNGS------------ 167
            +++E AEG +STLE  DYD +WD TP YEQERLH +  S RSS+R+G+            
Sbjct: 122  EEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIRSGTGHSLSSYQSRSS 181

Query: 168  -----VGRGPSSTRAQSIQSYGAMDNHRGRAPYDGGSPRXXXXXXQYTFXXXXXXXXXXX 222
                   RG  ++R+ + QS    +N        G SP       +Y++           
Sbjct: 182  SRSGRSARGYGTSRSPTRQSQNRRENANQVF---GTSPHSSSSSSRYSYRDRVPAGIDDD 238

Query: 223  XGSVELADDNISSGHSDAESEDGLLNDDNRFTIDEVSEPQYVSGKKAYHAEYLKPRYHDR 282
             G    ++ +  SG SD    D   ++D   + D+ SE +      +YHAEYLKP+YHDR
Sbjct: 239  SGQSMHSEHSSESGDSDRRFLD---DEDRNSSQDQASETK--KKTSSYHAEYLKPQYHDR 293

Query: 283  FYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYK 342
            F+P+N+PHL  QRFYIAEED+VVGIAG+RTS +    Y +   +TLG+ Y+L +W+PRYK
Sbjct: 294  FFPQNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGLFYLLLRWVPRYK 353

Query: 343  VKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKR------GLLNS-R 395
            V+ CG KT L KAEWVVVEN++ ELSII V R WYNRPLST+L + +       + N  +
Sbjct: 354  VRLCGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKIADITEDIPNHHQ 413

Query: 396  HYHHESEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIH 455
             +HHES+ENPNIPI+ISF YRY  LIYSP+ D+F+ N+NW D DW  LS + +GLP ++ 
Sbjct: 414  RHHHESKENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSLSSIQKGLPTSVV 473

Query: 456  EDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVL 515
            EDRM+AFG+N+INL+QKT+ +ILFDE LHPFY+FQIFSI+LW+ D YYYYA CIFIIS+L
Sbjct: 474  EDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYYYYAACIFIISML 533

Query: 516  SVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPC 575
            S+IDTLVETK++S+RL+E+S  +C+VRVYRDGFW QV SS+LVPGD+YE++DPSLS  PC
Sbjct: 534  SIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPC 593

Query: 576  DSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKL 635
            DS+L+SGDC+VNESMLTGESVPVSK+ A+ ET+ QLL+DF  TQ+S+F++KSFLFNGTK+
Sbjct: 594  DSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKI 653

Query: 636  IRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFG 695
            IRVR    QS AL MV RTGFSTTKGSL+RSM+FPKP+GFKFYEDSFKYIG++++IAL G
Sbjct: 654  IRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAG 713

Query: 696  FAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPT 755
            F++S I F+RLGL  + MILRALDIIT+VVPPALPA+LSIG  FA+ RLKKKGIFCI+PT
Sbjct: 714  FSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPT 773

Query: 756  RVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPL-QQEMKISKLVTDVKDLLQSLSLSD 814
            RVNV GKIDVMCFDKTGTLTEDGLDVLGVHV +P   Q  +   L+T+V+ L    SL+D
Sbjct: 774  RVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLND 833

Query: 815  CVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYE 874
            C S  D K++NFLVSLLTCHSLR+VDGELLGDP DFKM QFT WS  E+  + K HSL E
Sbjct: 834  CGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNE 893

Query: 875  ERHDGSTMPENSRFAPAIVHP---SGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKP 931
            ER++ ST+PEN+  APA+VHP   S + +F E +P N++G++RSFEF+S LRRMSVIVKP
Sbjct: 894  ERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKP 953

Query: 932  FSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYS 991
            + ENVF  FTKGAPEVI E+C+K TLP +YE +L  YTHNGYRVIACAGK L +++W ++
Sbjct: 954  YGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFA 1013

Query: 992  QKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREA 1051
            QKVSREE+ESN+EFLGF++FENKLK +T  TL SL  A IR+IMCTGDNVLTAISVGRE+
Sbjct: 1014 QKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRES 1073

Query: 1052 GLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEV 1111
            GL+    VFV  IND +     D+I W++V +    LD VTL P++G + DYT+AVTG+V
Sbjct: 1074 GLITESHVFVPQIND-NMDPNEDLIIWRDVDDCDLILDGVTLEPMNG-SSDYTIAVTGDV 1131

Query: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGA 1171
            FRLLFK ++   E  IN +LLK+SIYARMSPDEKHELV +LQ + Y VGFCGDGANDCGA
Sbjct: 1132 FRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGA 1191

Query: 1172 LKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQF 1231
            LKAAD+G+SLSEAEASVAAPFTS +FEISC+LDV+KEGRA+L TSF+CFQYMSLYSA QF
Sbjct: 1192 LKAADVGVSLSEAEASVAAPFTSSVFEISCILDVIKEGRASLTTSFSCFQYMSLYSAIQF 1251

Query: 1232 VTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTANLVSPKXXXXX 1291
            VT+ +LYSRG NLGDFQFLYIDLFLIVP+A+FMSWSKPY  L KKRP+ANLVSPK     
Sbjct: 1252 VTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRPSANLVSPKILAPL 1311

Query: 1292 XXXXXXXXXXXXXPWLAVQHMKWYRQPVVGDDEHVASSDNTILFFVSNFQYILVAVVLSV 1351
                         PWL VQ M+WY+ PVVG D+ V SSDNT+LFF SNFQY+L A+VLSV
Sbjct: 1312 VANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSV 1371

Query: 1352 GPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGWVFL 1411
            GPPYREPMSKN+GFI DV++S++ +  +M +  DSTLG++FQLT+ S  F   ++ W  L
Sbjct: 1372 GPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLGKVFQLTDISSGFKGYLLIWAVL 1431

Query: 1412 NYYAQLYIP 1420
            NY+AQLYIP
Sbjct: 1432 NYFAQLYIP 1440

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 1683 bits (4358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 848/1411 (60%), Positives = 1029/1411 (72%), Gaps = 35/1411 (2%)

Query: 39   ILEQRNSEAYAGASFEAVPSSIVSFHHPHSYRSGAF----GSVDMLERSRRNTGSESVLL 94
            +L+Q NSE YAGA+FEAVPSSIVSFHHPHS++S        S ++ +R RR T SE ++L
Sbjct: 43   VLDQNNSEPYAGATFEAVPSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVL 102

Query: 95   SPVRSRTSEISRTPSRATHFRFFSEQQLENAEGAASTLEYTDYDTDWDATPAYEQERLHM 154
            S    ++   SR PS   HFRFF+++Q+ NAEGA STLE TDYD  WDATPAYEQ+R++ 
Sbjct: 103  S-SAEQSRSSSRNPS---HFRFFTQEQISNAEGA-STLENTDYDMAWDATPAYEQDRIYG 157

Query: 155  NPRSSRSSLRNGSVGRGPSSTRAQSIQSYGAMDNHRGRAPYDGGSPRXXXXXXQYTFXXX 214
               SSR S           S  A+S  S+        RAP   G                
Sbjct: 158  TGLSSRRSSIRSFSRASSLSN-AKSYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSS 216

Query: 215  XXXXXXXXXGSVELA-DDNISSGHSDAESEDGLLNDDNRFTIDEVSEPQYVSGKKAY--H 271
                       + +  +        D  S   L + D+R +  E +   +      +  H
Sbjct: 217  SSLSRYTTRERIPIELESQTDEILEDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQH 276

Query: 272  AEYLKPRYHDRFYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGML 331
            +EYLKP YH++FYP+  P+LH QRFYIAEED+V+GIA Y+TS +   IYN+ C LT G++
Sbjct: 277  SEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLV 336

Query: 332  YILCKWIPRYKVKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKR-- 389
            Y+L +W+P  KVK  G K  L KAEWVV+EN++ E  I  + R WYNRPLSTVLP +   
Sbjct: 337  YLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYP 396

Query: 390  ------GLLNSRHYHHESEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTDL 443
                    +N  H HH +E NPN+PILI+FEYRY+  IYSPL D+F+TN NW DPDW DL
Sbjct: 397  NPSYEPNDINLSH-HHANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDL 455

Query: 444  SLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYY 503
            S VS GL   + EDR +AFGKN INLR KTTS+ILF+E LHPFY+FQ+FSIILW  D YY
Sbjct: 456  STVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYY 515

Query: 504  YYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIY 563
            YYA CIF+ISVLS+ D+L E K+ S  L+E+S F+CDVRV RD FW+ + SS+LVPGDIY
Sbjct: 516  YYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIY 575

Query: 564  ELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623
            E++DP++++LPCDSIL+S DC+VNESMLTGESVPVSK  AT ETM QL DDF  TQ+SSF
Sbjct: 576  EVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSF 635

Query: 624  VSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFK 683
            VSKSFL+NGT +IR R   GQ+ AL MV RTGFSTTKGSLVRSMVFPKPTGFKFY DSFK
Sbjct: 636  VSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFK 695

Query: 684  YIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNR 743
            YIG++S+IA+FGF VS +QF++LGLDK+TMILRALDIIT+VVPPALPA+L+IGT FAL+R
Sbjct: 696  YIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSR 755

Query: 744  LKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQ-QEMKISKLVTD 802
            LK+KGIFCISPTR+N+ GKIDVMCFDKTGTLTEDGLDVLGV + +P   +  K  +L++D
Sbjct: 756  LKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSD 815

Query: 803  VKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEE 862
            ++ +    SL+DC S  D K++NF +SLLTCHSLR VDG LLGDP DFKM QFT WS EE
Sbjct: 816  IRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEE 875

Query: 863  ETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR---FIEREPSNVIGIVRSFEFL 919
            +   R  HSLYE RH+    PENS   PA+VHP    R   F + +P N +G+VRSFEFL
Sbjct: 876  DFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFL 935

Query: 920  SNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACA 979
            S LRRMSVIVK  +++V+ SFTKGAPEVI E+C+K TLP D+E +L  YTHNGYRVIACA
Sbjct: 936  SELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACA 995

Query: 980  GKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGD 1039
            GK L +++WLYSQKVSREE+ESNLEFLGFIIF+NKLK  T ETL+SL  A+IRTIMCTGD
Sbjct: 996  GKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGD 1055

Query: 1040 NVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGD 1099
            N+LTAISVGREAGL++  RV+V  IND     E  +I W++V      LD+ TL+P+   
Sbjct: 1056 NILTAISVGREAGLIQCSRVYVPSINDTPLHGE-PVIVWRDVNEPDKILDTKTLKPVKLG 1114

Query: 1100 TD--------DYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVER 1151
             +        +YTLAV+G+VFRLLF+ +    EE +N ILL +SIYARMSPDEKHEL+ +
Sbjct: 1115 NNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQ 1174

Query: 1152 LQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRA 1211
            LQ + Y VGFCGDGANDCGALKAAD+GISLSEAEASVAAPFTS++F ISCVLDV++EGRA
Sbjct: 1175 LQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRA 1234

Query: 1212 ALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYE 1271
            ALVTSFACFQYMSLYSA QF+TI ILYSRGSNLGDFQFLYIDL LIVP+A+ MSWSK YE
Sbjct: 1235 ALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYE 1294

Query: 1272 VLAKKRPTANLVSPKXXXXXXXXXXXXXXXXXXPWLAVQHMKWYRQPVVGDDEHVASSDN 1331
             + KKRP+ANLVSPK                  PW+ VQ M WY +P+VG D+ V SSDN
Sbjct: 1295 KIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDN 1354

Query: 1332 TILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRL 1391
            T+LFFVSNFQYIL A+VLSVGPPYREPMSKN  FI D+ VS+ AS  +M L  +S LG++
Sbjct: 1355 TVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGKM 1414

Query: 1392 FQLTEASHPFCLLIIGWVFLNYYAQLYIPPA 1422
             QLT  S+ F + II WV LNYYAQLYIPP+
Sbjct: 1415 LQLTPISNSFTMFIIVWVILNYYAQLYIPPS 1445

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 1653 bits (4280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 824/1431 (57%), Positives = 1032/1431 (72%), Gaps = 36/1431 (2%)

Query: 12   SSNNARFRAXXXXXXXXXXXXXXXXXXILEQRNSEAYAGASFEAVPSSIVSFHHPHSYRS 71
            SS+  R RA                  I++  NSE+YAGA+FEAVPSSIVSFH PHS++S
Sbjct: 9    SSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQS 68

Query: 72   ----GAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQQLENAEG 127
                G+  + +MLER+   TG  ++  +    + ++ SR+ S   +FRFF+++Q+  AEG
Sbjct: 69   SHMMGSSLNSNMLERT---TG--AIHETEPLYQGNDHSRSSSNNRNFRFFTDEQVSQAEG 123

Query: 128  AASTLEYTDYDTDWDATPAYEQE-RLHMNPRSSRSSLRNGSVGRGPSSTRAQSIQSYGAM 186
             A TLE TDYD DWDA PAYEQE R      S RSS+R+       S   + S   YG++
Sbjct: 124  IA-TLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRD------ISRRSSLSTSPYGSI 176

Query: 187  DNHRGRAPYDGGSPRXXXXXXQYTFXXXXXXXXXXXXG---SVELADDNISSGHSDAESE 243
            D HRGR+      PR        T                  VE  DDN    HS  +S 
Sbjct: 177  D-HRGRSA-SKSRPRYDQVYQTSTHSSSSLSRYSVRERIPVEVEDQDDNSLDVHSSDQSL 234

Query: 244  DGLLNDDNRFTIDEVS---EPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAE 300
                ++ + +  +E S          K   H E+LKP+YHD+FYP      H+QR YI+E
Sbjct: 235  ASSHSNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISE 294

Query: 301  EDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVV 360
            EDMV+ IAGY+TS + + +YN+ C  TLG L+++ KW+P+YKV+  G K  L KAEW+V+
Sbjct: 295  EDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVL 354

Query: 361  ENQYSELSIINVKRIWYNRPLSTVLPLKRGLLNS------RHYHHESEENPNIPILISFE 414
            EN++ E +I    R WYNR LST+L L             + +HH SEENPN+PILISF+
Sbjct: 355  ENEHGEFTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHHTSEENPNLPILISFQ 414

Query: 415  YRYLTLIYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTT 474
            YRY+  +YSPL DIF+TN NW D DW DL   S+GL + I EDR++AF KN INL+ KTT
Sbjct: 415  YRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTT 474

Query: 475  SQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSEL 534
            SQILFDE LHPFYIFQ+ SIILW  D YYYYA CIF+IS+LS++DTL+ETK+ S  L+E+
Sbjct: 475  SQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEM 534

Query: 535  SQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGE 594
            S F C+VRV R+GFWS + SS+LVPGDIYE++DP+L+LLPCDSIL+SGDC+VNESMLTGE
Sbjct: 535  SHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGE 594

Query: 595  SVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVART 654
            SVPVSK  A+ ET+LQL DDF  TQ+S+F+SKSFLFNGT LIR +   G S+AL M  RT
Sbjct: 595  SVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRT 654

Query: 655  GFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMI 714
            GFSTTKGSL+RSMVFPKP+GFKFY DSFKYIG+++IIA FGF++S I F++LGLDKRTMI
Sbjct: 655  GFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMI 714

Query: 715  LRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTL 774
            LRALDIIT+VVPPALPA+L+IGT FALNRLK+KGIFCI+PTRVN+GGKIDVMCFDKTGTL
Sbjct: 715  LRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTL 774

Query: 775  TEDGLDVLGVHV-VQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTC 833
            TEDGLDVLGV V     + +   S L++D  D+    SL DC +  D K +NFL+SLLTC
Sbjct: 775  TEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTC 834

Query: 834  HSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIV 893
            HSLR+VDGELLGDP DFKM QFT WS EE+  N + HSLYEERH+G   PEN+   PAIV
Sbjct: 835  HSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIV 894

Query: 894  HPSG---KGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFE 950
            HP+    + +F++ +P+N++GI+RSFEFLS LRRMSVIVKP +ENV+ ++TKGAPEVI +
Sbjct: 895  HPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIID 954

Query: 951  LCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFII 1010
            +C+  TLP DY+ +L+ YTH+GYRVIACAGK L + +WLYSQKV REE+ESN+EFLGFII
Sbjct: 955  ICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFII 1014

Query: 1011 FENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTS 1070
            F+NKLK  T  TL  L  A+IRT+MCTGDNVLTAISVG+E  L+   RV+V  +   D +
Sbjct: 1015 FQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMT 1074

Query: 1071 QEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNI 1130
             +  +I W  ++N+   LD+ TL+P+   +  YTLA+TGEVFR++F    +  EE +N I
Sbjct: 1075 VQ-PVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEI 1133

Query: 1131 LLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAA 1190
            LLK SI+ARMSPDEKHELVE+LQ + Y VGFCGDGANDCGALKAAD+GISLSEAEASVAA
Sbjct: 1134 LLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1193

Query: 1191 PFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFL 1250
            PFTS++F+I+CVLDV+KEGRA+LVTSFACFQYMSLYSA QF++I ILYSRGSNLGDFQFL
Sbjct: 1194 PFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFL 1253

Query: 1251 YIDLFLIVPLAVFMSWSKPYEVLAKKRPTANLVSPKXXXXXXXXXXXXXXXXXXPWLAVQ 1310
            YIDL LI+P+AV MSWSKPY  LAKKRP+ANLVSPK                  PW+ +Q
Sbjct: 1254 YIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQ 1313

Query: 1311 HMKWYRQPVVGDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVL 1370
               WY +P+VG D+ V SSDNT+LF++SNFQYIL +VVLS+GPPYREP+  NV ++ D+ 
Sbjct: 1314 GRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIA 1373

Query: 1371 VSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIPP 1421
            +S++ S  IM ++PDS LG L QLT       +LI  W  LNYY   ++PP
Sbjct: 1374 LSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPP 1424

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 1593 bits (4125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/1180 (64%), Positives = 934/1180 (79%), Gaps = 22/1180 (1%)

Query: 248  NDDNRFTIDEVSEPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAEEDMVVGI 307
            NDD     +E  E      KK+YH+E+LKP+YH RF+P NVP+LH QRFYIAEED+VV I
Sbjct: 246  NDDYNSRAEEDQE----QNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAI 301

Query: 308  AGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVVENQYSEL 367
            AGYRTS ++   Y + C +TLG+ +++ +W P  +VK  G KT LGKAEWVVVEN++ EL
Sbjct: 302  AGYRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGEL 361

Query: 368  SIINVKRIWYNRPLSTVL----PLKRGLLNSRHYHH-ESEENPNIPILISFEYRYLTLIY 422
            ++ +VKR WYNRPLSTVL      + G   SRHYHH E+E NPN+PILISF+YRY TL+Y
Sbjct: 362  TVESVKRRWYNRPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPILISFQYRYFTLVY 421

Query: 423  SPLTDIFQTNTNWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEA 482
            SP+ DIF++N+NWADPDW DL +V  GL ++I EDR +AFGKNS+NL+QKT ++ILFDEA
Sbjct: 422  SPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEA 481

Query: 483  LHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVR 542
            LHPFY+FQIFSIILW+ D YYYYA CIF+ISVLS+IDT++ETK++SE+L+++S F C+VR
Sbjct: 482  LHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVR 541

Query: 543  VYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVA 602
            VY+D FW+QV SSDLVPGD++E++DPSL +LPCD++LISGDC+VNESMLTGESVPVSK A
Sbjct: 542  VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYA 601

Query: 603  ATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGS 662
            AT  TM QLL DF  +Q+SSFVSKSFLFNGTK+IRVR   GQ +AL +V RTGFSTTKGS
Sbjct: 602  ATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGS 661

Query: 663  LVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIIT 722
            LVRSMVFPKP GFKFYEDSFKYIG++++IA+FGF++S IQF+RLGL+ + MILRALDIIT
Sbjct: 662  LVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIIT 721

Query: 723  VVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVL 782
            +VVPPALPA+L+IGT FAL RLKKKGIFCISPTRVNVGGK+D+MCFDKTGTLTE+GLDVL
Sbjct: 722  IVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVL 781

Query: 783  GVHVVQPLQQE--MKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVD 840
            G+H  +P      +++S L+TD  ++LQ  +LSDC S  + KAKNFLVSLLTCHSL+ +D
Sbjct: 782  GIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHID 841

Query: 841  GELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR 900
            GELLGDP D KM +FTKW+ EE   + K  +            + +  +PA+VHP+    
Sbjct: 842  GELLGDPLDLKMFEFTKWAYEEGYESWKFKN----------AEDKTGISPAVVHPTSNCN 891

Query: 901  FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD 960
            FIE +P N+IG++RSFEFLS LRRMSVIVK F EN + SFTKGAPEVI ++C+  T+P D
Sbjct: 892  FIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKD 951

Query: 961  YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK 1020
            +  LLHHYTHNG+R+IACAGK L + SWLYSQKVSREE+E NLEFLGFI+FENKLK  TK
Sbjct: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTK 1011

Query: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN 1080
              L+ L  A+IRT+MCTGDNVLTA+SVGR++GL+ S RVF+  +ND +  +   +++W++
Sbjct: 1012 AALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLND-NLEESRHLLSWRD 1070

Query: 1081 VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM 1140
            V      LD+VTL+PL+     YTLA+TG++FR+LF+ D+   ++ I+ +L+K SIYARM
Sbjct: 1071 VDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARM 1130

Query: 1141 SPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEIS 1200
            SPDEKHELVE+LQ + Y VGFCGDGANDCGALKAA+IGISLSEAEASVAAPFTS +F+IS
Sbjct: 1131 SPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDIS 1190

Query: 1201 CVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPL 1260
            CVLDV+KEGRA+LVTSF+CFQYMSLYSA QF+TI ILYSRGSNLGDFQFLYIDL LIVP+
Sbjct: 1191 CVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPI 1250

Query: 1261 AVFMSWSKPYEVLAKKRPTANLVSPKXXXXXXXXXXXXXXXXXXPWLAVQHMKWYRQPVV 1320
            A+ MSWSKP   L KKRP+ANLVSPK                  PW+AVQ+  WY +PVV
Sbjct: 1251 AISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVV 1310

Query: 1321 GDDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIM 1380
            G D+ V SSDNT+LFFVSNFQYIL AVVLS GPPYREPM KN+GFI D+ +S++ S  +M
Sbjct: 1311 GGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLM 1370

Query: 1381 FLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYAQLYIP 1420
            +L+  + LG L QLT  S  F  LI+     NYYA  YIP
Sbjct: 1371 YLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIP 1410

>Scas_665.30
          Length = 1439

 Score = 1586 bits (4106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/1212 (62%), Positives = 951/1212 (78%), Gaps = 21/1212 (1%)

Query: 229  ADDNISSGHSDAESEDGLLNDDNRFTIDEVS--EPQYVSGKKAYHAEYLKPRYHDRFYPR 286
            ++++  +G S   ++D   N+ N  + ++      +  +    Y  EYLKP+YH++FYP 
Sbjct: 3    SEESSDNGRSTYNNDDLNANNGNNLSTEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFYPS 62

Query: 287  NVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGMLYILCKWIPRYKVKFC 346
            NV  L+ QRFYI EED+VVGIAGY TS +K  IYN  C ++ G+LY+L +W+P YKVK  
Sbjct: 63   NVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVKLI 122

Query: 347  GSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKRGL-----LNSRHYHHE- 400
            G+K  LGKAEWVV+EN++ E SI  +KR WYNRP+ST+LPL         +N   Y H  
Sbjct: 123  GTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDDPFQEIDGINDESYQHRH 182

Query: 401  ------SEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTDLSLVSRGLPNNI 454
                  +E+NPNIPILI+F+YRY+T IYSP+ DIF+TN NW DPDW DLS   RGL + +
Sbjct: 183  HHYHHVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSSGV 242

Query: 455  HEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISV 514
             EDR++AF  N INLR KT +++LF+E LHPFY+FQIFSIILW  D YYYYA CIF+IS+
Sbjct: 243  QEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISI 302

Query: 515  LSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLP 574
            LS++DTLVET+++ + L+++S F C+VRV+RD FW+ V S+DLVPGDIYE++DPSL++ P
Sbjct: 303  LSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFP 362

Query: 575  CDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTK 634
            CDS+L+SGDC+VNESMLTGESVPVSK  A  ETMLQLLDDF +TQ+SS++SKSFLFNGT 
Sbjct: 363  CDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTT 422

Query: 635  LIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALF 694
            +IR R   GQS AL MV RTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIG +++IALF
Sbjct: 423  IIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALF 482

Query: 695  GFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISP 754
            GF++S IQF+++GLDKRTMILRALDIIT+VVPPALPA+L+IGTGFAL+RLKKKGIFCISP
Sbjct: 483  GFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISP 542

Query: 755  TRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQP-LQQEMKISKLVTDVKDLLQSLSLS 813
            TRVN+GGKID++CFDKTGTLTE+GLDVLGV +  P      + + LV DV  L    SL+
Sbjct: 543  TRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLN 602

Query: 814  DCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLY 873
            DC S RD +AKNF +SLLTCHSLR+VD EL+GDP DFKM QFTKWS EE+   ++ HS Y
Sbjct: 603  DCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTY 662

Query: 874  EERHDGSTMPENSRFAPAIVHPSG---KGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVK 930
            EER   + +PEN    PA+VHP+    +  FI+ +P N +GI+RSFEFLS LRRMSVIVK
Sbjct: 663  EERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVK 722

Query: 931  PFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLY 990
            P +E+V+ +FTKGAPEVI ++C+K TLP ++E +L++YTH GYRVIACAG+ L R +WLY
Sbjct: 723  PSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLY 782

Query: 991  SQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGRE 1050
            SQKVSREE+ESN+EFLGFIIFENKLK  T +TL++L  A IRT+MCTGDNVLTAISVGR+
Sbjct: 783  SQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQ 842

Query: 1051 AGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTD-DYTLAVTG 1109
              L++S +V+V  + +ID++ +  II W++V N  DTLDS TL P++  +   YTLA+TG
Sbjct: 843  CNLIKSKKVYVPSLEEIDSTGQTSII-WRDVDNMDDTLDSRTLLPINNSSSTSYTLAITG 901

Query: 1110 EVFRLLFKTDKSQI-EEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGAND 1168
            ++FR++F  + + I E+ IN +LLK +IYARMSPDEKHEL+E+LQ + Y VGFCGDGAND
Sbjct: 902  DIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGAND 961

Query: 1169 CGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSA 1228
            CGALKAAD+GISLSEAEASVAAPFTS++F+ISCVLDV+KEGRA LVTSF+CFQYMSLYSA
Sbjct: 962  CGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSA 1021

Query: 1229 TQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTANLVSPKXX 1288
             QF+TI +LYSRGSNLGDFQFLYIDL LIVP+A+FMSWSKPY+ + KKRP+ANLVSPK  
Sbjct: 1022 IQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKIL 1081

Query: 1289 XXXXXXXXXXXXXXXXPWLAVQHMKWYRQPVVGDDEHVASSDNTILFFVSNFQYILVAVV 1348
                            PW+ VQ  +WY +P+VG D+ V SSDNTILFF+SNFQYIL AV+
Sbjct: 1082 IPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAVI 1141

Query: 1349 LSVGPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGW 1408
            LSVGPPYREPMS+N+GFI DV++S+V S  +MF+   S LG+ FQLTE S  F L I+ W
Sbjct: 1142 LSVGPPYREPMSRNIGFIVDVIISIVLSIWLMFIDSSSFLGKKFQLTEISFKFKLFILIW 1201

Query: 1409 VFLNYYAQLYIP 1420
            V +NY+ QLY+P
Sbjct: 1202 VVINYFVQLYVP 1213

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 86/145 (59%), Gaps = 6/145 (4%)

Query: 42   QRNSEAYAGASFEAVPSSIVSFHHPHSYR-SGAFG-SVDMLERSRRNTGSESVLLSPVRS 99
            Q N+E Y+G +FE VPSSIVSFHHP S++ S  FG SV      RR   +E ++ S   S
Sbjct: 1299 QPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRGRDTEPLITSHSPS 1358

Query: 100  RTSEISRTPSRATHFRFFSEQQLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSS 159
                   +      F FF+E Q+ NAEG  STLE TDY+T WDATP+YEQERL+    S+
Sbjct: 1359 PIRRSRSSSRNP-QFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERLYGT--SN 1414

Query: 160  RSSLRNGSVGRGPSSTRAQSIQSYG 184
            R+S R+   G  P S+ + +   YG
Sbjct: 1415 RTSRRSSIYGMSPRSSISHTRSQYG 1439

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score =  322 bits (826), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 233/767 (30%), Positives = 376/767 (49%), Gaps = 129/767 (16%)

Query: 447  SRGLPNNI-HEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYY 505
            S+GL  ++ H  R+  +G+NS ++   T  ++  + A+ PF+IFQ+F + LW+FD  +YY
Sbjct: 162  SKGLNGDLTHHKRL--YGENSFDIPIPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYY 219

Query: 506  ATC-IFIISVLSVIDTLVETKQSSERLSELSQFYC------DVRVYRDGFWSQVPSSDLV 558
            +   +F+I  +       E     +RL+ L +F         + V+RDG W ++ +  L 
Sbjct: 220  SLFNLFMIVAM-------EATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLF 272

Query: 559  PGDIYELTDPSL-SLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMD 617
            P D+  +T  +  S +PCD +LI G C+VNE+ML+GES P+ K        L+  +D + 
Sbjct: 273  PMDLVSITRTAEDSAIPCDLLLIDGSCIVNEAMLSGESTPLLK----ESIKLRPANDQL- 327

Query: 618  TQLSSFVSKSFLFNGTKLIRVRA--------TAGQSIALGMVARTGFSTTKGSLVRSMVF 669
             QL      + L  GTK ++V A        T     AL +V +TGF T++GSLVR M+F
Sbjct: 328  -QLDGVDKNAVLHGGTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIF 386

Query: 670  PKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPAL 729
                     +++  +I ++ I A+      + +  R+G  +  +IL  + IIT VVPP L
Sbjct: 387  SAERVDVGNKEALYFILFLLIFAIVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPEL 446

Query: 730  PASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQP 789
            P  L++    +L  L K  ++C  P R+   G+IDV CFDKTGTLT + L   G+     
Sbjct: 447  PMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVFEGLA---- 502

Query: 790  LQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKN-----FLVSLLTCHSL-RMVDGEL 843
                                  L D    R +K+ N      L ++   H+L ++ DGE+
Sbjct: 503  ---------------------GLHDGSDIRTLKSANDASQEVLSAIGAAHALVKLDDGEI 541

Query: 844  LGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIE 903
            +GDP +   ++ + W+ + +                                      ++
Sbjct: 542  VGDPMEKATLKASSWTVDFKD------------------------------------VVK 565

Query: 904  REPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEA 963
            R  ++ I I+R F+F S+L+R + I      N F +  KGAPE I E  +  ++P DY+ 
Sbjct: 566  RAGADNIRILRRFQFSSSLKRSASIAS--QSNRFFAAVKGAPETIRERLN--SVPSDYDD 621

Query: 964  LLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETL 1023
            +   +T +G RV+A A K L + S      + R+EIE+ L F  F++F   LK    ET+
Sbjct: 622  IYKSFTRSGSRVLALAYKDLPKMSNSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETI 681

Query: 1024 ESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVAN 1083
            + L+ +  R+IM TGDN LTA+ V +E G+V+   + +     ID S    ++       
Sbjct: 682  KMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILD--EPIDGSSHALVMR------ 733

Query: 1084 SSDTLDSVTLRPLSGDTD---------DYTLAVTGEVFRLLFKTDKSQIEEVINNILLKT 1134
                ++   ++P + D D          Y LAVTG   +LL      Q  + + +++  T
Sbjct: 734  ---DVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLL------QGHKQLRDVIRHT 784

Query: 1135 SIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISL 1181
             IYAR+SP +K  ++  L+ +GYQ   CGDG ND GALK A +GI+L
Sbjct: 785  WIYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 831

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 10/240 (4%)

Query: 1180 SLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYS 1239
            SL   +AS AAPFTS+L  ++ V +++++GR AL+ +   ++ ++L       ++ ++Y 
Sbjct: 949  SLKLGDASCAAPFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYL 1008

Query: 1240 RGSNLGDFQFLYIDLFLIVPLAVFMSWS--KPYEVLAKKRPTANLVSPKXXXXXXXXXXX 1297
             G   GD Q     L L V    F+S S  KP E L+K+RP   + +             
Sbjct: 1009 AGVKFGDGQATVSGLLLSV---CFLSISRGKPLEKLSKERPQPGIFNIYIMGSILGQFAV 1065

Query: 1298 XXXXXXXPWLAVQHMKWYRQPVVG-DDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYR 1356
                       +  ++  R+P V  + E V S  NT +F V   Q +   VV   G P+R
Sbjct: 1066 HILTLVYITTEIYKIE-PREPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPFR 1124

Query: 1357 EPMSKNVG-FIADVLVSLVASCRIMFLSPDSTLGRLFQLTEASHPFCLLIIGWVFLNYYA 1415
            E +  N G +   V VS++A C      P+  L    +       F + + G + L+++ 
Sbjct: 1125 ENIKNNKGMYYGIVGVSVLALCGSTEFIPE--LNAAMKFVPMDDIFKMKLTGTLLLDFFG 1182

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score =  321 bits (823), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 224/744 (30%), Positives = 367/744 (49%), Gaps = 111/744 (14%)

Query: 462  FGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTL 521
            +G N  ++   T  ++  + A+ P ++FQ+F + LW+ D Y+Y  +   +  +LS+    
Sbjct: 175  YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYL-SLFNLFMILSM---- 229

Query: 522  VETKQSSERLSELSQFYC------DVRVYRDGFWSQVPSSDLVPGDIYELTDPSL-SLLP 574
             E     +RL+ L +F         + V RDG W ++ +++L+P D+  +   +  S LP
Sbjct: 230  -EAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALP 288

Query: 575  CDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTK 634
            CD IL+ G C+VNE+ML+GES P+ K +      ++L     + Q+      S L  GTK
Sbjct: 289  CDLILVDGTCIVNEAMLSGESTPLLKES------IRLRPGNEELQIEGTDKISVLHGGTK 342

Query: 635  LIRVRA--------TAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIG 686
            +++V          +     A+ +V +TGF T++GSLVR M++         +++  +I 
Sbjct: 343  VLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFIL 402

Query: 687  YISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKK 746
            ++ I A+      +++  ++G  +  +IL  + IIT VVPP LP  L++    +L+ L K
Sbjct: 403  FLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSK 462

Query: 747  KGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDL 806
              ++C  P R+   G+IDV CFDKTGTLT + L   G            ++ L +D KD+
Sbjct: 463  FYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEG------------LAGLSSDPKDI 510

Query: 807  LQSLSLSDCVSTRDMKAKNFLVSLLTCHSL-RMVDGELLGDPFDFKMVQFTKWSDEEETG 865
                S +DC ++  +            H+L R+ DGE++GDP +   ++  KW+ E    
Sbjct: 511  RHLYSATDCPNSTSLVVG-------AAHALVRLEDGEIVGDPMEKATLKALKWTVE---- 559

Query: 866  NRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRM 925
                                            KG  +  E +  + I+R F+F S L+R 
Sbjct: 560  --------------------------------KGDKVFNEKNGQVTILRRFQFSSALKRS 587

Query: 926  SVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTR 985
            S +     +    S  KGAPE I E     T+P +Y+ +   +T +G RV+A A KKL +
Sbjct: 588  SSVAT--HDGKLYSAVKGAPETIRERLF--TIPANYDEIYKSFTRSGSRVLALASKKLEK 643

Query: 986  QSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAI 1045
             S    +   RE  E +LEF GF+IF   LK    ET++ L+ +  R +M TGDN LTA+
Sbjct: 644  MSQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAV 703

Query: 1046 SVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVAN--------SSDTLDSVTLRPLS 1097
             V +E G+V+   + V ++++       D + ++NV          S D+ +        
Sbjct: 704  HVAKEVGIVKGETLIVDMVDN----GNDDKLVFRNVEETLSFEFVVSKDSFEKY------ 753

Query: 1098 GDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGY 1157
            G  D Y LAVTG     L      Q++++I +      IYAR+SP +K  ++  L+ +GY
Sbjct: 754  GIFDKYDLAVTGHALEAL--KGHHQLQDLIRH----AWIYARVSPAQKEFILNNLKDMGY 807

Query: 1158 QVGFCGDGANDCGALKAADIGISL 1181
            Q   CGDG ND GALK A +G++L
Sbjct: 808  QTLMCGDGTNDVGALKQAHVGVAL 831

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 85/189 (44%), Gaps = 7/189 (3%)

Query: 1180 SLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYS 1239
            +L   +AS AAPFTS+L  +S V +++++GR ALV +   ++ ++L       ++ I+Y 
Sbjct: 950  TLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 1009

Query: 1240 RGSNLGDFQFLYIDLFLIVPLAVFMSWS--KPYEVLAKKRPTANLVSPKXXXXXXXXXXX 1297
             G   GD Q     L L V    F+S S  KP + L+K RP A + +             
Sbjct: 1010 AGVKFGDGQATTSGLLLSV---CFLSISRGKPLQKLSKARPQAGIFNVYIMGSILSQFVV 1066

Query: 1298 XXXXXXXPWLAVQHMKWYRQPVVG-DDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYR 1356
                       +  ++  R+P V  + E   S  NT +F +   Q +    V   G P+R
Sbjct: 1067 HIGTLIYLTNEIYRLE-PREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFR 1125

Query: 1357 EPMSKNVGF 1365
            E +  N G 
Sbjct: 1126 ENIRSNKGM 1134

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  314 bits (804), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 231/766 (30%), Positives = 375/766 (48%), Gaps = 125/766 (16%)

Query: 447  SRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYA 506
            SRGL  ++   +++ +G+N+ ++   +  ++  + A+ PF++FQIF + LW+FD  +Y +
Sbjct: 163  SRGLSGDLTHMKLL-YGENTFDIPVPSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLS 221

Query: 507  TC-IFIISVLSVIDTLVETKQSSERLSELSQFYC------DVRVYRDGFWSQVPSSDLVP 559
               +F+I  +  +          +RL+ L +F         + V+RD  W  + +++L+P
Sbjct: 222  LFNLFMIFAMEAVSVF-------QRLTTLKEFKTMGIKPYGINVFRDSKWQLLQTNELLP 274

Query: 560  GDIYELTDPSL-SLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDT 618
             D+  +T     S L CD IL+ G C+VNE+ML+GES P+ K +    +  + L      
Sbjct: 275  MDLISVTRTDEDSALSCDMILVDGTCIVNEAMLSGESTPLLKESVKLRSSEEKL------ 328

Query: 619  QLSSFVSKSFLFNGTKLIRVRA--TAGQSI-------ALGMVARTGFSTTKGSLVRSMVF 669
            Q+      S L  GTK+++V A      SI       AL +V++TGF T++G+LVR M++
Sbjct: 329  QVEGLDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVMIY 388

Query: 670  PKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPAL 729
                     +++  +I ++ I A+      +++  R+G  +  +IL  + IIT VVP  L
Sbjct: 389  SSERVSVGNKEALYFILFLLIFAIAASWYVWVEGTRMGRVQSKLILDCILIITSVVPSEL 448

Query: 730  PASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVV-- 787
            P  L++    +L  L K  ++C  P R+ + G+IDV CFDKTGTLT + L   G+  +  
Sbjct: 449  PMELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLAG 508

Query: 788  --QPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSL-RMVDGELL 844
              QP+    K +++  D                      N ++     H+L R+ D E++
Sbjct: 509  KNQPVNHLFKGTEVPLDT---------------------NLVIG--AAHALVRLDDDEVV 545

Query: 845  GDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIER 904
            GDP +   +  T W                                      G    +  
Sbjct: 546  GDPMEKATLAATGWK------------------------------------VGVKDSLSN 569

Query: 905  EPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEAL 964
            E    I I+R F+F S L+R S I     ++   S  KGAPE I E  S+  +P DY+ +
Sbjct: 570  EKVGDISILRRFQFSSALKRSSTIAVHNKQH--YSAVKGAPETIRERLSQ--VPTDYDQV 625

Query: 965  LHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLE 1024
               +T  G RV+A A KKL   S    +K+ RE +ES+LEF GF++F   LK    ET++
Sbjct: 626  YKSFTRAGSRVLALASKKLPSMSIKQIEKLEREAVESDLEFKGFLVFHCPLKDDAIETIK 685

Query: 1025 SLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANS 1084
             L+ +  R IM TGDN LTA+ V +E  +VE   + +     ID S     + ++N+   
Sbjct: 686  MLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILD--EPIDGSSHA--LVFRNI--- 738

Query: 1085 SDTLDSVTLRPLSGDTD---------DYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTS 1135
                +   + P + + D          Y +AVTG   +LL  +  SQ+ E+I +    T 
Sbjct: 739  ----EETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLL--SGHSQLNELIRH----TW 788

Query: 1136 IYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISL 1181
            +YAR+SP +K  ++  L+ +GYQ   CGDG ND GALK A +GI+L
Sbjct: 789  VYARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 834

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 92/208 (44%), Gaps = 19/208 (9%)

Query: 1165 GANDCGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMS 1224
            G ND      +D   +L   +AS AAPFTS+L  +S V +++++GR AL+ +   ++ ++
Sbjct: 942  GLND----SESDDAPTLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALINTIQMYKILA 997

Query: 1225 LYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSK--PYEVLAKKRPTANL 1282
            L       ++ ++Y  G   GD Q     L + V    F+S S+  P E L+K+RP    
Sbjct: 998  LNCLITAYSLSVIYLAGVKFGDVQATVSGLLITV---CFLSISRGQPLEKLSKERP---- 1050

Query: 1283 VSPKXXXXXXXXXXXXXXXXXXPWLAVQHMKWY----RQPVVGDDEHVASS-DNTILFFV 1337
              P                     LA  + + Y    R+P +  ++  + S  NT +F +
Sbjct: 1051 -QPGIFNVYIMGSILGQFAVHIAALAYINREIYFLEPREPQIDLEKDFSPSLLNTGIFLI 1109

Query: 1338 SNFQYILVAVVLSVGPPYREPMSKNVGF 1365
               Q +    V   G P+RE +  N G 
Sbjct: 1110 QLAQQVSTFAVNYQGEPFRENIRSNKGM 1137

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  302 bits (774), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 217/751 (28%), Positives = 371/751 (49%), Gaps = 113/751 (15%)

Query: 455  HEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISV 514
            H  R+  +G+NS ++   T  ++  + A+ P ++FQ+F + LW+ D ++YY+    + ++
Sbjct: 172  HLKRL--YGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYS----LFNL 225

Query: 515  LSVIDTLVETKQSSERLSELSQFYC------DVRVYRDGFWSQVPSSDLVPGDIYELTDP 568
              +I   +E     +RL+ L +F         + V+R+  W  + +++L+P D+  +T  
Sbjct: 226  FMIIS--MEAAAVFQRLTALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRT 283

Query: 569  SL-SLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKS 627
            +  S +PCD IL+ G  +VNE+ML+GES P+ K +      ++L     + QL      +
Sbjct: 284  AEESAIPCDLILLDGSAIVNEAMLSGESTPLLKES------IKLRPSEDNLQLDGVDKIA 337

Query: 628  FLFNGTKLIRVRATAGQSI--------ALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYE 679
             L  GTK ++V     +S         AL +V +TGF T++GSLVR M++         +
Sbjct: 338  VLHGGTKALQVTPPEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNK 397

Query: 680  DSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGF 739
            ++  +I ++ I A+      +++  ++G  +  +IL  + IIT VVPP LP  L++    
Sbjct: 398  EALMFILFLLIFAVIASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNS 457

Query: 740  ALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKL 799
            +L  L K  ++C  P R+   G+IDV CFDKTGTLT + L   G            ++ +
Sbjct: 458  SLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEG------------LAGI 505

Query: 800  VTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSL-RMVDGELLGDPFDFKMVQFTKW 858
              D +++    S ++         ++ ++ +   H+L ++ DG+++GDP +   ++   W
Sbjct: 506  SADSENIRHLYSAAEA-------PESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGW 558

Query: 859  SDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEF 918
            + E +  N                                     RE +  + I+R F+F
Sbjct: 559  AVERKNSNY------------------------------------REGTGKLDIIRRFQF 582

Query: 919  LSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIAC 978
             S L+R + I      +   +  KGAPE I E  S   +P +Y+ +   +T +G RV+A 
Sbjct: 583  SSALKRSASIAS--HNDALFAAVKGAPETIRERLSD--IPKNYDEIYKSFTRSGSRVLAL 638

Query: 979  AGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTG 1038
            A K L + S      ++R+++ES L F GF+IF   LK    ET++ L+ +  R+IM TG
Sbjct: 639  ASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITG 698

Query: 1039 DNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVAN--------SSDTLDS 1090
            DN LTA+ V +E G+V    + +      D +Q    + +++V          S DT D 
Sbjct: 699  DNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQ----LLFRDVEETVSIPFDPSKDTFDH 754

Query: 1091 VTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE 1150
              L       D Y +AVTG     L     SQ+ +++ +    T +YAR+SP +K  L+ 
Sbjct: 755  SKL------FDRYDIAVTGYALNAL--EGHSQLRDLLRH----TWVYARVSPSQKEFLLN 802

Query: 1151 RLQSIGYQVGFCGDGANDCGALKAADIGISL 1181
             L+ +GYQ   CGDG ND GALK A +GI+L
Sbjct: 803  TLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 833

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 87/194 (44%), Gaps = 7/194 (3%)

Query: 1175 ADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTI 1234
             D   +L   +AS AAPFTS+L  +S V +++++GR ALV +   ++ ++L       ++
Sbjct: 947  GDEAPALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSL 1006

Query: 1235 LILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWS--KPYEVLAKKRPTANLVSPKXXXXXX 1292
             I+Y  G   GD Q     L L V    F+S S  KP E L+K+RP + + +        
Sbjct: 1007 SIIYMAGVKFGDGQATVSGLLLSV---CFLSISRGKPLEKLSKQRPQSGIFNVYIMGSIL 1063

Query: 1293 XXXXXXXXXXXXPWLAVQHMKWYRQPVVG-DDEHVASSDNTILFFVSNFQYILVAVVLSV 1351
                            +  ++  R+P V  + E   S  NT +F +   Q +    V   
Sbjct: 1064 SQFAVHIATLVYITTEIYKLE-PREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQ 1122

Query: 1352 GPPYREPMSKNVGF 1365
            G P+RE +  N G 
Sbjct: 1123 GEPFRENIRSNKGM 1136

>Scas_583.14*
          Length = 875

 Score =  224 bits (571), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 166/543 (30%), Positives = 264/543 (48%), Gaps = 82/543 (15%)

Query: 647  ALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRL 706
            AL +V +TGF T +GSLVR M++         +++  +I ++   A+      +++  ++
Sbjct: 19   ALVVVTKTGFETYQGSLVRVMIYSAERVGVDNKEALMFILFLLNFAVVASWYVWVEGTKM 78

Query: 707  GLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVM 766
            G  +  +IL  + IIT VVPP LP  L++    +L  L K  ++C  P R+ + G+IDV 
Sbjct: 79   GRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVC 138

Query: 767  CFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNF 826
            CFDKTGTLT + L   G+           +S    DV+ L          S+ D   +  
Sbjct: 139  CFDKTGTLTGEDLVFEGL---------AGLSDKSEDVRHLF---------SSEDASQETI 180

Query: 827  LVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENS 886
            LV       +++ DGE++GDP +   ++   W  E   GN                    
Sbjct: 181  LVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVE---GND------------------- 218

Query: 887  RFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPE 946
                          F  R  +  + I+R F+F S L+R S +     ++   +  KGAPE
Sbjct: 219  --------------FTSRPKTGKLQILRRFQFSSALKRSSSVAS--HKDKLFTAVKGAPE 262

Query: 947  VIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFL 1006
             I E  +   +P +Y+ +   +T +G RV+A A K L   S      + R+EIE+ L F 
Sbjct: 263  TIRERLA--VVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIETGLTFN 320

Query: 1007 GFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVIND 1066
            GF++F   LK    ET++ L+ +  R+IM TGDN LTA+ V +E  +V    +   +++ 
Sbjct: 321  GFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETL---ILDK 377

Query: 1067 IDTSQEGDIITWQNVANS--------SDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKT 1118
             +T  +G ++ + NV  +        SD  D   L       D Y +AVTG    LL   
Sbjct: 378  SETVGDGKLLFF-NVEETIKIPFDPASDKFDHREL------FDKYDIAVTGYALNLL--E 428

Query: 1119 DKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIG 1178
            D SQ++++I +    T +YAR+SP +K  ++  L+ +GYQ   CGDG ND GALK A +G
Sbjct: 429  DHSQLKDLIRH----TWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVG 484

Query: 1179 ISL 1181
            ++L
Sbjct: 485  VAL 487

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 95/208 (45%), Gaps = 11/208 (5%)

Query: 1180 SLSEAEASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQFVTILILYS 1239
            +L   +AS AAPFTS+L ++S V +++++GR ALV +   ++ ++L       ++ I+Y 
Sbjct: 610  TLKLGDASCAAPFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 669

Query: 1240 RGSNLGDFQFLYIDLFLIVPLAVFMSWS--KPYEVLAKKRPTANLVSPKXXXXXXXXXXX 1297
             G   GD Q     L L V    F+S S  KP + L+K+RP   + +             
Sbjct: 670  AGVKFGDAQATVSGLLLSV---CFLSISRGKPIQKLSKQRPQKGIFNVYIMGSILSQFAV 726

Query: 1298 XXXXXXXPWLAVQHMKWYRQPVVG-DDEHVASSDNTILFFVSNFQYILVAVVLSVGPPYR 1356
                       + ++   R+P V  + E   S  NT +F +   Q +    V   G P+R
Sbjct: 727  HIFTLVYITREI-YILEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFR 785

Query: 1357 EPMSKNVGFIADVL----VSLVASCRIM 1380
            E +  N G    +L    ++LV++   M
Sbjct: 786  ENIRNNRGMYFGLLGVSSLALVSATEFM 813

>Kwal_14.1498
          Length = 939

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 212/874 (24%), Positives = 346/874 (39%), Gaps = 181/874 (20%)

Query: 449  GLPN-NIHEDRMIAFGKNSINLRQ------KTTSQILFDEALHPFYIFQIFSIILWMFDA 501
            GLP  ++ E+R   +GKN I+  +      K  +  + D    P  +  I S ++     
Sbjct: 52   GLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGD----PLILLLIGSAVISFIMG 107

Query: 502  YYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCD-VRVYRDGFWSQVPSSDLVPG 560
                A  I +  V+ V    V+  +S + L  L++   D   + R G  S++ +S LVPG
Sbjct: 108  NIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVPG 167

Query: 561  DI--YELTDPSLSLLPCDSILISG-DCLVNESMLTGESVPVSKVAATRETMLQLLDDFMD 617
            D+  + + D     +P D  +I   D  + ES LTGE+ PV K  AT      +  +F  
Sbjct: 168  DVVRFRVGDR----IPADLRIIEAVDLSIEESNLTGENEPVHKSTAT------VNKEFYK 217

Query: 618  TQLSSFVSKS----FLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKP- 672
              L S V  S      F GT    VR   G+ I +G    T F      ++ ++  PK  
Sbjct: 218  ENLGSIVPVSERSCIAFMGT---LVREGHGRGIVIGTAKNTAFGKV-FEMMNAIEKPKTP 273

Query: 673  --TGF-KFYED-SFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPA 728
              T   K  +D SF     I II L G     IQ    G     M   ++ +    +P  
Sbjct: 274  LQTAMDKLGKDLSFMSFIVIGIICLIGV----IQ----GRSWLEMFQISVSLAVAAIPEG 325

Query: 729  LPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQ 788
            LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V  V  + 
Sbjct: 326  LPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLG 385

Query: 789  PLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPF 848
             +  +  I KL     D   S S    + T D++A     +L    +      + LG+P 
Sbjct: 386  SMSNKSNILKL-----DKATSGSFKKNL-TEDLRATLRTGNLCNNSTYSHEHAKYLGNPT 439

Query: 849  DFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSN 908
            D  +++                                     ++H  G    +E E   
Sbjct: 440  DIALLE-------------------------------------VLHKFG----LEDERPQ 458

Query: 909  VIGIVRSFEFLSNLRR--MSVIVKPFSENVFMSFTKGAPEVIFELCS------------- 953
            V    RS E   N +R  M+V VK  +   F+   KGA E I E  +             
Sbjct: 459  V---TRSDEISFNSKRKFMAVKVKE-ANGKFVVHVKGAYEKILEKSTHFINAENKVVKLD 514

Query: 954  ---KQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFII 1010
               +Q +    +AL      +G R +A A  +L+  +   S+K++ ++I + L F G + 
Sbjct: 515  SNLRQAITDSADAL----ASDGLRTLAFAQLELSNGN---SKKLTEDDI-NGLTFAGLLG 566

Query: 1011 FENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGL-VESPRVFVSVINDIDT 1069
              +  + + K  +E L    +  IM TGD   TA+S+ R+ G+ V +P   V        
Sbjct: 567  MNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETAV-------- 618

Query: 1070 SQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINN 1129
                                      L+GD  D+                + Q+  +I++
Sbjct: 619  --------------------------LTGDKLDH--------------MSEDQLASIIDH 638

Query: 1130 ILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVA 1189
            +    +I+AR +P+ K  +V  LQ  G  V   GDG ND  ALK ADIG+S+ +    VA
Sbjct: 639  V----NIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 694

Query: 1190 APFTSRLF---EISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNL 1244
               +  +    + S +L  ++EG+     + +F  FQ  +  +A   V I   +   + L
Sbjct: 695  KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPL 754

Query: 1245 GDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRP 1278
               Q L+I++ +  P A  +        + KK P
Sbjct: 755  NAMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 788

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 198/841 (23%), Positives = 326/841 (38%), Gaps = 168/841 (19%)

Query: 541  VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSK 600
            V V RD   S +   +L+ GD+ +L   +  ++P D +L+ G+C  +ES LTGES  + K
Sbjct: 159  VVVVRDAAESLISIHNLLVGDLLKLQ--TGDVVPADCVLVRGECETDESALTGESNTIKK 216

Query: 601  VA---ATRETMLQLLDDFMDTQLS--------SFVSKSFLFNGTKLIRVRATAGQSIALG 649
            +    A          D  DT  S        S      L +G++++   A+A       
Sbjct: 217  LPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASA------- 269

Query: 650  MVARTGFSTTKGSLVRSMV-----FPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFL 704
            +V   G ++  G  + S+       P         D+    G ++ I LF   V F ++L
Sbjct: 270  IVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLF--VVLFARYL 327

Query: 705  ----------------RLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKG 748
                              G     + + A+ +I V VP  LP ++++   FA  R+ K G
Sbjct: 328  SYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDG 387

Query: 749  IFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDV----LGVHVVQPLQQEMKISKLVTDVK 804
                        G    +C DKTGTLTE+ + V    LG      +  +   S LV   K
Sbjct: 388  NLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKK 447

Query: 805  --DLLQSLSLSDCV------STRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFT 856
              DLL+++   + V        +D K  N   S+      R++           + +Q  
Sbjct: 448  CSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRIT-------QTLQKK 500

Query: 857  KWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRF---------IEREPS 907
            K  DEE   N   H+  E R +     +      ++   S   +F          E+ P+
Sbjct: 501  KPDDEE---NLLAHA-AEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPT 556

Query: 908  NVIGIVRSFEFLSNLRRMSVIVKPFSENV------FMSFTKGAPEVIFELCS-------- 953
             V  IV+   F S+ R+ S IV   + N       F  + KGA E++ + C+        
Sbjct: 557  -VETIVQIIPFESS-RKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEG 614

Query: 954  ----KQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSW----LYSQKVSREEI------ 999
                 Q    D E  +     +  R I+ A        W    L   + S E +      
Sbjct: 615  ISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLID 674

Query: 1000 --ESNLEFL---GFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLV 1054
              + +LE L     +  ++ L+   K ++    +A +   M TGDN+LTA ++ R  G++
Sbjct: 675  PKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGIL 734

Query: 1055 ESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRL 1114
             S  +                                         +D   A+ G  FR 
Sbjct: 735  SSKSL-----------------------------------------NDSACAMEGPAFRK 753

Query: 1115 LFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKA 1174
            L  +++ +I       L K  + AR SP++K  LV  L+ +G  V   GDG ND  ALK 
Sbjct: 754  LSDSERKRI-------LPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKL 806

Query: 1175 ADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGR--AALVTSFACFQYMSLYSAT 1229
            AD+G S+      VA   +  +    + S +++ +K GR  AA +  F  FQ +   +A 
Sbjct: 807  ADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAV 866

Query: 1230 --QFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTAN---LVS 1284
               FVT +I     S L   Q L+++L +    A+ ++  KP   +  ++P      L++
Sbjct: 867  LLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLIT 926

Query: 1285 P 1285
            P
Sbjct: 927  P 927

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 187/828 (22%), Positives = 324/828 (39%), Gaps = 170/828 (20%)

Query: 540  DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVS 599
            DV V R+G    +   DL+ GD+  L   +  ++P D++LISG C  +ES LTGES  + 
Sbjct: 240  DVVVIRNGDEHLISIHDLLVGDVISLQ--TGDVVPADAVLISGSCECDESALTGESDTIK 297

Query: 600  KVA--ATRETMLQLLD-----DFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVA 652
            KVA     E   Q+ +     D     +   V    L +G+KL+         I   ++ 
Sbjct: 298  KVALKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLL-------SGIGNAVIT 350

Query: 653  RTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFL--- 704
              G ++  G ++ ++       P         D+    G ++ + L  F + FI+FL   
Sbjct: 351  SVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVL--FIILFIRFLTYL 408

Query: 705  ------------RLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCI 752
                        + G     + + A+ +I V VP  LP ++++   FA  R+ K G    
Sbjct: 409  PNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVR 468

Query: 753  SPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSL 812
                    G    +C DKTGTLTE+ + V                     VK    +L  
Sbjct: 469  VLRACETMGSATAICSDKTGTLTENRMTV---------------------VKGFAGNLGF 507

Query: 813  SDCVSTRDMKAKNFLVSLLTCHSLRMVD----GELLGDPFDFKMVQFTKWSDEEETGNRK 868
             D     + + K+ +V    C +  + D      L    F+ K  Q      +E   ++ 
Sbjct: 508  DDTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKS 567

Query: 869  VHSLYEERHDGST-------MPEN------SRFAPAIVHPSGKG------RFIEREPSN- 908
              SL+    +  T       M EN      S+   A++  + K         +  +PS+ 
Sbjct: 568  RKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDL 627

Query: 909  -VIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQ------TLPLDY 961
             +  +V+   F S+ +  ++ V+      +  + KGA E++ ++CS Q       +P++ 
Sbjct: 628  GIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQ 687

Query: 962  E------ALLHHYTHNGYRVIACAGKKL-----------TRQSWLYSQKVSREEIE-SNL 1003
            +        +     +  R I+   +             T  S      V   E++  NL
Sbjct: 688  DLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNL 747

Query: 1004 EFLGFII-----FENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR 1058
               G  +      ++ L+   KE++E   RA +   M TGDN+LTA ++ R   ++    
Sbjct: 748  SSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNIL---- 803

Query: 1059 VFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLL-FK 1117
                       S+EG                           +D   A+ G  FR L +K
Sbjct: 804  -----------SEEG--------------------------YNDPECAMEGPTFRKLPYK 826

Query: 1118 TDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADI 1177
                     +  ++ K  + AR SP++K  LVE L+ +G  V   GDG ND  ALK AD+
Sbjct: 827  K--------MLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADV 878

Query: 1178 GISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRAALVT--SFACFQYMSLYSAT--Q 1230
            G S+  +   VA   +  +    + + +++ +K GR   V+   F  FQ     +A    
Sbjct: 879  GFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILT 938

Query: 1231 FVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRP 1278
            FV+ +      S L   Q L+++L +    A+ ++  KP E +  ++P
Sbjct: 939  FVSAVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKP 986

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 191/818 (23%), Positives = 325/818 (39%), Gaps = 167/818 (20%)

Query: 560  GDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDF--MD 617
            GD+  L   +  ++P D ++ISG C  +ES +TGES  + K           L DF   +
Sbjct: 213  GDVISLQ--TGDVVPADCVMISGKCEADESSITGESNTIQKFPVDNS-----LRDFKKFN 265

Query: 618  TQLSSFVSKSFLF-----NGTKLIRVRATAGQSI----ALGMVARTGFSTTKGSLVRSM- 667
            +  S   SK         +G K+      +G  I      G++   G ++  G  + S+ 
Sbjct: 266  SIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLN 325

Query: 668  VFPKPTGFKFY----EDSFKYIGYISIIALFGFAVSFIQFLRLGLDKR------------ 711
              P+ T  + +     D+    G +S I LF    +   F  +  D R            
Sbjct: 326  AEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSK 385

Query: 712  --TMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFD 769
               + + ++ +I V VP  LP ++++   FA  R+ K G            G    +C D
Sbjct: 386  FMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSD 445

Query: 770  KTGTLTEDGLDVL---------GVHVVQPLQQEMKI-SKLVTDVK-------DLLQSLSL 812
            KTGTLTE+ + V+               P+ ++ K+ SK V +         DLL ++ L
Sbjct: 446  KTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRNDLLANIVL 505

Query: 813  -SDCVSTRDMKA--KNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWS--DEEETGNR 867
             S     RD K   KN      T  S  M       D    ++  F K +  D+E+   +
Sbjct: 506  NSTAFENRDYKKNDKN------TNGSKNMSKNLSFLDKCKSRLSFFKKGNREDDEDQLFK 559

Query: 868  KVHSLYEERHDGS---TMPENSRFAPAIVHPSGKGRFIEREPS---NVIGIVRSFEFLSN 921
             V+   +E   GS   T   +       + P G+ +++  +P    N+  +V++  F S+
Sbjct: 560  NVNKGRQEPFIGSKTETALLSLARLSLGLQP-GELQYLRDQPMEKFNIEKVVQTIPFESS 618

Query: 922  LRRMSVIVK--------PFSENVFMSFTKGAPEVIFELCS------------KQTLPLDY 961
             +   ++VK        PF    +  F KGA E++ + CS             +    + 
Sbjct: 619  RKWAGLVVKYKEGKNKKPF----YRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKET 674

Query: 962  EALLHHYTHNGYRVIACAGKKLTR-QSWLYSQKVSREEIESNLEFL-------------G 1007
            +  + +   +  R I+ A K      SW   Q   R++   N+  L             G
Sbjct: 675  DDEIKNLASDALRAISVAHKDFCECDSWPPEQ--LRDKDSPNIAALDLLFNSQKGLILDG 732

Query: 1008 FIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDI 1067
             +  ++ L+   +E+++   RA +   M TGDN+LTA ++ R   ++ +           
Sbjct: 733  LLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILST----------- 781

Query: 1068 DTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVI 1127
            D S E                              Y+ A+ G  FR L K ++ +I    
Sbjct: 782  DISSEA-----------------------------YS-AMEGTEFRKLTKNERIRI---- 807

Query: 1128 NNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEAS 1187
               L    + AR SP++K  LVE L+ +G  V   GDG ND  ALK AD+G S+  +   
Sbjct: 808  ---LPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTE 864

Query: 1188 VAAPFTSRLF---EISCVLDVMKEGRAALVT--SFACFQYMSLYSAT--QFVTILILYSR 1240
            VA   +  +    + S +++ +K GR   V+   F  FQ +   +A    FV+ +     
Sbjct: 865  VAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDE 924

Query: 1241 GSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRP 1278
             S L   Q L+I+L +    A+ ++  KP   +  ++P
Sbjct: 925  TSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKP 962

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 189/764 (24%), Positives = 313/764 (40%), Gaps = 144/764 (18%)

Query: 524  TKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YELTDPSLSLLPCD-SILI 580
            +++S E L +L    C   + R G  + V +S LVPGD+  +++ D     +P D  I+ 
Sbjct: 144  SEKSLEALHKLVPASC--HLIRFGAETHVLASCLVPGDLVYFKVGDR----IPADVRIIE 197

Query: 581  SGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRA 640
            S D  ++ES LTGE+ PV K      +      D     +      S  + GT    VR 
Sbjct: 198  STDLSLDESTLTGETEPVHKSCTPVNS--ATYSDVPGGIIPIGERTSIAYMGT---LVRE 252

Query: 641  TAGQSIALGMVARTGFSTTKGSLVRSM-VFPKP-TGFKFYEDSFKY-IGYISIIALFGFA 697
              G+    G+V  TG  T  G++   M    KP T  +   D+ +  + Y+       F 
Sbjct: 253  GHGK----GIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVR------FV 302

Query: 698  VSFIQFLRLGLDKRT---MILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISP 754
            +S I FL   +  R+   M   ++ +    +P  LP  +++     + R+  +       
Sbjct: 303  LSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRL 362

Query: 755  TRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKI----SKLVTDVKDLLQSL 810
              V   G ++V+C DKTGTLT + +    +  +  +  +  +    +K    +   L +L
Sbjct: 363  PSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNL 422

Query: 811  S--LSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRK 868
               LSD     D+KA   + S+    S     G+ LG+P D  +++  +  D        
Sbjct: 423  KNYLSD-----DVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFD-------- 469

Query: 869  VHSLYEERHDGSTMPE---NSR---FAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNL 922
               L +ER   + + E   NS+    A  +  P+  G+ I       I +  +FE +  L
Sbjct: 470  ---LVDERPTTTRVDELTFNSKRKYMAVKVDSPANSGKHI-------IYVKGAFERI--L 517

Query: 923  RRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKK 982
             R +            SF  GA +V     S ++L  D    L      G R +A A   
Sbjct: 518  ERSA------------SFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFA--- 559

Query: 983  LTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVL 1042
               Q    + K   +    NL F+G I  ++  + T +  +E L +  +  IM TGD   
Sbjct: 560  ---QLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAEN 616

Query: 1043 TAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDD 1102
            TA+++ R+ G        + VIN      E  ++T        D LD +T        DD
Sbjct: 617  TAVNIARQIG--------IPVIN-----PEISVLT-------GDRLDQMT--------DD 648

Query: 1103 YTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFC 1162
                               Q+  VI+++    +I+AR +P+ K  +V  LQ  G  V   
Sbjct: 649  -------------------QLAGVIDHV----NIFARATPEHKLNIVRALQKRGDIVAMT 685

Query: 1163 GDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRAAL--VTSF 1217
            GDG ND  ALK ADIG+++      VA   +  +    + S +L  ++EG+     + SF
Sbjct: 686  GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSF 745

Query: 1218 ACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLA 1261
              FQ  +  +A   V I   +   + L   Q L+I++ +  P A
Sbjct: 746  LTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPA 789

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 192/862 (22%), Positives = 341/862 (39%), Gaps = 160/862 (18%)

Query: 453  NIHEDRMIAFGKNSI------NLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYA 506
            N   +R   +G N I      +L +K  S  + D  +       + S+ +   D      
Sbjct: 62   NEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSIT 121

Query: 507  TCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YE 564
              IFI+  +  +     +++S E L++L    C   + R G  S V +S LVPGD+  + 
Sbjct: 122  LAIFIVVTVGFVQEY-RSEKSLEALNKLVPAEC--HLMRCGQESHVLASTLVPGDLVHFR 178

Query: 565  LTDPSLSLLPCDSILISG-DCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623
            + D     +P D  +I   D  ++ES LTGE+ PV K + T E        F D Q +S 
Sbjct: 179  IGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEK-----SSFND-QPNSI 228

Query: 624  VSKS----FLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMV-FPKP------ 672
            V  S      + GT    V+   G+ I +G    TG +T+ G++   M    KP      
Sbjct: 229  VPISERSCIAYMGT---LVKEGHGKGIVVG----TGTNTSFGAVFEMMNNIEKPKTPLQL 281

Query: 673  TGFKFYED----SFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPA 728
            T  K  +D    SF  IG I ++ +     S+++  ++          ++ +    +P  
Sbjct: 282  TMDKLGKDLSLVSFIVIGMICLVGIIQ-GRSWLEMFQI----------SVSLAVAAIPEG 330

Query: 729  LPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQ 788
            LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V  +  + 
Sbjct: 331  LPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLD 390

Query: 789  PLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPF 848
             +  ++ +  L  + K    + +L + + T D++    + +L    S        LG+P 
Sbjct: 391  SMSNKLNVLSLDKNKKTKNSNGNLKNYL-TEDVRETLTIGNLCNNASFSQEHAIFLGNPT 449

Query: 849  DFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSR---FAPAIVHPSGKGRFIERE 905
            D  ++        E+  N ++  +         +P NS+    A  I++P          
Sbjct: 450  DVALL--------EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVD-------- 493

Query: 906  PSNVIGIVRSFEFLSNLRRMSVIVKPFSENVF---MSFTKGAPEVIFELCSKQTLPLDYE 962
                              + +V VK   E +     S+ K   +   +L   Q   ++  
Sbjct: 494  -----------------NKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINEC 536

Query: 963  ALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKET 1022
            A  +     G RV   A   L+  S   +     E++  +L F G I   +  +   K  
Sbjct: 537  A--NSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFA 589

Query: 1023 LESLHRADIRTIMCTGDNVLTAISVGREAGL-VESPRVFVSVINDIDTSQEGDIITWQNV 1081
            +E L +  +  IM TGD+  TA+++ ++ G+ V  P++ V                    
Sbjct: 590  IEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSV-------------------- 629

Query: 1082 ANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMS 1141
                          LSGD  D              +    Q+  VI+++    +I+AR +
Sbjct: 630  --------------LSGDKLD--------------EMSDDQLANVIDHV----NIFARAT 657

Query: 1142 PDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---E 1198
            P+ K  +V  L+  G  V   GDG ND  ALK +DIG+S+      VA   +  +    +
Sbjct: 658  PEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717

Query: 1199 ISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFL 1256
             S +L  ++EG+     + +F  FQ  +  +A   V +   +   + L   Q L+I++ +
Sbjct: 718  FSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILM 777

Query: 1257 IVPLAVFMSWSKPYEVLAKKRP 1278
              P A  +        + KK P
Sbjct: 778  DGPPAQSLGVEPVDHEVMKKPP 799

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 179/772 (23%), Positives = 304/772 (39%), Gaps = 166/772 (21%)

Query: 523  ETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YELTDPSLSLLPCD-SIL 579
            ++++S E L++L    C   + R G  S V +S+LVPGD+  +++ D     +P D  I+
Sbjct: 132  KSEKSLEALNKLVPAEC--HLTRSGQLSHVLASNLVPGDLVRFKVGD----RIPADLRIV 185

Query: 580  ISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFL---------F 630
             S D  V+ES LTGE+ PV K +             +D +  S +  S +         F
Sbjct: 186  ESIDLCVDESNLTGENEPVHKSSGA-----------VDPKNYSHIPGSIIPVGDRNCIGF 234

Query: 631  NGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMV-FPKP-TGFKFYEDSF-KYIGY 687
             GT    VR   G+    G+V  TG  T  GS+   M    KP T  +   D   + + Y
Sbjct: 235  MGT---LVREGHGK----GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSY 287

Query: 688  ISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKK 747
            +S + +    +  I   R  L+   M   A+ +    +P  LP  +++     + R+ K+
Sbjct: 288  MSFVLIGIICLIGIIQGRSWLE---MFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 344

Query: 748  GIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLL 807
                     V   G ++V+C DKTGTLT + + V  +  +  ++ +              
Sbjct: 345  KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK-------------- 390

Query: 808  QSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNR 867
                 ++C++   +K +   +      +LR+                          GN 
Sbjct: 391  -----TNCLALSKVKERPIKMEQDVATTLRI--------------------------GNI 419

Query: 868  KVHSLYEERH-DGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMS 926
              +  Y + H      P +     ++ H      F   +  N +  +    F S  + M+
Sbjct: 420  CNNGTYSQEHLKYLGNPTDIAILESLQH------FGINDCRNSVNKINEIPFNSKRKFMA 473

Query: 927  VIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQ 986
            V     ++ V + + KGA E I E   K    +  +  +H    N   +I  A   L  +
Sbjct: 474  VKTIDANDKVVV-YVKGAFEKIVE---KSINYIGRDGKVHKLKPNDKAIINDAAVALASE 529

Query: 987  ------------SWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTI 1034
                        S  +  K   E++   L F G I   +  + T +  +E L +  +  I
Sbjct: 530  GLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVI 589

Query: 1035 MCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLR 1094
            M TGD   TA+S+ R+ G        + VIN      E  ++       S D LD +T  
Sbjct: 590  MITGDAENTAVSIARQIG--------IPVIN-----PEYSVL-------SGDKLDQMT-- 627

Query: 1095 PLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQS 1154
                  DD                   Q+  VI+++    +++AR +P+ K  +V  LQ 
Sbjct: 628  ------DD-------------------QLASVIDHV----NVFARATPEHKLNIVRALQK 658

Query: 1155 IGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRA 1211
             G  V   GDG ND  ALK ADIG+S+ +    VA   +  +    + S +L  ++EG+ 
Sbjct: 659  RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 718

Query: 1212 AL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLA 1261
                + +F  FQ  +  +A   V I       + L   Q L+I++ +  P A
Sbjct: 719  IFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPA 770

>Scas_707.48*
          Length = 741

 Score =  108 bits (271), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 186/792 (23%), Positives = 322/792 (40%), Gaps = 151/792 (19%)

Query: 458  RMIAFGKNSI------NLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFI 511
            R + +G N I      +L +K  S  + D  +       + S I+   D        I I
Sbjct: 67   RKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVI 126

Query: 512  ISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YELTDPS 569
            +  +  +     +++S E L++L    C   + R G  S V +S LVPGD+  +++ D  
Sbjct: 127  VVSVGFVQEY-RSEKSLEALNKLVPAEC--HLIRCGQESHVLASGLVPGDLVHFKIGDR- 182

Query: 570  LSLLPCDSILISG-DCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKS- 627
               +P D  +I   D  ++ES LTGE+ PV K A       ++  D  + Q +S +  S 
Sbjct: 183  ---IPADLRIIEAVDLSIDESNLTGENEPVHKSAK------EVNKDSFNDQPNSIIPISD 233

Query: 628  ---FLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKY 684
                 + GT    V+   G+ I +G+   T F      ++ ++  PK       +++   
Sbjct: 234  RTCVAYMGT---LVKEGHGKGIVVGIGKNTSFGAIF-EMLSNIEKPKTP----LQNAMDK 285

Query: 685  IGYISIIALFGFAVSFIQFLRLGLDKRT---MILRALDIITVVVPPALPASLSIGTGFAL 741
            +G    ++LF F V  +  L   L  R+   M   ++ +    +P  LP  +++     +
Sbjct: 286  LG--KDLSLFSFIVIGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGV 343

Query: 742  NRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVT 801
             R+ K+         V   G ++V+C DKTGTLT + +    +  +  +  +  +  L  
Sbjct: 344  LRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSL-- 401

Query: 802  DVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMV-QFTKW-- 858
               +  +S SL + + T D+K+   + ++    S     G+ LG+P D  ++ Q +K+  
Sbjct: 402  ---EKSKSGSLKNYL-TEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDL 457

Query: 859  SDEEETGNRKVHSLYEERHDGSTMPENSR---FAPAIVHPSGKGRFIEREPSNVIGIVRS 915
            SD   T  +KV  +          P NS+    A  IV+  GK             +  +
Sbjct: 458  SDIRPT-FKKVQEI----------PFNSKRKFMAVKIVNSEGKYSLC---------VKGA 497

Query: 916  FEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRV 975
            FE + +     +  K  +E      T+G  +VI E               +     G R+
Sbjct: 498  FEKVLSQCSHYLNQKGKTEK----LTQGQRDVIIETA-------------NSLASEGLRM 540

Query: 976  IACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIM 1035
            +A A   L     L +     EE   +L F G I   +  + T K  +E L +  +  IM
Sbjct: 541  LAFAKTTLPDSPTLLT-----EESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIM 595

Query: 1036 CTGDNVLTAISVGREAGL-VESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLR 1094
             TGD+  TA+++ R+ G+ V  P++ V                                 
Sbjct: 596  ITGDSENTAVNIARQIGIPVLDPKLSV--------------------------------- 622

Query: 1095 PLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQS 1154
             LSGD               L +    Q+  VI+++    +I+AR +P+ K  +V  L+ 
Sbjct: 623  -LSGDK--------------LNEMSDDQLANVIDHV----NIFARATPEHKLNIVRALRK 663

Query: 1155 IGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRA 1211
             G  V   GDG ND  ALK ADIG+S+      VA   +  +    + S +L  ++EG+ 
Sbjct: 664  RGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 723

Query: 1212 AL--VTSFACFQ 1221
                + +F  FQ
Sbjct: 724  IFNNIQNFLTFQ 735

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 181/789 (22%), Positives = 325/789 (41%), Gaps = 158/789 (20%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            VPS +L  GD+ +L   S   +P D IL+     SG+  V    L GE+    +VA +  
Sbjct: 283  VPSKNLRVGDLVKLHKDSR--IPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLT 340

Query: 607  TMLQLLDDFMDTQL---SSFVSKSF-LFNGTKLIR----------------VRATAGQSI 646
                L  D M T++   +S   KS  +F G    +                V A++G  +
Sbjct: 341  Q--NLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCV 398

Query: 647  AL----GMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQ 702
            A     G   R   +T+K S+         TG    E     +  I  I +F  ++  + 
Sbjct: 399  ACVIYTGTDTRQAMNTSKSSV--------KTGL--LELEINSLSKILCICVFTLSILLVV 448

Query: 703  FLRLGLDKRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV-- 759
               L  DK  + I+R L + + ++P +L  +L +G      +++       +  R +   
Sbjct: 449  IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIP 508

Query: 760  --GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQS-------- 809
               G+I+ +  DKTGTLT++ + +  +H+   +   M+   +VTD    L S        
Sbjct: 509  EDLGRIEYLLSDKTGTLTQNDMQLRKIHL-GTVSYTMETMDMVTDYIQTLTSPANMGAAG 567

Query: 810  LSLSDCVSTRDMKAKNFLVSLLTCHSL--RMVDGELL---GDPFDFKMVQFTKWSDEEET 864
            ++++        + ++ +V+L TCH++     D EL      P +  +V+FT+       
Sbjct: 568  VAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTE------- 620

Query: 865  GNRKVHSLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLR 923
              R   SL++ +RH  +   E S            G  ++ +      I+  F F S+ +
Sbjct: 621  --RVGLSLFKRDRHSLTLFHEYS------------GVNLQYD------ILHVFPFTSDTK 660

Query: 924  RMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKL 983
            RM +IV+  ++N      KGA  V+ ++          E  + +    G R +  A KKL
Sbjct: 661  RMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIARKKL 717

Query: 984  TRQSWLYSQ--------------------KVSREEIESNLEFLGFIIFENKLKGTTKETL 1023
            + +  LY Q                    +V +  +E NLE LG    E+KL+   K ++
Sbjct: 718  STR--LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSI 775

Query: 1024 ESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVAN 1083
            E L  A ++  M TGD V TA  V   A L+   + +V  I  + T ++G +   + +  
Sbjct: 776  ELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ-YVHTITKL-TRRDGALSRLEYLKA 833

Query: 1084 SSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPD 1143
            + ++                 L + G+   +     +++  E++  I L   I  R +P 
Sbjct: 834  NRNS----------------CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQ 875

Query: 1144 EKHELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEI 1199
            +K ++   ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA ++   F  
Sbjct: 876  QKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF-- 933

Query: 1200 SCVLD--VMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLI 1257
             C L   ++  GR +   S    Q++ ++          +YS  SNL             
Sbjct: 934  -CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK------------ 979

Query: 1258 VPLAVFMSW 1266
             P+A++  W
Sbjct: 980  -PIALYQGW 987

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 161/714 (22%), Positives = 294/714 (41%), Gaps = 132/714 (18%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            VPS DL  GD+ ++   +   +P D +L+     SG+  +    L GE+    +VA +  
Sbjct: 261  VPSKDLKVGDLIKIHKGTR--IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLT 318

Query: 607  TMLQLLD-----------------------DFMDTQLSSFVSKSFLFNGTKLIRVRATAG 643
              L   D                        + D+  ++    + ++  T L  V +  G
Sbjct: 319  QNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIG 378

Query: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703
              +  G   R   +TT  S+         TG    E     +  I    +F  ++  + F
Sbjct: 379  CVVYTGTDTRQAMNTTMSSV--------KTGL--LELEINSLSKILCACVFVLSIVLVAF 428

Query: 704  LRLG-LDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759
               G  D    I+R L + + ++P +L  +L +G      +++       +  R +    
Sbjct: 429  AGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPE 488

Query: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTD-VKDLLQSLS---LSD 814
              G+I+ +  DKTGTLT++ + +  +H+   +   M    +VTD V++L+ S +   +  
Sbjct: 489  DLGRIEYLLSDKTGTLTQNDMQLKKLHL-GTVSYTMDTMDIVTDYVQELVSSSTTTPMPQ 547

Query: 815  CVSTRDM--KAKNFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETGNR 867
              + +D+  + ++ +V+L  CH++     DGEL      P +  +V+FT+          
Sbjct: 548  STAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTE---------- 597

Query: 868  KVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSV 927
                       G ++ +  R + ++ H      F          I++ F F S+ +RM +
Sbjct: 598  ---------SVGLSLFKRDRHSVSLFHQHSATNF-------EYDILQVFPFNSDTKRMGI 641

Query: 928  IV--KPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTR 985
            IV  K   E+ FM   KGA  V+  +       LD E  + +    G R +    KKL+ 
Sbjct: 642  IVYDKVKGEHWFMQ--KGADTVMARIVQSNDW-LDEE--VGNMAREGLRTLVIGRKKLSP 696

Query: 986  QSWLYSQK------------------VSREEIESNLEFLGFIIFENKLKGTTKETLESLH 1027
            +S+   +K                  V ++ +E NLE LG    E+KL+   K ++E L 
Sbjct: 697  KSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLR 756

Query: 1028 RADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDT 1087
             A ++  M TGD V TA  V   A L+   + +V  +  + +  EG +          + 
Sbjct: 757  NAGVKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTKL-SRPEGAL----------NA 804

Query: 1088 LDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHE 1147
            L+ + +   S       L + GE   +     K +  +++  + L   I  R +P +K +
Sbjct: 805  LEYLKINKSS------CLLIDGESLGMFLTYYKQEFFDIV--VDLPAVIACRCTPQQKAD 856

Query: 1148 LVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLF 1197
            +   ++ I G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F
Sbjct: 857  VALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 186/804 (23%), Positives = 324/804 (40%), Gaps = 133/804 (16%)

Query: 491  IFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWS 550
            I S+ L   D        I I+  +  +     +++S E L++L    C   + R G  S
Sbjct: 114  IISVFLGNIDDAISITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQEC--HLIRGGRES 170

Query: 551  QVPSSDLVPGDI--YELTDPSLSLLPCD-SILISGDCLVNESMLTGESVPVSKVAATRET 607
             V +++LVPGD+  + + D     +P D  I+   D  ++ES LTGE+ PV K      +
Sbjct: 171  NVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHK------S 220

Query: 608  MLQLLDDFMDTQLSSFV----SKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSL 663
               L  D  + Q +S V      +  + GT    V+   G+ I +G    TG  T+ G++
Sbjct: 221  YKALSRDSYNDQPNSIVPVAERTNIAYMGT---LVKEGNGRGIVVG----TGRETSFGNV 273

Query: 664  VRSMV-FPKP-TGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDII 721
               M    KP T  +   D  K    +S+ +     +  +  +  G     M   ++ + 
Sbjct: 274  FEMMSSIEKPKTPLQLTMD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLA 331

Query: 722  TVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDV 781
               +P  LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V
Sbjct: 332  VAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 391

Query: 782  LGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDG 841
              +  +  +  ++ +  L     D  +  +L + + T D+K      +L    S      
Sbjct: 392  SKIWCLGSMANKLNVLSL-----DKNKGGNLKNYL-TDDVKTTLLCGNLCNNASYSQEHA 445

Query: 842  ELLGDPFDFKMV-QFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR 900
            + LG+P D  ++ Q  K+   +      V S Y +  + S   +    A  I        
Sbjct: 446  KYLGNPTDVALLEQLQKFELAD------VRSEYTKVKELSFNSKRKMMATKIQ------- 492

Query: 901  FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD 960
              + E    + I  +FE + +     +  K   E      T G  E I + C+       
Sbjct: 493  --DNEKKTTLFIKGAFERILDKSSSYLTEKGKIE----KLTAGHRETIID-CA------- 538

Query: 961  YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK 1020
                 +     G RV+A A + +T  S     K+  ++I S+L F G I   +  + + K
Sbjct: 539  -----NTLASEGLRVLAFAKRAMTDSS----SKLVEDDI-SDLVFTGLIGMNDPPRSSVK 588

Query: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGL-VESPRVFVSVINDIDTSQEGDIITWQ 1079
              ++   +  I  IM TGD+  TA+++ R+ G+ V  P++ V                  
Sbjct: 589  FAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSV------------------ 630

Query: 1080 NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYAR 1139
                            LSGD             +L   TD  Q+  VI+++    +I+AR
Sbjct: 631  ----------------LSGD-------------KLNEMTD-DQLANVIDHV----NIFAR 656

Query: 1140 MSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF-- 1197
             +P+ K  +V  L+  G  V   GDG ND  ALK ADIG+S+      VA   +  +   
Sbjct: 657  ATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTD 716

Query: 1198 -EISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDL 1254
             + S +L  ++EG+     + +F  FQ  +  +A   V +   +   + L   Q L+I++
Sbjct: 717  DDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINI 776

Query: 1255 FLIVPLAVFMSWSKPYEVLAKKRP 1278
             +  P A  +        + KK P
Sbjct: 777  LMDGPPAQSLGVEPVDHEVMKKPP 800

>Kwal_23.5789
          Length = 1133

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 164/708 (23%), Positives = 298/708 (42%), Gaps = 121/708 (17%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            VPS DL  GD+ ++   + +  P D +L+     SG+  +    L GE+    ++A    
Sbjct: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308

Query: 607  TMLQLLDDFM----------DTQLSSFVSK-SF---------LFNGTKLIRVRATAGQSI 646
              L   DD +          +  +++F+ K +F         + N      V A+AG +I
Sbjct: 309  QHLSQ-DDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAI 367

Query: 647  ALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRL 706
            A   V  TG + T+ ++  SM   K TG    E     +  I    +F  +V+ + F   
Sbjct: 368  AC--VVYTG-ADTRQAMNTSMSSVK-TGL--LELEINSLSKILCACVFILSVALVAFAGF 421

Query: 707  GL-DKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV----GG 761
               D    I+R L + + ++P +L  +L +G     ++++       +  R +      G
Sbjct: 422  NNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLG 481

Query: 762  KIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTD-VKDLLQSLSLSDC--VST 818
            +I+ +  DKTGTLT++ +++  +H+   +   M    +VTD V+ +  +L+ S     S 
Sbjct: 482  RIEYLLSDKTGTLTQNDMELKKLHL-GTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK 540

Query: 819  RDM--KAKNFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETGNRKVHS 871
            +D+  + ++ +++L  CH +     DGEL      P +  +V+FT+              
Sbjct: 541  KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTE-------------- 586

Query: 872  LYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKP 931
                   G T+    R +  ++H      F          I+  F F S+ +RM +++  
Sbjct: 587  -----SVGLTLFRRDRHSITLLHDQSGTNF-------EYDILHVFPFNSDNKRMGIVIFD 634

Query: 932  FSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYS 991
              ++ +    KGA  V+ ++  K       E    +    G R +    K+L+++     
Sbjct: 635  KQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRLSKKLLQTF 691

Query: 992  QK---------VSRE---------EIESNLEFLGFIIFENKLKGTTKETLESLHRADIRT 1033
             K         ++RE          +E +LE LG    E+KL+   K ++E L  A I+ 
Sbjct: 692  TKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKI 751

Query: 1034 IMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTL 1093
             M TGD V TA  V   A LV   + +V  +  ++   EG                ++T 
Sbjct: 752  WMLTGDKVETARCVSISAKLVSRGQ-YVHTVTKVN-KPEG----------------ALTH 793

Query: 1094 RPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ 1153
              L     +  L + GE   L  +  + Q  E++ N  L   I  R +P +K ++   ++
Sbjct: 794  LELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVN--LPAVIACRCTPQQKADVATFIR 851

Query: 1154 SI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLF 1197
             + G +V   GDG ND   +++AD+G+ +   E   AS+AA F+   F
Sbjct: 852  EVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 173/781 (22%), Positives = 319/781 (40%), Gaps = 139/781 (17%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGES-------VPVS 599
            +PS DL  GD+ ++       +P D +L+     SG+  +    L GE+        P++
Sbjct: 265  IPSKDLKVGDLIKVHKGDR--IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLT 322

Query: 600  KVAATRETM--LQLLDDFMDTQLSSFVSKSFLFNGTK--------LIRVRATAGQSIALG 649
            +  +  + +  + +     +  +  F+ K    + T         L      A     + 
Sbjct: 323  QNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIA 382

Query: 650  MVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLD 709
             V  TG  T +   + +      TG    E     I  I    +F  ++  + F     D
Sbjct: 383  CVVYTGRDTRQA--MNTTTAKVKTGL--LELEINSISKILCACVFALSILLVAFAGFHND 438

Query: 710  KRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV----GGKID 764
               + ILR L + + ++P +L  +L +      ++++       +  R +      G+I+
Sbjct: 439  DWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIE 498

Query: 765  VMCFDKTGTLTEDGLDVLGVHV--VQPLQQEMKI-----SKLVTDVKDLLQSLSLSDCVS 817
             +  DKTGTLT++ + +  +H+  V    + + I       LV+   D L +  ++   +
Sbjct: 499  YLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTT 558

Query: 818  TRDM--KAKNFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETGNRKVH 870
             +DM  + ++ +++L  CH++     D EL      P +  +V+FT     E  G     
Sbjct: 559  RKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT-----ESVG----L 609

Query: 871  SLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIV 929
            SL++ +RH  S + E+S            G+ +  E      I++ F F S+ +RM +IV
Sbjct: 610  SLFKRDRHSISLLHEHS------------GKTLNYE------ILQVFPFNSDSKRMGIIV 651

Query: 930  KPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWL 989
            +    + +    KGA  V+ ++          E    +    G R +    KKL ++ + 
Sbjct: 652  RDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKLNKKIYE 708

Query: 990  YSQK---------VSREE---------IESNLEFLGFIIFENKLKGTTKETLESLHRADI 1031
              QK         ++R++         +E +LE LG    E+KL+   K ++E L  A I
Sbjct: 709  QFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGI 768

Query: 1032 RTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSV 1091
            +  M TGD V TA  V   A L+   + +V  I  + T  EG          + + L+ +
Sbjct: 769  KIWMLTGDKVETARCVSISAKLISRGQ-YVHTITKV-TRPEG----------AFNQLEYL 816

Query: 1092 TLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVER 1151
             +        +  L + GE   +  K  + +  +V+  + L T I  R +P +K ++   
Sbjct: 817  KINR------NACLLIDGESLGMFLKHYEQEFFDVV--VHLPTVIACRCTPQQKADVALV 868

Query: 1152 LQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEISCVLD--V 1205
            ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F   C L   +
Sbjct: 869  IRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTELL 925

Query: 1206 MKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMS 1265
            +  GR +         Y       QFV       RG  +   Q +Y    L  P+A++  
Sbjct: 926  LWHGRNS---------YKRSAKLAQFVM-----HRGLIIAICQAVYSICSLFEPIALYQG 971

Query: 1266 W 1266
            W
Sbjct: 972  W 972

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 179/832 (21%), Positives = 314/832 (37%), Gaps = 166/832 (19%)

Query: 540  DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVS 599
            +V V R+G    +   DL+ GD+  L   +  ++P D IL+ G C  +ES +TGES  + 
Sbjct: 184  EVVVVRNGDKHVISVHDLLVGDLLSLQ--TGDVVPVDCILVEGKCECDESGITGESDTIK 241

Query: 600  KV--AATRETMLQLLDDFMDTQLS------SFVSKSFLFNGTKLIRVRATAGQSIALGMV 651
            KV  A + +    +  D     +       S V    L +G+KL+         I   +V
Sbjct: 242  KVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLL-------SGIGHAVV 294

Query: 652  ARTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFL-- 704
               G  +  G ++ ++       P         D     G  S+ A   F V F++FL  
Sbjct: 295  TAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYG--SVAAFLLFVVLFLRFLSY 352

Query: 705  ----RL--GLDKRTMILRALDII-------TVVVPPALPASLSIGTGFALNRLKKKGIFC 751
                RL   L       R +DI         V VP  LP ++++   FA  R+ K G   
Sbjct: 353  LPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLV 412

Query: 752  ISPTRVNVGGKIDVMCFDKTGTLTEDGLDV----LGVHVVQPLQQEMKISKLVTDVKDLL 807
                     G    +C DKTGTLT++ + V    LG      + ++   ++     +D+ 
Sbjct: 413  RVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSDALRQDMS 472

Query: 808  QSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNR 867
            Q  +L+D ++   + +  F        + ++ D  +  +P+         WS       R
Sbjct: 473  QH-TLNDILANIALNSTAF-------ENKQVADPVITENPYHKPRRSLFPWS-------R 517

Query: 868  KVHSLYEERHDGSTMPE----NSRFAPAIVHPSGKGRFIE-----REPSNVIG---IVRS 915
                 Y    D S         S+   A++  +     +E     R+  + IG   IV+ 
Sbjct: 518  NNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQM 577

Query: 916  FEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELC------SKQTLPLDYE------A 963
              F S+ +   ++V+    N +  F KGA E IF+ C      +   + L  +       
Sbjct: 578  IPFESSRKWAGLVVRLVDGN-YRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFG 636

Query: 964  LLHHYTHNGYRVIACAGKKLTR-QSWLYSQ-----------------------KVSREEI 999
            L+++   +  R I+ A K  T   SW  ++                          R  I
Sbjct: 637  LINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSI 696

Query: 1000 ESN----LEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVE 1055
             +N    L   G +   + L+   KE++++  ++ +   M TGDN+ T  ++ R  G++ 
Sbjct: 697  ITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILS 756

Query: 1056 SPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLL 1115
                                                       +  D+  A+ G VFR  
Sbjct: 757  -----------------------------------------ESEYADHECAMEGPVFR-- 773

Query: 1116 FKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAA 1175
             K  + Q+ +       K  + AR SP++K   V+ L+ +   V   GDG ND  AL  A
Sbjct: 774  -KLSRRQMMDAAP----KLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLA 828

Query: 1176 DIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRAA--LVTSFACFQYMSLYSATQ 1230
            D+G S+  +   VA   +  +    + + +++ +K GR     +  F  FQ     +A  
Sbjct: 829  DVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVT 888

Query: 1231 FVTILILYSRGSN--LGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRPTA 1280
               +  + S   N  L   Q L+++L +    A+ ++  KP   + ++ PT 
Sbjct: 889  LTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTG 940

>Scas_704.38
          Length = 1161

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 160/705 (22%), Positives = 294/705 (41%), Gaps = 118/705 (16%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            VPS DL  GD+ +++      LP D +L+     SG+  +    L GE+    ++A    
Sbjct: 275  VPSKDLKVGDLIKISKGDR--LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT 332

Query: 607  TMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALG-------MVARTGFST- 658
              L   D      +++   +  + N    +  + T+   +++        ++A TGF   
Sbjct: 333  QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392

Query: 659  --------TKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDK 710
                    T+ ++  +    K    +   +S   I   S+ AL    V F  F     D 
Sbjct: 393  CVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFH--NSDW 450

Query: 711  RTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV----GGKIDVM 766
               ++R L + + ++P +L  +L +      ++++       +  R +      G+I+ +
Sbjct: 451  YLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYL 510

Query: 767  CFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSD--------CVST 818
              DKTGTLT++ + +  +H+   +    +   +V+D  D L + S S           S 
Sbjct: 511  LSDKTGTLTQNDMQLKKIHL-GTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSR 569

Query: 819  RDMKAK--NFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETGNRKVHS 871
            +D+ A+  + +V+L  CH++     D EL      P +  +V+FT     E  G     S
Sbjct: 570  KDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT-----ESVG----LS 620

Query: 872  LYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVK 930
            L++ +RH  S +  +S            G  +  E      I++ F F S+ +RM +IV 
Sbjct: 621  LFKRDRHSISLLHGHS------------GSILTYE------ILQVFPFNSDSKRMGIIVH 662

Query: 931  PFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLY 990
               ++ +    KGA  V+  +          E    +    G R +    KKL+R  +  
Sbjct: 663  DEQKDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQ 719

Query: 991  SQK---------VSREE---------IESNLEFLGFIIFENKLKGTTKETLESLHRADIR 1032
             +K         V+R++         +E +LE LG    E+KL+   K ++E L  A I+
Sbjct: 720  FKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIK 779

Query: 1033 TIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVT 1092
              M TGD V TA  V   A L+   + +V +I  + T  EG +          + L+ + 
Sbjct: 780  IWMLTGDKVETARCVSISAKLISRGQ-YVHIITKL-TKPEGAL----------NQLEYLK 827

Query: 1093 LRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERL 1152
            +   +       L + GE   +  +  K +  +V+  I L T +  R +P +K ++   +
Sbjct: 828  VNKGA------CLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVI 879

Query: 1153 QSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFT 1193
            +   G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+
Sbjct: 880  REFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 177/787 (22%), Positives = 312/787 (39%), Gaps = 157/787 (19%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            +PS DL  GDI +L   +   +P D +++     +G+  +    L GE+    ++A +  
Sbjct: 268  IPSKDLKVGDIIKLKKGAR--VPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLT 325

Query: 607  TML---QLLDD--------------------FMDTQLSSFVSKSFLFNGTKLIRVRATAG 643
              L    LL++                    + D+  S     + ++  T L    A   
Sbjct: 326  QSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACIC 385

Query: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703
              +  G   R   +TTK      ++  +  G      +  ++  I ++A  GF  +    
Sbjct: 386  CIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---- 441

Query: 704  LRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV---- 759
                 D    I+R L + + ++P +L  +L +G      +++       +  R +     
Sbjct: 442  -----DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPED 496

Query: 760  GGKIDVMCFDKTGTLTEDGLDVLGVHV--VQPLQQEMKISKLVTDVKDLLQSLSLSDCVS 817
             G+I+ +  DKTGTLT++ + +  +H+  V    + M I      V D +QS++     S
Sbjct: 497  LGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDI------VTDFIQSMNSRTSNS 550

Query: 818  TRDMKAKN-------FLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETG 865
            T     KN        + +L  CH++     DGEL      P +  +V+FT     E  G
Sbjct: 551  TPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT-----ESVG 605

Query: 866  NRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRM 925
               +     +RH  S   ++S            G  +E +    I I+  F F S+ +RM
Sbjct: 606  ---LSLFRRDRHSISLFHDHS------------GMKLEYD----IKIL--FPFNSDSKRM 644

Query: 926  SVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTR 985
             VI+    +  +    KGA  V+  +  +       E    +    G R +    KKL+ 
Sbjct: 645  GVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLST 701

Query: 986  QSW------------------LYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLH 1027
              +                  ++ Q V R+ +E++LE LG    E+KL+   K ++E L 
Sbjct: 702  NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761

Query: 1028 RADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDI--ITWQNVANSS 1085
             A I+  M TGD V TA  V   A L+   + +V  +  ++   EG +  + +  V  +S
Sbjct: 762  NAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTKVN-KPEGALHHLEYLQVNQNS 819

Query: 1086 DTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEK 1145
                               L + GE   L  +    +  +++ N  L T +  R +P +K
Sbjct: 820  ------------------CLLIDGESLGLYLQYFPDEFFDIVVN--LPTVVACRCTPQQK 859

Query: 1146 HELVERL-QSIGYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEISC 1201
             ++   + Q+ G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F   C
Sbjct: 860  ADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---C 916

Query: 1202 VLD--VMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVP 1259
             L   ++  GR +         Y S    +QFV       RG  +   Q +Y    +  P
Sbjct: 917  HLTKLLLWHGRNS---------YKSSAKLSQFVI-----HRGLIISVCQAVYSICSMFEP 962

Query: 1260 LAVFMSW 1266
            LA++  W
Sbjct: 963  LALYQGW 969

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 187/843 (22%), Positives = 330/843 (39%), Gaps = 147/843 (17%)

Query: 446  VSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAY--- 502
            ++ GL  +    R+ A G+N++    K   + +    LH      I  +++ M  ++   
Sbjct: 33   LTEGLTQDESLRRLKAVGENTLGDDTKIDYKAM---VLHQVCNAMIMVLVISMAISFAVR 89

Query: 503  -YYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPG 560
             +     I  +  ++V+  LV+  ++++ ++ L      +  V R+G    + S D+VPG
Sbjct: 90   DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPG 149

Query: 561  DI--YELTDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVA-----ATRETMLQLL 612
            DI   ++ D     +P D  LI       +ES+LTGES+PVSK A        ET +   
Sbjct: 150  DICLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG-- 203

Query: 613  DDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIAL---------GMVAR---------T 654
                D    +F S + +    K I ++      I           G+++R         T
Sbjct: 204  ----DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNT 259

Query: 655  GFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMI 714
              ST K   V         G   +    K    +  IA+  FA+  +   +  +DKR  I
Sbjct: 260  WISTKK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAI 315

Query: 715  LRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTL 774
              A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTGTL
Sbjct: 316  Y-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 775  TEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMK-AKNFLVSLLTC 833
            T+  +  L   +  P    + IS           ++SL    S  +    ++  V +L  
Sbjct: 375  TQGKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 834  HSLRMVDGELLGDPFDFKMVQFTKWSD------------EEETGNRKVHS--------LY 873
               R+ + +L   P D  M  F KW +            ++ T   K H         ++
Sbjct: 433  FKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489

Query: 874  EERHDGSTMPENSRFAPAIVHPSGKG------RFIEREPSNVIGIVRSFEFLSNLRRMSV 927
              + D   +P N+       + S +       +  E+  S     +  F F S ++RMS 
Sbjct: 490  ATKMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 928  IVKPFSENVFMSFTKGAPEVIFELCSK-------QTLPL---DYEAL---LHHYTHNGYR 974
            +        +  + KGA E I   CS        +  PL   D E +   ++  ++ G R
Sbjct: 547  VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606

Query: 975  VIACAGKKLTRQS----WLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRAD 1030
            V+  A K  T+       L +   +R   ES+L FLG I   +  +  T   ++  H+A 
Sbjct: 607  VLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAG 666

Query: 1031 IRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDS 1090
            I   M TGD V TA ++ +E G++ +        N    SQE               +DS
Sbjct: 667  INVHMLTGDFVGTAKAIAQEVGILPT--------NLYHYSQE--------------IVDS 704

Query: 1091 VTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE 1150
                          + +TG  F  L        EE ++++ +   + AR SP  K  ++E
Sbjct: 705  --------------MVMTGSQFDGLS-------EEEVDDLPVLPLVIARCSPQTKVRMIE 743

Query: 1151 RLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMK 1207
             L          GDG ND  +LK A++GI++    + V+   +  +      + +L+ ++
Sbjct: 744  ALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVE 803

Query: 1208 EGR 1210
            EGR
Sbjct: 804  EGR 806

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 187/843 (22%), Positives = 330/843 (39%), Gaps = 147/843 (17%)

Query: 446  VSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAY--- 502
            ++ GL  +    R+ A G+N++    K   + +    LH      I  +++ M  ++   
Sbjct: 33   LTEGLTQDESLRRLKAVGENTLGDDTKIDYKAM---VLHQVCNAMIMVLVISMAISFAVR 89

Query: 503  -YYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPG 560
             +     I  +  ++V+  LV+  ++++ ++ L      +  V R+G    + S D+VPG
Sbjct: 90   DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPG 149

Query: 561  DI--YELTDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVA-----ATRETMLQLL 612
            DI   ++ D     +P D  LI       +ES+LTGES+PVSK A        ET +   
Sbjct: 150  DICLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG-- 203

Query: 613  DDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIAL---------GMVAR---------T 654
                D    +F S + +    K I ++      I           G+++R         T
Sbjct: 204  ----DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNT 259

Query: 655  GFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMI 714
              ST K   V         G   +    K    +  IA+  FA+  +   +  +DKR  I
Sbjct: 260  WISTKK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAI 315

Query: 715  LRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTL 774
              A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTGTL
Sbjct: 316  Y-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 775  TEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMK-AKNFLVSLLTC 833
            T+  +  L   +  P    + IS           ++SL    S  +    ++  V +L  
Sbjct: 375  TQGKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQN 432

Query: 834  HSLRMVDGELLGDPFDFKMVQFTKWSD------------EEETGNRKVHS--------LY 873
               R+ + +L   P D  M  F KW +            ++ T   K H         ++
Sbjct: 433  FKDRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVF 489

Query: 874  EERHDGSTMPENSRFAPAIVHPSGKG------RFIEREPSNVIGIVRSFEFLSNLRRMSV 927
              + D   +P N+       + S +       +  E+  S     +  F F S ++RMS 
Sbjct: 490  ATKMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 928  IVKPFSENVFMSFTKGAPEVIFELCSK-------QTLPL---DYEAL---LHHYTHNGYR 974
            +        +  + KGA E I   CS        +  PL   D E +   ++  ++ G R
Sbjct: 547  VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606

Query: 975  VIACAGKKLTRQS----WLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRAD 1030
            V+  A K  T+       L +   +R   ES+L FLG I   +  +  T   ++  H+A 
Sbjct: 607  VLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAG 666

Query: 1031 IRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDS 1090
            I   M TGD V TA ++ +E G++ +        N    SQE               +DS
Sbjct: 667  INVHMLTGDFVGTAKAIAQEVGILPT--------NLYHYSQE--------------IVDS 704

Query: 1091 VTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE 1150
                          + +TG  F  L        EE ++++ +   + AR SP  K  ++E
Sbjct: 705  --------------MVMTGSQFDGLS-------EEEVDDLPVLPLVIARCSPQTKVRMIE 743

Query: 1151 RLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMK 1207
             L          GDG ND  +LK A++GI++    + V+   +  +      + +L+ ++
Sbjct: 744  ALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVE 803

Query: 1208 EGR 1210
            EGR
Sbjct: 804  EGR 806

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 188/841 (22%), Positives = 328/841 (39%), Gaps = 143/841 (17%)

Query: 446  VSRGLPNNIHEDRMIAFGKNSINLRQKT--TSQILFDEALHPFYIFQIFSIILWMFDAYY 503
            ++ GL  +    R+   G+N++    K    + +L         +  I  II +    + 
Sbjct: 33   LTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHDWI 92

Query: 504  YYATCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGDI 562
                  F+I+V +V+  LV+  ++++ ++ L      +  V R+G    + S D+VPGDI
Sbjct: 93   TGGVISFVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDI 151

Query: 563  --YELTDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVA-----ATRETMLQLLDD 614
               ++ D     +P D  LI       +ES+LTGES+PVSK A        ET +     
Sbjct: 152  CLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG---- 203

Query: 615  FMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIAL---------GMVAR---------TGF 656
              D    +F S + +    K I ++      I           G+++R         T  
Sbjct: 204  --DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWI 261

Query: 657  STTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILR 716
            ST K   V         G   +    K    +  IA+  FA+  +   +  +DKR  I  
Sbjct: 262  STKK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY- 316

Query: 717  ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTE 776
            A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTGTLT+
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 777  DGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMK-AKNFLVSLLTCHS 835
              +  L   +  P    + IS           ++SL    S  +    ++  V +L    
Sbjct: 377  GKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFK 434

Query: 836  LRMVDGELLGDPFDFKMVQFTKWSD------------EEETGNRKVHS--------LYEE 875
             R+ + +L   P D  M  F KW +            ++ T   K H         ++  
Sbjct: 435  DRLYEKDL---PEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFAT 491

Query: 876  RHDGSTMPENSRFAPAIVHPSGKG------RFIEREPSNVIGIVRSFEFLSNLRRMSVIV 929
            + D   +P N+       + S +       +  E+  S     +  F F S ++RMS + 
Sbjct: 492  KMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVY 548

Query: 930  KPFSENVFMSFTKGAPEVIFELCSK-------QTLPL---DYEAL---LHHYTHNGYRVI 976
                   +  + KGA E I   CS        +  PL   D E +   ++  ++ G RV+
Sbjct: 549  YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVL 608

Query: 977  ACAGKKLTRQS----WLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIR 1032
              A K  T+       L +   +R   ES+L FLG I   +  +  T   ++  H+A I 
Sbjct: 609  GFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668

Query: 1033 TIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVT 1092
              M TGD V TA ++ +E G++ +        N    SQE               +DS  
Sbjct: 669  VHMLTGDFVGTAKAIAQEVGILPT--------NLYHYSQE--------------IVDS-- 704

Query: 1093 LRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERL 1152
                        + +TG  F  L        EE ++++ +   + AR SP  K  ++E L
Sbjct: 705  ------------MVMTGSQFDGLS-------EEEVDDLPVLPLVIARCSPQTKVRMIEAL 745

Query: 1153 QSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEG 1209
                      GDG ND  +LK A++GI++    + V+   +  +      + +L+ ++EG
Sbjct: 746  HRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEG 805

Query: 1210 R 1210
            R
Sbjct: 806  R 806

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 169/721 (23%), Positives = 290/721 (40%), Gaps = 143/721 (19%)

Query: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606
            V S DL  GD+ +++  +   +P D IL+     SG+  +    L GE+    ++A T  
Sbjct: 259  VASKDLKVGDLIKISKGAR--VPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLT 316

Query: 607  TMLQ---LLDD--------------------FMDTQLSSFVSKSFLFNGTKLIRVRATAG 643
              L    LL+                     + DT  S     + L+  T L       G
Sbjct: 317  QNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIG 376

Query: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703
              I  G   R   +TT   +         TG    E     I  I    +F  ++  + F
Sbjct: 377  CVIYTGRDTRQAMNTTSAKV--------KTGL--LELEINDISKILCACVFILSILLVVF 426

Query: 704  LRLGLDKRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759
              L  D   + I+R L + + ++P +L  +L +      ++++       +  R +    
Sbjct: 427  AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 486

Query: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSL--SLSDCV 816
              G+I+ +  DKTGTLT++ + +  VH    L      ++    V D +Q +  S +D V
Sbjct: 487  DLGRIEYLLSDKTGTLTQNDMQLKKVH----LGNVSYTTETADIVSDYIQGMIESKNDSV 542

Query: 817  ------STRDMKAKNFLVSLLT----CHSLR--MVDGELL---GDPFDFKMVQFTKWSDE 861
                  ST    A   ++ L+T    CH++     D EL      P +  +V+FT     
Sbjct: 543  TNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT----- 597

Query: 862  EETGNRKVHSLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLS 920
            E  G     SL++ +RH  S + E+S            G  +  +      ++  F F S
Sbjct: 598  ESVG----LSLFKRDRHSMSLLHEHS------------GTILNYD------VLTMFPFNS 635

Query: 921  NLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAG 980
            + +RM +IV    ++ +    KGA  V+  + +        E    +    G R +    
Sbjct: 636  DTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGR 692

Query: 981  KKLTRQSWLYSQ-KVSREEI-------------------ESNLEFLGFIIFENKLKGTTK 1020
            KKLT++  +Y Q K   EE+                   E +LE LG    E+KL+   K
Sbjct: 693  KKLTKK--IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVK 750

Query: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQN 1080
             ++E L  A I+  M TGD V TA  V   A L+   + +V V+  + +  EG       
Sbjct: 751  SSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHVVTKL-SKPEG------- 801

Query: 1081 VANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARM 1140
               + + L+ + +        +  L + GE   +  K  + +  +V+  + L T I  R 
Sbjct: 802  ---AFNQLEYLKVNK------NACLLIDGESLGMFLKYYRQEFFDVV--VHLPTVIACRC 850

Query: 1141 SPDEKHELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRL 1196
            +P +K ++   ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   
Sbjct: 851  TPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQ 910

Query: 1197 F 1197
            F
Sbjct: 911  F 911

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 122/301 (40%), Gaps = 62/301 (20%)

Query: 966  HHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLES 1025
            H    +G R IACA K         S  V  E+  + L F G     +  +   K ++E 
Sbjct: 535  HSCASDGLRTIACAFKPTD------SDNVISEDDINGLTFTGLFGLADPPRPNVKASIEK 588

Query: 1026 LHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSS 1085
            LHR  +  IM TGD+V TA+S+  + GL    R             E  ++T   V+  +
Sbjct: 589  LHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDR-------------ESSVMTGDKVSELT 635

Query: 1086 DTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEK 1145
                                                  E+ ++ ++ K +I+AR +P+ K
Sbjct: 636  --------------------------------------EDELSKVIDKVNIFARATPENK 657

Query: 1146 HELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCV 1202
              +V+ L+  G  V   GDG ND  ALK ADIGI++  +   VA   +  +    + S +
Sbjct: 658  LNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMILTDDDFSSI 717

Query: 1203 LDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPL 1260
            L  ++EG+     + +F  FQ     +    + I  +    + L   Q L+I++ +  P 
Sbjct: 718  LTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQILWINIIMDGPP 777

Query: 1261 A 1261
            A
Sbjct: 778  A 778

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 134/298 (44%), Gaps = 30/298 (10%)

Query: 491 IFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWS 550
           + S  +   D     +  I I+  +  I     +++S E L++L    C   + R G  S
Sbjct: 116 VLSFAIGQIDDAVSISLAILIVVTVGFIQEY-RSEKSLEALNKLVPTKC--HLIRYGRES 172

Query: 551 QVPSSDLVPGDI--YELTDPSLSLLPCDSILISG-DCLVNESMLTGESVPVSKVAATRET 607
              +S+LVPGD+  +++ D     +P D  +I   D  ++ES LTGE+ P+ K A T + 
Sbjct: 173 NTLASELVPGDLVRFKIGDR----IPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDP 228

Query: 608 MLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGS---LV 664
                +++ +  +         + GT    V+   G+ I +G    TG +T+ G+   +V
Sbjct: 229 -----EEYDNRNVPVSERSCIAYMGT---LVKEGHGKGIVIG----TGTNTSYGAIFEMV 276

Query: 665 RSMVFPKPTGFKFYEDSFKYIGY-ISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITV 723
            S+  PK       +++   +G  +S I+ F  A+  I  +  G     M   ++ +   
Sbjct: 277 NSIEKPKTP----LQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVA 332

Query: 724 VVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDV 781
            +P  LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V
Sbjct: 333 AIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTV 390

>Scas_499.3
          Length = 346

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 97/183 (53%), Gaps = 20/183 (10%)

Query: 462 FGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTL 521
           +G+N+ ++   T  ++  + A+ P ++FQ+F + LW+ D ++YY+    + +++ ++   
Sbjct: 177 YGENAFDIPVPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYYS----LFNLMMIVS-- 230

Query: 522 VETKQSSERLSELSQFYC------DVRVYRDGFWSQVPSSDLVPGDIYELTDPS-LSLLP 574
           +E     +RL  L +F         + V R+  W  + +++L+  D+  LT  +  S +P
Sbjct: 231 MEGAAVFQRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESAIP 290

Query: 575 CDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTK 634
           CD ILI G C+VNE+M +GES P+ K +      +QL     D  L S    S L  GT+
Sbjct: 291 CDMILIDGACIVNEAM-SGESTPLLKES------IQLRPGEDDLLLESIDKISVLHGGTE 343

Query: 635 LIR 637
            ++
Sbjct: 344 TLQ 346

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 143/330 (43%), Gaps = 56/330 (16%)

Query: 900  RFIEREPSNVIGIVRS-------------FEFLSNLRRMSVIVKPFSENVFMSFTKGAPE 946
            +FI R+P N + I+R               EF S  +RMS I + F +N      KGA  
Sbjct: 664  KFIIRKP-NSVTILREDITEEVVYELLNICEFNSTRKRMSAIFR-FPDNSIRLLCKGADT 721

Query: 947  VIFELCSKQTLPLDYEALLH--HYTHNGYRVIACAGKKLTR---QSW--LY--------- 990
            VI E  +  + P     L H   Y   G R +  A + +     + W  LY         
Sbjct: 722  VILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHN 781

Query: 991  -SQKVSR--EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISV 1047
             S+++ +  E IE  L  LG    E+KL+    ET+ +L +A I+  + TGD   TAI++
Sbjct: 782  RSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINI 841

Query: 1048 GREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLS-GDTDDYTLA 1106
            G    L+      + V  D   S   ++I         D L ++    +S  D +   L 
Sbjct: 842  GMSCKLLSEDMNLLIVNEDTKESTRNNLI---------DKLRAINDHQISQQDMNTLALV 892

Query: 1107 VTGEVFRLLFKTDKSQIEEVINNI--LLKTSIYARMSPDEKHELVE----RLQSIGYQVG 1160
            + G+      + D   +EE +  I  + +  I  R+SP +K  +V+    R +S+   + 
Sbjct: 893  IDGKSLGFALEPD---LEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAI- 948

Query: 1161 FCGDGANDCGALKAADIGISLSEAEASVAA 1190
              GDGAND   ++AA +G+ +S  E   AA
Sbjct: 949  --GDGANDVSMIQAAHVGVGISGMEGMQAA 976

>Kwal_47.17547
          Length = 1240

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 131/305 (42%), Gaps = 63/305 (20%)

Query: 989  LYSQKVSR--------EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDN 1040
            L+  +VSR        +E+ S +   G +  ++ L+   ++++E   +A +   M TGDN
Sbjct: 693  LFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDN 752

Query: 1041 VLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDT 1100
            +LTA ++ ++                        I++ +   N   +++    R LS   
Sbjct: 753  ILTATAIAKKCS----------------------ILSEEQAENPESSMEGPRFRKLS--- 787

Query: 1101 DDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG 1160
                              +K ++      IL    + AR SP++K  LVE L+ +G  V 
Sbjct: 788  ------------------NKERVR-----ILPNLRVLARSSPEDKRILVETLKKMGDVVA 824

Query: 1161 FCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGR--AALVT 1215
              GDG ND  ALK AD+G S+  A   VA   +  +    + S +++ +K GR  +  + 
Sbjct: 825  VTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIK 884

Query: 1216 SFACFQYMSLYSAT--QFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVL 1273
             F  FQ     +A    FV+ +      S L   Q L+++L +    A+ ++  KP E +
Sbjct: 885  KFIQFQLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENI 944

Query: 1274 AKKRP 1278
             +++P
Sbjct: 945  LERKP 949

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 114/267 (42%), Gaps = 33/267 (12%)

Query: 540 DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVS 599
           +V V R+G    +   D++ GDI  L   +  ++P D IL+ G C  +ES LTGES  + 
Sbjct: 187 EVIVLRNGDEHLISIHDILVGDILSLQ--TGDVVPADCILVKGSCECDESALTGESATIK 244

Query: 600 KVAA----TRETMLQLLDDFMD--TQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVAR 653
           K A      +   L   D  +D  T  +  V    L +G+KL+         +   +V  
Sbjct: 245 KAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLL-------SGLGRAVVTS 297

Query: 654 TGFSTTKG-SLVRSMVFPKPTGFKFYEDSF--KYIGYISIIALFGFAVSFIQFL------ 704
            G ++  G +L+   V  + T  +   DS       Y S  AL  F + F++FL      
Sbjct: 298 VGVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKG 357

Query: 705 ---------RLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPT 755
                    + G     + +  + +I V VP  LP ++++   FA  R+ K G       
Sbjct: 358 GELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLR 417

Query: 756 RVNVGGKIDVMCFDKTGTLTEDGLDVL 782
                G    +C DKTGTLTE+ + V+
Sbjct: 418 ACETMGSATAVCSDKTGTLTENRMTVV 444

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 184/829 (22%), Positives = 320/829 (38%), Gaps = 162/829 (19%)

Query: 509  IFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDP 568
            + ++ ++S +   VE  + S    EL+   CDV   R G + +    D+  GDI  +   
Sbjct: 258  LLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVR-- 315

Query: 569  SLSLLPCDSILIS-----GDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623
            S   +P D I++S     G C +  + L GE+    K+   R+     LD+    +L   
Sbjct: 316  SEEAIPADLIILSSSEPEGLCYIETANLDGETNL--KIKQARQETANYLDEKALCKLHGR 373

Query: 624  V------SKSFLFNGTK--------------LIRVRATAGQSIALGMVARTGFSTTKGSL 663
            V      S  + + GT               L+R       +   G++  TG  T    L
Sbjct: 374  VQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET---KL 430

Query: 664  VRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAV------------------SFIQFLR 705
            +R+      T       + + +  + I+ALFG  +                  + + +L 
Sbjct: 431  MRN-----ATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLY 485

Query: 706  L-GLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCI------------ 752
            + G +K  +  + +    ++    +P SL +     +  +K    + I            
Sbjct: 486  IEGTNKAGLFFKDILTFWILFSNLVPISLFV----TVEMIKYYQAYMIGSDLDLYHEESD 541

Query: 753  SPTRVNVG------GKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDL 806
            +PT V         G+I+ +  DKTGTLT + ++   V +      E         V+D 
Sbjct: 542  TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDG 601

Query: 807  LQS-----LSLSDCVST-RDMKAK---NFLVSLLTCHSL---RMVDGEL---LGDPFDFK 851
            ++       SL D ++   D +A     FL  L TCH++      DG +      P +  
Sbjct: 602  IEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGA 661

Query: 852  MVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIG 911
            +VQ          G   +   ++ R   S          +I  P     F E+    ++ 
Sbjct: 662  LVQ----------GAADLGFRFDIRRPNSV---------SISTP-----FSEQLEYQLLN 697

Query: 912  IVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLH--HYT 969
            I    EF S  +RMS I +   +     F KGA  VI E    +  P     L H   Y 
Sbjct: 698  IC---EFNSTRKRMSAIFR-MPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYA 753

Query: 970  HNGYRVIACAGKKLTRQSWLYSQKV-----------------SREEIESNLEFLGFIIFE 1012
              G R +  A + +  + +    K+                 + E IE +L FLG    E
Sbjct: 754  AEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIE 813

Query: 1013 NKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQE 1072
            +KL+    ET+  L  A ++  + TGD   TAI++G       S R+    +N +  ++E
Sbjct: 814  DKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM------SCRLLSEDMNLLIVNEE 867

Query: 1073 GDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNI-- 1130
                T  N+ +  + ++S  +     D +   L + G+      + D   +E+    I  
Sbjct: 868  TKEDTRTNLQSKLNAIESHQIS--QQDMNSLALVIDGKSLGYALEED---LEDQFLTIGK 922

Query: 1131 LLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAE---A 1186
            L K  I  R+SP +K  +V+ ++     +    GDGAND   ++AA +G+ +S  E   A
Sbjct: 923  LCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 982

Query: 1187 SVAAPFTSRLFEISCVLDVMKEG----RAALVTSFACFQYMSLYSATQF 1231
            + +A F    F     L ++       R +L   ++ ++ M+LY  TQF
Sbjct: 983  ARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY-MTQF 1030

>Kwal_26.7070
          Length = 1315

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 148/327 (45%), Gaps = 50/327 (15%)

Query: 900  RFIEREPSNVIGIVRSF------------EFLSNLRRMSVIVKPFSENVFMSFTKGAPEV 947
            +FI R+P++V  ++               EF S  +RMS I +  +  + + F KGA  V
Sbjct: 667  KFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKL-FCKGADTV 725

Query: 948  IFELCSKQTLPLDYEALLHH---YTHNGYRVIACAGKKLTRQSW-----LY--------- 990
            I E       P   EA L H   Y   G R +  A + +T   +     +Y         
Sbjct: 726  ILERLKAGENPY-IEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDD 784

Query: 991  -SQKV--SREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISV 1047
             +QK+  + E IE +L  LG    E+KL+    ET+ +L  A I+  + TGD   TA+++
Sbjct: 785  RAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNI 844

Query: 1048 GREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLS-GDTDDYTLA 1106
            G       S R+    +N +  ++E    T +N+   ++ L +++   +S  D +   L 
Sbjct: 845  GM------SCRLLSEDMNLLIINEEDKEATRKNL---TEKLKAISDHQISQQDMNSLALV 895

Query: 1107 VTGEVFRLLFKTDKSQIEEVINNI--LLKTSIYARMSPDEKHELVERLQSIGYQVGFC-G 1163
            + G+      + D   +E+ +  I  L K  I  R+SP +K  +V+ ++     +    G
Sbjct: 896  IDGKSLGFALEAD---LEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIG 952

Query: 1164 DGANDCGALKAADIGISLSEAEASVAA 1190
            DGAND   ++AA +G+ +S  E   AA
Sbjct: 953  DGANDVSMIQAAHVGVGISGMEGMQAA 979

>Scas_576.8
          Length = 1591

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 138/324 (42%), Gaps = 50/324 (15%)

Query: 912  IVRSFEFLSNLRRMSVIVK-----PFSENVFMSFTKGAPEVIFELCSKQTLP-----LDY 961
            I+ + EF S  +RMS IVK     P  E   +   KGA  +I+     +        L+ 
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNGANSENLLEK 911

Query: 962  EAL-LHHYTHNGYRVIACAGKKLTRQSWLYSQK---------VSREE--------IESNL 1003
             AL L  Y   G R +  A ++L+   +L   K          +REE        IE  L
Sbjct: 912  TALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIEREL 971

Query: 1004 EFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSV 1063
              LG    E++L+    E++  L +A I+  + TGD V TAI++G    L+ +    + V
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1031

Query: 1064 INDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDT-----------------DDYTLA 1106
              + D  QE       + A  +++L +  LR   G T                  D+ + 
Sbjct: 1032 KTNGDDVQE----FGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFPRGDFAVV 1087

Query: 1107 VTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVER-LQSIGYQVGFCGDG 1165
            + GE  +L    +  + + ++     K  +  R+SP +K  +V+  + S+       GDG
Sbjct: 1088 IDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDG 1147

Query: 1166 ANDCGALKAADIGISLSEAEASVA 1189
            +ND   +++AD+G+ ++  E   A
Sbjct: 1148 SNDVAMIQSADVGVGIAGEEGRQA 1171

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 176/837 (21%), Positives = 317/837 (37%), Gaps = 148/837 (17%)

Query: 446  VSRGLPNNIHEDRMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWMFDAYYY 504
            +++GL      +R+   G+N++    K   + I   +  +   +  I S+++      + 
Sbjct: 35   INQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIMVLIISMVISFAIKDWI 94

Query: 505  YATCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGDIY 563
                I  +  ++V+    +   +S+ ++ L         V R G    + S +LVPGDI 
Sbjct: 95   SGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVPGDIC 154

Query: 564  ELTDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSS 622
             +       +P D  L     L  +E++LTGES+PV+K  +  E   Q      DT +  
Sbjct: 155  IIR--VGDTVPADLRLFEAINLETDEALLTGESLPVAK--SHGEVYEQ------DTPVGD 204

Query: 623  FVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSF 682
             ++ +F           +T  +  A G+V +T  +T  G + +S+   K        D  
Sbjct: 205  RLNLAF---------AASTVTKGRATGIVIKTALNTEIGKIAKSL---KSEASLISRDKS 252

Query: 683  KYIG---YI----SIIALFGFAV--------SFIQFL-----------RLGLDK----RT 712
            K  G   +I    SI    G +V        S +  L            +G  K    + 
Sbjct: 253  KSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQ 312

Query: 713  MILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTG 772
            + + A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTG
Sbjct: 313  VAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTG 372

Query: 773  TLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFL-VSLL 831
            TLT+  +  +   V  P    + +          +  + L    S    K  +   V ++
Sbjct: 373  TLTQGKM--IAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMI 430

Query: 832  TCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGN-----RKVHSLYEERHDGSTMPENS 886
            T    +    EL   P +  +  FT+W       N     R   +   + H   T     
Sbjct: 431  TDFKSKYYADEL--GPLNVSL--FTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQ 486

Query: 887  RFAPAIVHP----SGKGRFIEREPSNVIGI--VRSFEFLSNLRRMSVIVKPFSEN---VF 937
             FA  +  P    +G+    E+   N I    V  + F S+++RMS I K   E    ++
Sbjct: 487  VFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPIY 546

Query: 938  MSFTKGAPEVIFELCSK-------QTLPLDYEAL------LHHYTHNGYRVIACAGKKLT 984
              FTKGA E + + C+           PL  E L      +   +  G RV+A A K   
Sbjct: 547  EVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFN 606

Query: 985  RQSWLYSQKV---SREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNV 1041
               +  ++      R+ +E+NL FLG +   +  +  +   ++  H A I   M TGD  
Sbjct: 607  ESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFP 666

Query: 1042 LTAISVGREAGLVES-----PRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPL 1096
             TA S+ +E G++       P+  V+ +  + T+ + D       A S   +D + + PL
Sbjct: 667  GTAKSIAQEVGILPHNLYHYPKEVVNFM--VMTATDFD-------ALSDKEIDELPVLPL 717

Query: 1097 SGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIG 1156
                                                   + AR +P  K  ++E L    
Sbjct: 718  ---------------------------------------VIARCAPQTKVRMIEALHRRN 738

Query: 1157 YQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGR 1210
                  GDG ND  +LK A++GI++    + VA   +  +      + +L+ ++EGR
Sbjct: 739  RFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (PMA2)
            - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 146/675 (21%), Positives = 242/675 (35%), Gaps = 181/675 (26%)

Query: 543  VYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLV--NESMLTGESVPVSK 600
            V RDG   ++P++++VPGDI +L D  +  +P D  +++  C V  ++S +TGES+ V K
Sbjct: 163  VIRDGSLVEIPANEVVPGDILQLEDGVI--IPADGRIVTEGCFVQIDQSAITGESLAVDK 220

Query: 601  VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTK 660
                          + D   SS   K     G   + V AT G S  +G  A        
Sbjct: 221  -------------RYGDATFSSSTVK----RGEGFMIVTAT-GDSTFVGRAA-------- 254

Query: 661  GSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVS-FIQFLRLGLDKRTMILRALD 719
                 ++V     G   + +    IG I +I +    +  ++      +D  T++   L 
Sbjct: 255  -----ALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVACFYRSIDIVTILRYTLA 309

Query: 720  IITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGL 779
            I  V VP  LPA ++         L KK       + +     ++++C DKTGTLT++ L
Sbjct: 310  ITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

Query: 780  DVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKA--KNFLVSLLTCHSLR 837
             +   + V+ ++ +           DL+ +  L+     + + A  K FL SL+     +
Sbjct: 370  SLHEPYTVEGVEAD-----------DLMLTACLAASRKKKGLDAIDKAFLKSLINYPRAK 418

Query: 838  MVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSG 897
                +       +K+++F  +    +  ++KV ++ E        PE  R    IV   G
Sbjct: 419  AALTK-------YKVLEFHPF----DPVSKKVTAIVES-------PEGER----IVCVKG 456

Query: 898  KGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTL 957
               F                          ++K   EN  +      PE + E       
Sbjct: 457  APLF--------------------------VLKTVEENHLI------PEDVKE------- 477

Query: 958  PLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKG 1017
              +YE  +      GYR +                 V+R+  E + E LG +   +  + 
Sbjct: 478  --NYENKVAELASRGYRALG----------------VARKRGEGHWEILGVMPCMDPPRD 519

Query: 1018 TTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIIT 1077
             T +T+       +R  M TGD V  A    R+ GL                        
Sbjct: 520  DTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGL------------------------ 555

Query: 1078 WQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIY 1137
              N+ N+              +  D+     G  F  +F   K  + E+           
Sbjct: 556  GTNIYNAERLGLGGGGDMPGSELADFVENADG--FAEVFPQHKYNVVEI----------- 602

Query: 1138 ARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTSR 1195
                          LQ  GY V   GDG ND  +LK AD GI++  A   A  AA     
Sbjct: 603  --------------LQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFL 648

Query: 1196 LFEISCVLDVMKEGR 1210
               +S ++D +K  R
Sbjct: 649  APGLSAIIDALKTSR 663

>Kwal_23.3160
          Length = 1100

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 133/320 (41%), Gaps = 65/320 (20%)

Query: 913  VRSFEFLSNLRRMSVIVKPFSE-NVFMSFTKGAPEVIFELCSK---------QTLPL--- 959
            +  F F S+++RMS +     E N    FTKGA E + + C+K            P+   
Sbjct: 536  IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595

Query: 960  DYEALLHH---YTHNGYRVIACAGKKLTRQSWLYSQ---KVSREEIESNLEFLGFIIFEN 1013
            D E +  +    +  G RV+A A K  T    L      + +R+ +ES+L F G +   +
Sbjct: 596  DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655

Query: 1014 KLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEG 1073
              +  T   ++  H+A I   M TGD   TA ++ +E G++  PR       ++      
Sbjct: 656  PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL--PRNLYHYPKEV------ 707

Query: 1074 DIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLK 1133
                          +DS+ +              T   F  L        +E I+N+LL 
Sbjct: 708  --------------VDSMVM--------------TAAQFDQL-------TDEEIDNLLLL 732

Query: 1134 TSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFT 1193
              + AR +P  K  +++ L          GDG ND  +LK A++GI++    + VA   +
Sbjct: 733  PLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792

Query: 1194 SRLF---EISCVLDVMKEGR 1210
              +      + +L+ ++EGR
Sbjct: 793  DIVLSDDNFASILNAVEEGR 812

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 144/357 (40%), Gaps = 53/357 (14%)

Query: 458 RMIAFGKNSINLRQKTT-SQILFDEALHPFYIFQIFSIILWMFDAYYYYATCI-FIISVL 515
           R+  +G+NS+    K     IL  +  +   +    S+++ +    +     I F++ + 
Sbjct: 51  RVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWISGGVIAFVVFIN 110

Query: 516 SVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPC 575
             I +  E K S    S  S       V RDG    +PS  LVPGD+  +   +   +P 
Sbjct: 111 VAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVK--AGDTVPA 168

Query: 576 DSILISGDCL---VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNG 632
           D  LI  +C+    +E++LTGES+P++K A+      Q+     DT +   ++ +F    
Sbjct: 169 DLRLI--ECVNFETDEALLTGESLPIAKEAS------QVYPATEDTPVGDRLNLAF---- 216

Query: 633 TKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIA 692
                  +T  +  A G+V +TG +T  G + +S+        K    +F     I++ A
Sbjct: 217 -----ASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAA 271

Query: 693 LFG----------------------------FAVSFIQFLRLGLDKRTMILRALDIITVV 724
             G                            FA+  +   +  ++K   I  A+ +   +
Sbjct: 272 TIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIY-AICVAVSM 330

Query: 725 VPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDV 781
           +P +L   L+I        +  + +       +   G ++ +C DKTGTLT+  + V
Sbjct: 331 IPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIV 387

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 144/318 (45%), Gaps = 41/318 (12%)

Query: 912  IVRSFEFLSNLRRMSVIVKPFSEN-----VFMSFTKGAPEVIFELCSKQTLP--LDYEAL 964
            ++   EF S  +RMS I+K  SEN       +   KGA  +I+   SK      L+  AL
Sbjct: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940

Query: 965  -LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESNLEFL 1006
             L  Y   G R +  A ++L+    Q W    +++      RE+        IE  L  L
Sbjct: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000

Query: 1007 GFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR---VFVSV 1063
            G    E++L+    +++ +L  A I+  + TGD V TAI++G    L+ +     V  + 
Sbjct: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKAS 1060

Query: 1064 INDIDT--SQEGDIITWQ---------NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVF 1112
             +D+D   S+  +I+             ++ S + L+    +     T ++ + + G+  
Sbjct: 1061 GDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAK-KVHEPPTGNFGVIIDGDAL 1119

Query: 1113 RLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCGA 1171
            +L  + D  + E ++     K  +  R+SP +K  +V+ ++ ++       GDG+ND   
Sbjct: 1120 KLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAM 1179

Query: 1172 LKAADIGISLSEAEASVA 1189
            +++ADIG+ ++  E   A
Sbjct: 1180 IQSADIGVGIAGEEGRQA 1197

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 137/323 (42%), Gaps = 43/323 (13%)

Query: 900  RFIEREPSNVIGIV-----RSF------EFLSNLRRMSVIVKPFSENVFMSFTKGAPEVI 948
            +F+ R+P++V  ++     R +      EF S  +RMS I + F ++      KGA  VI
Sbjct: 650  KFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFR-FPDDSIKLLCKGADSVI 708

Query: 949  FELCSKQTLPLDYEALLHH---YTHNGYRVIACAGKKLTRQSW-LYSQK----------- 993
             E  S +T     +A   H   Y   G R +  A K +    +  +++K           
Sbjct: 709  LERLS-ETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHR 767

Query: 994  -----VSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVG 1048
                    EEIES L  +G    E+KL+    +T+ +L  A I+  + TGD   TAI++G
Sbjct: 768  AEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIG 827

Query: 1049 REAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVT 1108
                   S R+    +N +  S+E    T +N+      L   +L     D +   L + 
Sbjct: 828  M------SCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLS--EHDMNTLALVID 879

Query: 1109 GEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDGAN 1167
            G       + D       I   + K  I  R+SP +K  +V+ ++     +    GDGAN
Sbjct: 880  GHSLSFALEADLEDYFLAIGK-MCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGAN 938

Query: 1168 DCGALKAADIGISLSEAEASVAA 1190
            D   ++AA +G+ +S  E   AA
Sbjct: 939  DVSMIQAAHVGVGISGMEGMQAA 961

>Scas_297.1
          Length = 800

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 14/180 (7%)

Query: 1106 AVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDG 1165
            A+ G  FR L K ++ ++       L    + AR SP++K  LVE L+ +G  V   GDG
Sbjct: 28   AIEGPKFRTLTKQERIKM-------LPNLRVMARSSPEDKRLLVETLKGMGDVVAVTGDG 80

Query: 1166 ANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRAALVT--SFACF 1220
             ND  ALK AD+G S+  +   VA   +  +    + + ++D +K GR   ++   F  F
Sbjct: 81   TNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGRCVSISIKKFIQF 140

Query: 1221 QYMSLYSAT--QFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYEVLAKKRP 1278
            Q +   +A    FV+ +      S L   Q L+I+L +    A+ ++  KP   +  ++P
Sbjct: 141  QLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKP 200

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 27/165 (16%)

Query: 556 DLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATR---------- 605
           +L+ GDI  L   +  ++P D +L+ G C V+ES +TGES  + KV              
Sbjct: 615 NLLVGDIITLQ--TGDVIPADGVLVEGQCEVDESSITGESDTIKKVKVFNALKTFDVINE 672

Query: 606 -ETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLV 664
            ++  Q+LD    T     +    L +G+KL+         +   ++   G ++  G  +
Sbjct: 673 GKSNDQILDIGFKTPNGDKIPDCMLISGSKLL-------SGLGKAIITSVGTNSIHGRTM 725

Query: 665 RSM-VFPKPTGFK----FYEDSFKYIGYISIIALFGFAVSFIQFL 704
            ++ V P+ T  +       DS    G ++ I L  F V FI+FL
Sbjct: 726 MALKVEPESTPLQQRLSQLADSISVYGCVAAILL--FLVLFIRFL 768

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 136/324 (41%), Gaps = 50/324 (15%)

Query: 912  IVRSFEFLSNLRRMSVIVK-----PFSENVFMSFTKGAPEVIFELCSKQTLPLDYEAL-- 964
            I+   EF S  +RMS I+K     P  E   +   KGA  VI+   S +    D   L  
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 965  ----LHHYTHNGYRVIACAGKKLT---------RQSWLYSQKVSREE--------IESNL 1003
                L  Y   G R +  A ++LT         R     +   +REE        IE +L
Sbjct: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951

Query: 1004 EFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSV 1063
              LG    E++L+    E++  L  A I+  + TGD V TAI++G    L+ +    + V
Sbjct: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1011

Query: 1064 INDIDTSQEGDIITWQNVANSSDTLDSVTLRP---LSGD--------------TDDYTLA 1106
                 T+ E  +   ++     ++L S  LR    LSG                 D+ + 
Sbjct: 1012 ----KTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVV 1067

Query: 1107 VTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDG 1165
            + G+  ++    D  + + ++     K  +  R+SP +K  +V+ ++ ++       GDG
Sbjct: 1068 IDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1127

Query: 1166 ANDCGALKAADIGISLSEAEASVA 1189
            +ND   +++AD+GI ++  E   A
Sbjct: 1128 SNDVAMIQSADVGIGIAGEEGRQA 1151

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 171/423 (40%), Gaps = 90/423 (21%)

Query: 823  AKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTM 882
             ++F+++L  CHS+ +                      E    N K   L  +  D + +
Sbjct: 767  CEHFMLALALCHSVLV----------------------EANPDNPKKLDLKAQSPDEAAL 804

Query: 883  PENSR-FAPAIVHPSGKGRFIEREPSNVIGIVRSFEFL------SNLRRMSVIVK----- 930
               +R    + V  + KG  IE +     GI + FE L      S+ +RMS IVK     
Sbjct: 805  VATARDVGFSFVGKTKKGLIIEMQ-----GIQKEFEILNILEFNSSRKRMSCIVKIPGLN 859

Query: 931  PFSENVFMSFTKGAPEVIFELCSKQT-----LPLDYEAL-LHHYTHNGYRVIACAGKKLT 984
            P  E   +   KGA  +I+   S+Q+       L+  AL L  Y   G R +  A ++L 
Sbjct: 860  PGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQREL- 918

Query: 985  RQSWLYSQK------------VSREE--------IESNLEFLGFIIFENKLKGTTKETLE 1024
              SW   +K             +RE+        IE  L  LG    E++L+    + +E
Sbjct: 919  --SWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIE 976

Query: 1025 SLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANS 1084
             L  A I+  + TGD V TAI++G    L+ +    + +    D  +E         +  
Sbjct: 977  LLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKE----FGSEPSEI 1032

Query: 1085 SDTLDSVTLRP---LSGDTDD--------------YTLAVTGEVFRLLFKTDKSQIEEVI 1127
             D L S  L+    L+G  ++              Y + + G+  +L    +  + + ++
Sbjct: 1033 VDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLL 1092

Query: 1128 NNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCGALKAADIGISLSEAEA 1186
                 +  +  R+SP +K  +V+ ++ S+       GDG+ND   +++AD+GI ++  E 
Sbjct: 1093 LCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEG 1152

Query: 1187 SVA 1189
              A
Sbjct: 1153 RQA 1155

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 130/297 (43%), Gaps = 36/297 (12%)

Query: 917  EFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHH---YTHNGY 973
            EF S  +RMS I + F +     F KGA  VI E    +      EA + H   Y   G 
Sbjct: 697  EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQY-VEATMRHLEDYASEGL 754

Query: 974  RVIACAGKKLTR---QSW--LYSQKVS----REE--------IESNLEFLGFIIFENKLK 1016
            R +  A + ++    + W  +Y++  +    R E        IE NL  +G    E+KL+
Sbjct: 755  RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814

Query: 1017 GTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDII 1076
                ET+ +L  A I+  + TGD   TAI++G       S R+    +N +  ++E    
Sbjct: 815  DGVPETIHTLQEAGIKIWVLTGDRQETAINIGM------SCRLLSEDMNLLIINEETRDD 868

Query: 1077 TWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNI--LLKT 1134
            T +N+    + L+   L   + D     L + G+         + ++E+ +  +  L K 
Sbjct: 869  TERNLLEKINALNEHQLS--THDMKSLALVIDGKSLGFAL---EPELEDYLLTVAKLCKA 923

Query: 1135 SIYARMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAEASVAA 1190
             I  R+SP +K  +V+ ++     +      GAND   ++AA +G+ +S  E   AA
Sbjct: 924  VICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAA 980

>Scas_636.16
          Length = 1554

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 142/322 (44%), Gaps = 46/322 (14%)

Query: 912  IVRSFEFLSNLRRMSVIVK--PFSEN---VFMSFTKGAPEVIFELCSK------QTLPLD 960
            I+   EF S+ +RMS IVK  P +E      +   KGA  VI+   S+      +TL L+
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL-LE 873

Query: 961  YEAL-LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESN 1002
              AL L  Y   G R +    ++++    Q W     ++      REE        IE +
Sbjct: 874  KTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERD 933

Query: 1003 LEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESP-RVFV 1061
            L  LG    E++L+    +++  L  A I+  + TGD V TAI++G    L+ +   + V
Sbjct: 934  LVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLV 993

Query: 1062 SVINDIDTSQEGD-------------IITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVT 1108
                  D  + GD             ++   N+  S + L +   +  S    ++ + + 
Sbjct: 994  IKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL-AAAKKDHSPPQGEFAIIID 1052

Query: 1109 GEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGAN 1167
            GE  ++    D  + + ++     K  +  R+SP +K  +V+ ++ ++       GDG+N
Sbjct: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSN 1112

Query: 1168 DCGALKAADIGISLSEAEASVA 1189
            D   +++AD+G+ ++  E   A
Sbjct: 1113 DVAMIQSADVGVGIAGEEGRQA 1134

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 93/201 (46%), Gaps = 26/201 (12%)

Query: 997  EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVES 1056
            E IE +L  LG I  E+KL+    + ++ L RA I+  M TGD   TAI++G    L+  
Sbjct: 994  EIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHD 1053

Query: 1057 -PRVFVSVINDIDTSQEGDIITWQ----NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEV 1111
               V +   ND + + +   IT +    NVA+    +D  TL    G+    TL +    
Sbjct: 1054 YSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFI---- 1109

Query: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG--FCGDGANDC 1169
              L  KTD              + I  R SP +K  +V +++    ++     GDGAND 
Sbjct: 1110 -ELCTKTD--------------SVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDI 1154

Query: 1170 GALKAADIGISLSEAEASVAA 1190
              +++ADIG+ ++  E   A+
Sbjct: 1155 AMIQSADIGVDITGKEGLQAS 1175

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 110/250 (44%), Gaps = 25/250 (10%)

Query: 998  EIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESP 1057
            +IE  L  LG    E+KL+    E +E + RA I+  M TGD   TAI++G    L+   
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDY 1074

Query: 1058 RVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFK 1117
               V     I T+ + +II+          +++++    SG+     + + G    +   
Sbjct: 1075 STVV-----ILTTSDENIIS---------KMNAISQEVDSGNVAHCVIVIDGATLAMF-- 1118

Query: 1118 TDKSQIEEVINNILLKTS--IYARMSPDEKHELVERLQSIGYQVG--FCGDGANDCGALK 1173
             D   +  V   +  KT   +  R SP +K  +V  +++    +     GDGAND   ++
Sbjct: 1119 EDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQ 1178

Query: 1174 AADIGISLSEAE---ASVAAPFTSRLFEISCVLDVMKEGRAALVTSFACFQYMSLYSATQ 1230
            +ADIG+ ++  E   AS +A ++   F     L ++  GR   + + A F   + Y    
Sbjct: 1179 SADIGVGIAGKEGLQASRSADYSIGQFRFILKL-LLVHGRYNYIRT-AKFILCTFYKELT 1236

Query: 1231 FVTILILYSR 1240
            F    ++Y R
Sbjct: 1237 FYLTQLIYQR 1246

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 60/143 (41%), Gaps = 17/143 (11%)

Query: 822 KAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEE---ETGNRKVHSLYEERHD 878
           KAK F++SL  CH       E   D  D  ++++   S +E    T  R +  +   R  
Sbjct: 674 KAKMFILSLAICHICLPKRTEEGNDEDD--IIEYQSSSPDELALVTAARDMGYIVYNR-- 729

Query: 879 GSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVK-PFSENVF 937
                 N+        P G       E   ++ +V   +F S  +RMSVIV+ P  ++  
Sbjct: 730 ------NANILTLKTFPDGFDELPRFENFEILELV---DFNSQRKRMSVIVRVPEEKDRV 780

Query: 938 MSFTKGAPEVIFELCSKQTLPLD 960
           + F KGA  VI E    + + LD
Sbjct: 781 LLFCKGADNVILERLHNKEMALD 803

>Scas_710.41
          Length = 904

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 37/260 (14%)

Query: 526 QSSERLSELSQFYCD-VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGD- 583
           Q+   + EL +   +  RV RDG   ++P++++VPGDI EL +   +++P D  L++ + 
Sbjct: 151 QAGSIVEELKKTLANTARVIRDGTLQEIPANEIVPGDILELDEG--TIIPADGRLVTENR 208

Query: 584 -CLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATA 642
              V++S +TGES+ V K             ++ D   SS   K+    GT ++ V AT 
Sbjct: 209 FLQVDQSAITGESLAVDK-------------NYGDVTFSSSTVKT----GTSVMVVTAT- 250

Query: 643 GQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQ 702
           G +  +G  A             ++V     G   + D    IG I ++ +    +    
Sbjct: 251 GDNTFVGRAA-------------ALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWT 297

Query: 703 FLRLGLDKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGG 761
                 D   MILR  L I  + VP  LPA ++         L KK       + +    
Sbjct: 298 ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLA 357

Query: 762 KIDVMCFDKTGTLTEDGLDV 781
            ++++C DKTGTLT++ L +
Sbjct: 358 GVEILCSDKTGTLTKNKLSL 377

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTS 1194
            +A + P  K+++VE LQ+ GY V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 594  FAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 653

Query: 1195 RLFEISCVLDVMKEGR 1210
                +S ++D +K  R
Sbjct: 654  LAPGLSAIIDGLKTSR 669

>Scas_89.1
          Length = 271

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 97/208 (46%), Gaps = 24/208 (11%)

Query: 994  VSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGL 1053
            V ++ +E NLE LG    E+KL+   K ++E L  A ++  M TGD V TA  V   A L
Sbjct: 26   VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 1054 VESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFR 1113
            +   + +V  +  + +  EG +          + L+ + +   S       L + GE   
Sbjct: 86   ISRGQ-YVHTVTKL-SRPEGAL----------NALEYLKINKSS------CLLIDGESLG 127

Query: 1114 LLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSI-GYQVGFCGDGANDCGAL 1172
            +     K +  +++  + L   I  R +P +K ++   ++ I G +V   GDG ND   +
Sbjct: 128  MFLTYYKQEFFDIV--VDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMI 185

Query: 1173 KAADIGISLSEAE---ASVAAPFTSRLF 1197
            + AD+G+ +   E   AS+AA F+   F
Sbjct: 186  QCADVGVGIVGKEGKQASLAADFSVTQF 213

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/429 (23%), Positives = 181/429 (42%), Gaps = 67/429 (15%)

Query: 804  KDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEE 863
            K+L+Q L  ++    ++   ++F++SL  CHS+ +                      EE 
Sbjct: 756  KELVQDLGGANSQEQKE-AVEHFMLSLALCHSVVV----------------------EEN 792

Query: 864  TGNRKVHSLYEERHDGSTMPENSR-FAPAIVHPSGKGRFIEREP-SNVIGIVRSFEFLSN 921
              N +   +  +  D + + E +R    + V  +  G  IE +       I+   EF S 
Sbjct: 793  KNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIEIQGVQKEFRILNVLEFNST 852

Query: 922  LRRMSVIVK-----PFSENVFMSFTKGAPEVIF-ELCSKQTLP--LDYEAL-LHHYTHNG 972
             +RMS IVK       S+   +   KGA  VI+  L   +  P  L+  AL L  +   G
Sbjct: 853  RKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEG 912

Query: 973  YRVIACAGKKLTRQSWL-YSQKV--------SREE--------IESNLEFLGFIIFENKL 1015
             R +  A +++    +L ++++         +REE        IE  L  LG    E++L
Sbjct: 913  LRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRL 972

Query: 1016 KGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR---VFVSVINDIDTSQE 1072
            +    +++  L  A I+  + TGD V TAI++G    L+ S     V  S   D++   E
Sbjct: 973  QDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGE 1032

Query: 1073 GD-----------IITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKS 1121
             D           + T  N+  S + L +   +  +     + + + G+  +L    +  
Sbjct: 1033 KDSDVVLALIDKYLETHFNMKGSPEEL-AAARKDHTPPQSAFGVVIDGDALKLALHGEDI 1091

Query: 1122 QIEEVINNILLKTSIYARMSPDEKHELVERL-QSIGYQVGFCGDGANDCGALKAADIGIS 1180
            + + ++     K  +  R+SP +K  +V+ + +S+       GDG+ND   ++AAD+GI 
Sbjct: 1092 RRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIG 1151

Query: 1181 LSEAEASVA 1189
            ++  E   A
Sbjct: 1152 IAGEEGRQA 1160

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 136/321 (42%), Gaps = 74/321 (23%)

Query: 916  FEFLSNLRRMSVI-VKPFSENVFMSFTKGAPEVIFELCSKQTL--------PLDYEAL-- 964
            F F S+++RMS + +    +N    FTKGA E + + C++  L        PL  + L  
Sbjct: 529  FPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEI 588

Query: 965  ----LHHYTHNGYRVIACAGKKL-TRQSWLYSQKVSREE--IESNLEFLGFIIFENKLKG 1017
                +   ++ G RV+A A K +   ++    ++++++   +ES+L F G +   +  + 
Sbjct: 589  IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648

Query: 1018 TTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVES-----PRVFVSVINDIDTSQE 1072
             T   ++  HRA I   M TGD   TA ++ +E G++       P+  V ++  + T+ +
Sbjct: 649  ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIM--VMTATQ 706

Query: 1073 GDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILL 1132
             D +T        + LD + + PL                                    
Sbjct: 707  FDSLT-------DEELDQLPVLPL------------------------------------ 723

Query: 1133 KTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPF 1192
               + AR +P  K  +++ L          GDG ND  +LK A++GI++    + VA   
Sbjct: 724  ---VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 780

Query: 1193 TSRLF---EISCVLDVMKEGR 1210
            +  +      + +L+ ++EGR
Sbjct: 781  SDIVLSDDNFASILNAVEEGR 801

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 148/360 (41%), Gaps = 51/360 (14%)

Query: 448 RGLPNNIHEDRMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWMFDAYYYYA 506
           RGL       R+   G N++   +    + IL  +  +   +  I S+++ +    +   
Sbjct: 39  RGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISG 98

Query: 507 TCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGDIYEL 565
             I  +  L+V     +   + + ++ L        RV R+G    + S+ +VPGDI ++
Sbjct: 99  GVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQV 158

Query: 566 TDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSK-VAATRETMLQLLDDFMDTQLSSF 623
                  +P D  L+    L  +E++LTGE++PV+K  AA  E          DT +   
Sbjct: 159 R--VGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFE---------QDTPVGDR 207

Query: 624 VSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPK--------PTGF 675
           ++ +F           +T  +  A G+V RTG  +  G +  S+   +         +G 
Sbjct: 208 LNLAF---------ASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGL 258

Query: 676 KFYEDSFK-----YIG---------YISIIALFGFAVSFIQFLRLGLDKRTMILRALDII 721
           +    + K     ++G          ++ +AL  FA++ +  L +   ++ ++ R + I 
Sbjct: 259 QNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREVAIY 318

Query: 722 TVVV-----PPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTE 776
            + V     P +L   L+I        +  + +       +   G ++ +C DKTGTLT+
Sbjct: 319 AICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQ 378

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 127/315 (40%), Gaps = 63/315 (20%)

Query: 916  FEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSK------QTLPLDYEALLHHYT 969
            F F S ++RMS + +      +  +TKGA E +   C+        T  +  +A +    
Sbjct: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIK 589

Query: 970  HN-------GYRVIACAGKKLTR----QSWLYSQKVSREEIESNLEFLGFIIFENKLKGT 1018
             N       G RV+A A K   +    +  L      R+  E+ L FLG I   +  +  
Sbjct: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREE 649

Query: 1019 TKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITW 1078
            T   ++  H+A I   M TGD   TA ++ +E G++ +                      
Sbjct: 650  TAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT---------------------- 687

Query: 1079 QNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYA 1138
             N+ + S  +  +             + +TG+ F  L        E+ I+N+ +   + A
Sbjct: 688  -NLYHYSKEVVDI-------------MVMTGKQFDNLS-------EDEIDNLPVLPLVIA 726

Query: 1139 RMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF- 1197
            R SP  K  ++E L          GDG ND  +LK A++GI++    + VA   +  +  
Sbjct: 727  RCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLS 786

Query: 1198 --EISCVLDVMKEGR 1210
                + +L+ ++EGR
Sbjct: 787  DDNFASILNAVEEGR 801

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/363 (21%), Positives = 161/363 (44%), Gaps = 55/363 (15%)

Query: 447 SRGLPNNIHEDRMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWMFDAYYYY 505
           S+G+     + R+   G+NS+    K   + +L  +  +   +  I S+I+      +  
Sbjct: 30  SKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMILVLIISMIISFAIRDWIT 89

Query: 506 ATCIFIISVLSVIDTLVETKQSSERLSELSQFYC-DVRVYRDGFWSQVPSSDLVPGD--I 562
              I  +  ++VI  L++  ++S+ ++ L      +  V R+G    V S+D+VPGD  +
Sbjct: 90  GGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTDVVPGDLVV 149

Query: 563 YELTDPSLSLLPCDSILISGDCL-VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLS 621
            ++ D     +P D  L+S      +E++LTGES+PVSK A       ++ DD  +T + 
Sbjct: 150 VKVGDT----IPADLRLVSQQNFETDEALLTGESLPVSKDAN------EIFDD--ETPVG 197

Query: 622 SFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSM-----VFPKPTGFK 676
             +  +  F+ + +++ RA        G+  +TG +T  G + +S+     +  +     
Sbjct: 198 DRI--NLAFSSSTVVKGRAQ-------GIAIKTGLNTEIGKIAKSLRGGNELISRDPAKT 248

Query: 677 FYEDSF--------KYIGYIS-----------IIALFGFAVSFIQFL----RLGLDKRTM 713
           +Y++++         ++G               + LF  AV F   +    +  +D R +
Sbjct: 249 WYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVD-RGV 307

Query: 714 ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGT 773
            + A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTGT
Sbjct: 308 AIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGT 367

Query: 774 LTE 776
           LT+
Sbjct: 368 LTQ 370

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 141/319 (44%), Gaps = 41/319 (12%)

Query: 912  IVRSFEFLSNLRRMSVIVKPFSENV-----FMSFTKGAPEVIFELCSKQTLP----LDYE 962
            I+   EF S+ +RMS IVK   ++       +   KGA  VI+    K  L     L+  
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902

Query: 963  AL-LHHYTHNGYRVIACAGKKLTRQSWLYSQK---------VSREE--------IESNLE 1004
            AL L  Y   G R +  A ++L+ + +    K         V REE        IE +L 
Sbjct: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962

Query: 1005 FLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSV- 1063
             LG    E++L+    +++  L  A I+  + TGD V TAI++G    L+ +    + + 
Sbjct: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022

Query: 1064 -----INDIDTSQEG--DIITWQNVANSSDTLDS-VTLRPLSGDTD----DYTLAVTGEV 1111
                 + D+  + +   D +  Q + +      S   L+    + D    ++ + + GE 
Sbjct: 1023 TTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEA 1082

Query: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCG 1170
             +    T+  + + ++     K+ +  R+SP +K  +V+ ++ ++       GDG+ND  
Sbjct: 1083 LKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVA 1142

Query: 1171 ALKAADIGISLSEAEASVA 1189
             +++A+IG+ ++  E   A
Sbjct: 1143 MIQSANIGVGIAGEEGRQA 1161

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 92/203 (45%), Gaps = 32/203 (15%)

Query: 998  EIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESP 1057
            EIE  L  LG    E+KL+    E +E + RA I+  M TGD   TAI++G    L++  
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDY 1134

Query: 1058 RVFV-------SVINDIDT-SQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTG 1109
               V       ++I+ ++  SQE D     N+A+    +D  T+    G+    ++ V  
Sbjct: 1135 STVVILTTTDENIISKMNAVSQEVDS---GNIAHCVVVIDGATMAMFEGNPTYMSVFV-- 1189

Query: 1110 EVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG--FCGDGAN 1167
                L  KTD              + I  R SP +K  +V  +++    +     GDGAN
Sbjct: 1190 ---ELCTKTD--------------SVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGAN 1232

Query: 1168 DCGALKAADIGISLSEAEASVAA 1190
            D   +++ADIG+ ++  E   A+
Sbjct: 1233 DIAMIQSADIGVGIAGKEGLQAS 1255

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 136/320 (42%), Gaps = 54/320 (16%)

Query: 521 LVETKQSSERLSELSQFYCD-VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSIL 579
            ++  Q+   + EL +   +   V RDG   +VPS+++VPGDI +L D  +  +P D  L
Sbjct: 140 FIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEVVPGDILQLEDGVV--IPADGRL 197

Query: 580 ISGDCLV--NESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIR 637
           ++ DC +  ++S +TGES+ V K              F D+  SS   K     G   + 
Sbjct: 198 VTEDCFIQIDQSAITGESLAVDK-------------RFGDSTFSSSTVK----RGEAFMI 240

Query: 638 VRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFA 697
           V AT G S  +G  A        GS               + +    IG I +I +    
Sbjct: 241 VTAT-GDSTFVGRAAALVNKAAAGS-------------GHFTEVLNGIGTILLILVIVTL 286

Query: 698 VS--FIQFLRLGLDKRTMILRALDIITVV-VPPALPASLSIGTGFALNRLKKKGIFCISP 754
           +      F R   +K   ILR    IT+V VP  LPA ++         L KK       
Sbjct: 287 LLVWVASFYRT--NKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKL 344

Query: 755 TRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSD 814
           + +     ++++C DKTGTLT++ L +   + V+ +           D  DL+ +  L+ 
Sbjct: 345 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGV-----------DPDDLMLTACLAA 393

Query: 815 CVSTRDMKA--KNFLVSLLT 832
               + + A  K FL SL++
Sbjct: 394 SRKKKGLDAIDKAFLKSLIS 413

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTS 1194
            +A + P  K+ +VE LQ  GY V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 588  FAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 647

Query: 1195 RLFEISCVLDVMKEGR 1210
                +S ++D +K  R
Sbjct: 648  LAPGLSAIIDALKTSR 663

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 123/329 (37%), Gaps = 83/329 (25%)

Query: 913  VRSFEFLSNLRRMSVIVKPFSEN---VFMSFTKGAPEVIFELCSK-------QTLPLDYE 962
            V  F F S+++RMS I K   +    ++  FTKGA E + + C         +  PL  E
Sbjct: 519  VAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKE 578

Query: 963  AL------LHHYTHNGYRVIACAGKKLTRQSWLYSQKV---SREEIESNLEFLGFIIFEN 1013
             L      +   +  G RV+A A K      +  ++      R+ +E  L FLG I   +
Sbjct: 579  DLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYD 638

Query: 1014 KLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLV---------ESPRVFVSVI 1064
              +  +   ++  H+A I   M TGD   TA S+ +E G++         E     V   
Sbjct: 639  PPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAA 698

Query: 1065 NDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIE 1124
             D D             A S   +D + + PL                            
Sbjct: 699  TDFD-------------ALSDQEIDDLRVLPL---------------------------- 717

Query: 1125 EVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA 1184
                       + AR +P  K  ++E L          GDG ND  +LK A++GI++   
Sbjct: 718  -----------VIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGIN 766

Query: 1185 EASVAAPFTSRLF---EISCVLDVMKEGR 1210
             + VA   +  +      + +L+ ++EGR
Sbjct: 767  GSDVAKDASDIVLSDDNFASILNAVEEGR 795

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 79/366 (21%), Positives = 145/366 (39%), Gaps = 59/366 (16%)

Query: 446 VSRGLPNNIHEDRMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWM-FDAYY 503
           +++GL N    +R+   G+N++    K   + IL  +  +   +  I S+++ +    + 
Sbjct: 35  INQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKDWI 94

Query: 504 YYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGD-- 561
                 F++ +  VI    E   S    S  S       V RDG    + S +LVPGD  
Sbjct: 95  SGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDIC 154

Query: 562 IYELTDPSLSLLPCD-SILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQL 620
           I ++ D     +P D  +L S +   +E++LTGES+PV+K  +        + D ++   
Sbjct: 155 IIKVGDT----VPADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLN--- 207

Query: 621 SSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYED 680
                    F  + + + RAT       G+V +T  +T  G + +S+     T F   +D
Sbjct: 208 -------LAFAASTVTKGRAT-------GIVIKTALNTEIGKIAKSL--KSETSF-ISKD 250

Query: 681 SFKYIGYISIIALFGFAVSFI--------------------------QFLRLGLDK---- 710
             K  G    I L     SF+                            + +G  K    
Sbjct: 251 ENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVN 310

Query: 711 RTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDK 770
           + + + A+ +   ++P +L   L+I        +  + +       +   G ++ +C DK
Sbjct: 311 KQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDK 370

Query: 771 TGTLTE 776
           TGTLT+
Sbjct: 371 TGTLTQ 376

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 114/264 (43%), Gaps = 41/264 (15%)

Query: 522 VETKQSSERLSELSQFYCDVRVY-RDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILI 580
           V+  Q+   + EL +   +  V  RDG   ++P++++VPGDI +L D   +++P D  ++
Sbjct: 160 VQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDG--TVIPTDGRIV 217

Query: 581 SGDCL--VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRV 638
           + DC   +++S +TGES+ V K              + D   SS   K     G   + V
Sbjct: 218 TEDCFLQIDQSAITGESLAVDK-------------HYGDQTFSSSTVK----RGEGFMVV 260

Query: 639 RATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFG--F 696
            AT G +  +G  A             ++V     G   + +    IG I ++ +     
Sbjct: 261 TAT-GDNTFVGRAA-------------ALVNKAAGGQGHFTEVLNGIGIILLVLVIATLL 306

Query: 697 AVSFIQFLRLGLDKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPT 755
            V    F R     R  ILR  L I  + VP  LPA ++         L KK       +
Sbjct: 307 LVWTACFYRTNGIVR--ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLS 364

Query: 756 RVNVGGKIDVMCFDKTGTLTEDGL 779
            +     ++++C DKTGTLT++ L
Sbjct: 365 AIESLAGVEILCSDKTGTLTKNKL 388

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTS 1194
            +A + P  K+ +VE LQ+ GY V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 607  FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 666

Query: 1195 RLFEISCVLDVMKEGR 1210
                +S ++D +K  R
Sbjct: 667  LAPGLSAIIDALKTSR 682

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 140/322 (43%), Gaps = 48/322 (14%)

Query: 912  IVRSFEFLSNLRRMSVIVK-----PFSENVFMSFTKGAPEVIF---ELCSKQTLPLDYEA 963
            ++   EF S+ +RMS I+K     P  E   +   KGA  VI+   +        L+  A
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 964  L-LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESNLEF 1005
            L L  Y   G R +  A ++LT    + W+ +  V+      REE        IE  L  
Sbjct: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000

Query: 1006 LGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVIN 1065
            LG    E++L+    +++  L  A I+  + TGD V TAI++G    ++ +    + V  
Sbjct: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060

Query: 1066 DIDTSQEGDIITWQNVANSSDTLDSVTLRP---LSGDTDD--------------YTLAVT 1108
              +  +E      Q V N    L +  LR    +SG  ++              + + + 
Sbjct: 1061 SGEDVEEFGSDPIQVVNN----LVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIID 1116

Query: 1109 GEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERL-QSIGYQVGFCGDGAN 1167
            G+  ++    ++ + + ++     K  +  R+SP +K  +V+ + +++       GDG+N
Sbjct: 1117 GDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSN 1176

Query: 1168 DCGALKAADIGISLSEAEASVA 1189
            D   +++AD+G+ ++  E   A
Sbjct: 1177 DVAMIQSADVGVGIAGEEGRQA 1198

>Scas_669.3
          Length = 1638

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 83/192 (43%), Gaps = 36/192 (18%)

Query: 997  EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLV-- 1054
            EEIE +L+ LG    E+KL+    E +E + RA I+  M TGD   TAI++G    L+  
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYD 1107

Query: 1055 --------ESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLA 1106
                    +     +S +N I  SQE D     NVA+    +D  TL    G+       
Sbjct: 1108 YSTVVILAKGDENIISKMNAI--SQEVDS---GNVAHCVIIIDGSTLAMFEGNP-----T 1157

Query: 1107 VTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG--FCGD 1164
            +      L  KTD              + I  R SP +K  +V  +++    +     GD
Sbjct: 1158 LMSVFIELCTKTD--------------SVICCRASPSQKSLMVTNIRNSNKNLVTLAIGD 1203

Query: 1165 GANDCGALKAAD 1176
            GAND   +++AD
Sbjct: 1204 GANDIAMIQSAD 1215

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 86/199 (43%), Gaps = 26/199 (13%)

Query: 999  IESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR 1058
            IE++LE LG    E+KL+    E ++ + RA I+  M TGD   TAI++G    L+    
Sbjct: 995  IETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYS 1054

Query: 1059 VFVSVINDIDT-----SQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFR 1113
              V +  + D      +  G+ +    +A+    +D  +L     +       +      
Sbjct: 1055 TVVILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNP-----TMMSVFIE 1109

Query: 1114 LLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE--RLQSIGYQVGFCGDGANDCGA 1171
            L  KTD              + I  R SP +K  +V   RL++        GDGAND   
Sbjct: 1110 LCTKTD--------------SVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAM 1155

Query: 1172 LKAADIGISLSEAEASVAA 1190
            +++ADIG+ ++  E   A+
Sbjct: 1156 IQSADIGVGITGKEGLQAS 1174

>Kwal_23.3556
          Length = 1597

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 93/201 (46%), Gaps = 26/201 (12%)

Query: 997  EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVE- 1055
            E +E++L  LG    E+KL+    + ++ + RA I+  M TGD   TAI++G    L+  
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 1056 -SPRVFVSVINDIDTSQEGDI---ITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEV 1111
             S  V +S  ++  +S+   +   I   N+A+    +D  TL     +    ++ V    
Sbjct: 1073 YSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFV---- 1128

Query: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG--FCGDGANDC 1169
              L  KTD              + I  R SP +K  +V  +++   ++     GDGAND 
Sbjct: 1129 -ELCTKTD--------------SVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDI 1173

Query: 1170 GALKAADIGISLSEAEASVAA 1190
              +++ADIG+ ++  E   A+
Sbjct: 1174 AMIQSADIGVGIAGKEGLQAS 1194

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 880 STMPENSRFAPAIVHPSGKGRFIEREPS-NVIGIVRSFEFLSNLRRMSVIVK-PFSENVF 937
           + M  NS       +P+G     + EP  +   I+ + EF S+ +RMSV+V+ P  EN  
Sbjct: 714 AVMNRNSDVLTIKTYPNG----FDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRI 769

Query: 938 MSFTKGAPEVIFE 950
           +   KGA  VI E
Sbjct: 770 LLICKGADNVILE 782

>Scas_688.1
          Length = 913

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 108/292 (36%), Gaps = 76/292 (26%)

Query: 926  SVIVKPFSENVFMSFTKGAPEVIFELCSK-QTLPLD----YEALLHHYTHNGYRVIACAG 980
            +V+  P  E +     KGAP  + +   +   +P D    YE  +      G+R +    
Sbjct: 455  AVVESPEGERIIC--VKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALG--- 509

Query: 981  KKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDN 1040
                         V+R+  E + E LG +   +  +  T ET+    R  +R  M TGD 
Sbjct: 510  -------------VARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDA 556

Query: 1041 VLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDT 1100
            V  A    R+ GL                          NV N+           LSG  
Sbjct: 557  VGIAKETCRQLGL------------------------GTNVYNAERL-------GLSGGG 585

Query: 1101 DDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVG 1160
            D                   S++ + + N       +A + P +K+ +VE LQ+ GY V 
Sbjct: 586  D----------------MPGSELADFVEN----ADGFAEVFPQDKYRVVEILQTRGYLVA 625

Query: 1161 FCGDGANDCGALKAADIGISLSEA--EASVAAPFTSRLFEISCVLDVMKEGR 1210
              GDG ND  +LK AD GI++  A   A  AA        +S ++D +K  R
Sbjct: 626  MTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 677

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 709 DKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMC 767
           D    ILR  L I  V VP  LPA ++         L KK       + +     ++++C
Sbjct: 312 DGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 371

Query: 768 FDKTGTLTEDGL 779
            DKTGTLT++ L
Sbjct: 372 SDKTGTLTKNKL 383

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 129/312 (41%), Gaps = 50/312 (16%)

Query: 526 QSSERLSELSQFYCD-VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDC 584
           Q+   + EL +   +   V RDG   ++P++++VPG+I +L   +++  P D  +++ DC
Sbjct: 193 QAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLESGTIA--PADGRIVTEDC 250

Query: 585 L--VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATA 642
              +++S +TGES+   K              + D   SS   K+    G   + V AT 
Sbjct: 251 FLQIDQSAITGESLAAEK-------------HYGDEVFSSSTVKT----GEAFMVVTATG 293

Query: 643 GQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQ 702
             +     V R      + S V          F    +    I  + +IA      +   
Sbjct: 294 DNT----FVGRAAALVGQASGVEGH-------FTEVLNGIGIILLVLVIATLLLVWTACF 342

Query: 703 FLRLGLDKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGG 761
           +  +G+     ILR  L I  + VP  LPA ++         L KK       + +    
Sbjct: 343 YRTVGI---VSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLA 399

Query: 762 KIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDM 821
            ++++C DKTGTLT++ L +   + V+ +  +           DL+ +  L+     + +
Sbjct: 400 GVEILCSDKTGTLTKNKLSLHEPYTVEGVSPD-----------DLMLTACLAASRKKKGL 448

Query: 822 KA--KNFLVSLL 831
            A  K FL SL+
Sbjct: 449 DAIDKAFLKSLI 460

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTS 1194
            +A + P  K+ +VE LQ+ GY V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 636  FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 695

Query: 1195 RLFEISCVLDVMKEGR 1210
                +S ++D +K  R
Sbjct: 696  LAPGLSAIIDALKTSR 711

>Kwal_47.17522
          Length = 899

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 133/317 (41%), Gaps = 50/317 (15%)

Query: 521 LVETKQSSERLSELSQFYCD-VRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSIL 579
            ++  Q+   + EL +   +   V RDG   ++P++++VPGDI +L D    ++  D  L
Sbjct: 140 FIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEVVPGDIMQLEDG--VVICADGRL 197

Query: 580 ISGDCL--VNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIR 637
           ++ +C   +++S +TGES+ V K              + DT  SS   K     G   + 
Sbjct: 198 VTEECFLQIDQSAITGESLAVDK-------------HYGDTTFSSSTVK----RGEGFMI 240

Query: 638 VRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFA 697
           V AT G +  +G  A             ++V         + +    IG I ++ +    
Sbjct: 241 VTAT-GDNTFVGRAA-------------ALVNQAAGDQGHFTEVLNGIGTILLVLVIVTL 286

Query: 698 VSFIQFLRLGLDKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTR 756
           +          D+   ILR  L I  + VP  LPA ++         L KK       + 
Sbjct: 287 LLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSA 346

Query: 757 VNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCV 816
           +     ++++C DKTGTLT++ L +   + V+ ++ +           DL+ +  L+   
Sbjct: 347 IESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPD-----------DLMLTACLAASR 395

Query: 817 STRDMKA--KNFLVSLL 831
             + + A  K FL SL+
Sbjct: 396 KKKGLDAIDKAFLKSLI 412

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA--EASVAAPFTS 1194
            +A + P  K+ +VE LQ  GY V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 588  FAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 647

Query: 1195 RLFEISCVLDVMKEGR 1210
                +S ++D +K  R
Sbjct: 648  LAPGLSAIIDALKTSR 663

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 139/348 (39%), Gaps = 80/348 (22%)

Query: 504 YYATCIFIISVLSV---IDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPG 560
           Y+ + +F+   L +   +++L +TK +S  +S LS F  +          Q    + V  
Sbjct: 511 YFDSVVFLTFFLLIGRLLESLAKTKTASA-ISNLSSFKQETATLMQKVGDQYQEVETVQI 569

Query: 561 DIYELTD-----PSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDF 615
              EL D     P  S  P DSI++ G+   +ES LTGES+P+ ++        Q+    
Sbjct: 570 QYLELGDYIKISPGQSP-PLDSIILEGETEFDESALTGESIPMVRLRGD-----QIFAGT 623

Query: 616 MDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGF 675
           ++   SS ++K   F+G  L            L  +  T      G L R+ +       
Sbjct: 624 VNVGSSSVIAKVSSFDGESL------------LDQIVNT---VRDGQLNRAPI------- 661

Query: 676 KFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRT---------------MILRALDI 720
           +   D     GY   I +F   ++++ +L LGL  +                 +  A+ +
Sbjct: 662 ERLADILT--GYFVPIIIFLAILTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFAISV 719

Query: 721 ITVVVPP----ALPASLSIGTGFALNRLKKKGIFCI-SPTRVNVGGKIDVMCFDKTGTLT 775
             +  P     A P +L +G+G A     K GI C         G KI ++CFDKTGTLT
Sbjct: 720 FVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFDKTGTLT 775

Query: 776 EDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKA 823
                         L  EMK++       + L  + +     TRDM++
Sbjct: 776 --------------LGNEMKVTNYSLHGDEKLAKIGIE---VTRDMES 806

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 1135 SIYARMSPDEKHELVERLQ--SIGYQ-----VGFCGDGANDCGALKAADIGISLS 1182
            ++ A + P+EK   V+ +Q  +IG       V   GDG ND  AL AAD+GI+L+
Sbjct: 971  NVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALA 1025

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 128/315 (40%), Gaps = 46/315 (14%)

Query: 521 LVETKQSSERLSELSQFYCDVRVY-RDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSIL 579
            ++  Q+   + EL +   +V V  RDG   +VP++++VPGDI +L D ++  +P D  L
Sbjct: 143 FIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANEVVPGDILQLEDGTI--IPADGRL 200

Query: 580 ISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVR 639
           ++ +C +           V + A T E+ L +   + D   SS   K     G   + V 
Sbjct: 201 VTENCFLQ----------VDQSAITGES-LAVDKGYGDQTFSSSTVK----RGEAFMVVT 245

Query: 640 ATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVS 699
           AT   +     V R      K S           G   + +    IG + ++ +    + 
Sbjct: 246 ATGDNT----FVGRAAALVNKAS----------GGQGHFTEVLNGIGILLLVLVIVTLLG 291

Query: 700 FIQFLRLGLDKRTMILR-ALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVN 758
                    D    ILR  L I  + VP  LPA ++         L KK       + + 
Sbjct: 292 VWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIE 351

Query: 759 VGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVST 818
               ++++C DKTGTLT++ L +   + V+ +  +           DL+ +  L+     
Sbjct: 352 SLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSAD-----------DLMLTACLAASRKK 400

Query: 819 RDMKA--KNFLVSLL 831
           + + A  K FL SL+
Sbjct: 401 KGLDAIDKAFLKSLI 415

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 1137 YARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRL 1196
            +A + P  K+++VE LQ+ GY V   GDG ND  +LK AD GI++ E  +  A      +
Sbjct: 591  FAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAARSAADIV 649

Query: 1197 F---EISCVLDVMKEGR 1210
            F    +S ++D +K  R
Sbjct: 650  FLAPGLSAIIDALKTSR 666

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 94/233 (40%), Gaps = 43/233 (18%)

Query: 560 GDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQ 619
           GDI+++   S   +P D  +ISG   V+E+++TGES+PV K                   
Sbjct: 717 GDIFKVLPDSR--IPTDGTVISGSSEVDEALITGESMPVPKKCQ---------------- 758

Query: 620 LSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYE 679
            S  V+ S    GT  +++    G +            +T  ++V      KP      +
Sbjct: 759 -SIVVAGSVNGTGTLFVKLSKLPGNNTI----------STIATMVDEAKLTKPKIQNIAD 807

Query: 680 DSFKY-IGYISIIALFGFAVSFIQFLRLGLDKRT-----MILRALDIITVVVPP----AL 729
               Y +  I  I +  F V     +R+    R+      I+ A+ ++ V  P     A+
Sbjct: 808 KIASYFVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAV 867

Query: 730 PASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVL 782
           P    I +G A     K+G+   S   + V      + FDKTGTLTE  L V+
Sbjct: 868 PIVFVIASGVA----AKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVV 916

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 28/104 (26%)

Query: 1091 VTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE 1150
            ++L  LSGD D    AV     RL  ++               ++I +  +P EK E ++
Sbjct: 1042 ISLHILSGDDDG---AVRSMAARLGIES---------------SNIRSHATPAEKSEYIK 1083

Query: 1151 RL----------QSIGYQVGFCGDGANDCGALKAADIGISLSEA 1184
             +          QS    V FCGDG ND   L  A IG+ ++E 
Sbjct: 1084 DIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEG 1127

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 1110 EVFRLLFKTDKS--QIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGAN 1167
            EVF +   T KS  ++ E+++  +   ++Y+ ++PD K + VE L+  G  + F GDG N
Sbjct: 782  EVFMVTGDTHKSAMKVAEMVD--IPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGIN 839

Query: 1168 DCGALKAADIGISLS 1182
            D  AL  +D+GI++S
Sbjct: 840  DSLALVTSDLGIAIS 854

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 130/325 (40%), Gaps = 69/325 (21%)

Query: 487 YIFQIFSIILWMFDAYYYYATCIFIISVLSV----IDTLVETKQSSERLSELSQFY---- 538
           YIF  +SII  ++         IF  +V+ +    +  L+E K  SE  + +S+      
Sbjct: 347 YIFSCYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTP 406

Query: 539 --CDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESV 596
             C + V  DG   ++    L P DI E+  P + + P D ++I  +  V+ES++TGES+
Sbjct: 407 SSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRNETEVDESLITGESM 463

Query: 597 PVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGF 656
            V K+                   S  +  S   NG      RA            R G 
Sbjct: 464 LVEKIVG-----------------SQVIGGS--VNGPGHFYFRAI-----------RVGE 493

Query: 657 STTKGSLVRSMVFPKPTG--FKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRT-- 712
            T   +++ +M   + +    + Y D    I    +I+L   A++FI ++ +    +T  
Sbjct: 494 DTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISL--SAITFITWMLVSYTMKTPP 551

Query: 713 -----------MILR-ALDIITVVVPPAL----PASLSIGTGFALNRLKKKGIFCISPTR 756
                      M ++ ++ +I V  P AL    P ++ +GTG   +     G+       
Sbjct: 552 LIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASH----GVLIKGGDV 607

Query: 757 VNVGGKIDVMCFDKTGTLTEDGLDV 781
           +     +    FDKTGTLT   + V
Sbjct: 608 LEKCSALQTFLFDKTGTLTTGRMSV 632

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 1136 IYARMSPDEKHELVERLQSIGYQ-VGFCGDGANDCGALKAADIGISLSEA 1184
            +++ ++P++K ++V +LQ+ G + V F GDG ND  AL  AD+GIS+S  
Sbjct: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843

>Kwal_55.21575
          Length = 989

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query: 1135 SIYARMSPDEKHELVERLQSIGYQ-VGFCGDGANDCGALKAADIGISLS 1182
            ++Y+ ++P +K++LV+ LQ  G + V F GDG ND  AL  +D+G+S+S
Sbjct: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 128/321 (39%), Gaps = 62/321 (19%)

Query: 487 YIFQIFSIILWMFDAYYYYATCIFIISVLSV----IDTLVETKQSSERLSELSQFYC--- 539
           + F ++SI + +          IF  SV+ +    +  L+E K  S+  + LS+      
Sbjct: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408

Query: 540 -DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPV 598
               +  +G   ++P   L  GD  E+  P  + +P D ++I G+  V+ES++TGES   
Sbjct: 409 STCTIIENGKAREIPVEFLQVGDTVEI-KPG-AKIPTDGVIIEGESEVDESLITGES--- 463

Query: 599 SKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATA-GQSIALGMVARTGFS 657
                            M  +   F   +   NG     + AT+ G    L  + +T   
Sbjct: 464 ----------------LMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQT--- 504

Query: 658 TTKGSLVRSMVFPKPTGFKFYED--SFKYIGYISIIALFGFAVSFIQFLRLGLDKRTM-- 713
                + ++ +   P   + Y D  + K++  + ++A+  F V++    R+  +  ++  
Sbjct: 505 -----MKQAQLSKAP--IQHYADYLASKFVPSVLVLAMITF-VTWTILSRVLSNPPSIFD 556

Query: 714 ---------ILRALDIITVVVPPAL----PASLSIGTGFALNRLKKKGIFCISPTRVNVG 760
                    +   + +I V  P AL    P ++ +GTG       K G+       +   
Sbjct: 557 SPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKGGDILEKC 612

Query: 761 GKIDVMCFDKTGTLTEDGLDV 781
             ++   FDKTGTLT   + V
Sbjct: 613 SSLETFLFDKTGTLTTGHMTV 633

>Scas_569.0d
          Length = 468

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 1125 EVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA 1184
            E I+N+ +   + AR SP  K  ++E L          GDG ND  +LK A++GI++   
Sbjct: 93   EQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGIN 152

Query: 1185 EASVAAPFTSRLF---EISCVLDVMKEGR 1210
             + VA   +  +      + +L+ ++EGR
Sbjct: 153  GSDVAKDASDIVLSDDNFASILNAIEEGR 181

>Scas_615.9
          Length = 942

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 1135 SIYARMSPDEKHELVERLQ--SIGYQVGFCGDGANDCGALKAADIGISLS 1182
            ++Y+ ++P  K E+VE LQ  S+G  V F GDG ND   L  +DIG++LS
Sbjct: 746  NVYSGVTPSGKCEIVESLQADSVG-GVAFVGDGINDSPVLVTSDIGVALS 794

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 22/133 (16%)

Query: 487 YIFQIFSIILWMFDAY----------YYYATCIFIISVLSVIDTLVETK---QSSERLSE 533
           Y+F IFSII  M  +             + T + +I+ +S    L+E K   Q+S  LS+
Sbjct: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFIS-FGKLLENKAKAQTSSSLSK 349

Query: 534 LSQFY---CDVRVYRDGFWS---QVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVN 587
           L Q     C +   ++   S   ++ ++ L   DI E+  P + + P D I+I G+  ++
Sbjct: 350 LIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEI-KPGMKI-PADGIIIQGESEID 407

Query: 588 ESMLTGESVPVSK 600
           ES++TGES+ V K
Sbjct: 408 ESLMTGESILVHK 420

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 1135 SIYARMSPDEKHELVERLQSI--GYQVGFCGDGANDCGALKAADIGISLS 1182
            ++Y+ +SP  K +LV+++Q      +V   GDG ND  AL  +D+GI++S
Sbjct: 807  NVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 518 IDTLVETKQSSERLSELSQF---YCDV--RVYRDGFWSQVPSSDLVPGDIYELTDPSLSL 572
           ++TL ++ Q+S  LS+L Q     C +   V R+    ++P   L   DI E+  P + +
Sbjct: 389 LETLAKS-QTSTALSKLIQLTPSVCSIISDVERNE-TKEIPIELLQVNDIVEI-KPGMKI 445

Query: 573 LPCDSILISGDCLVNESMLTGESVPVSK 600
            P D I+  G+  ++ES++TGES+ V K
Sbjct: 446 -PADGIITRGESEIDESLMTGESILVPK 472

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 1008 FIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDI 1067
            F+   ++L+   KE +++LH   I   M +GDN L A +V  E G+         VI D+
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGIKH-------VIADV 1065

Query: 1068 DTSQEGDIITW 1078
                + + I W
Sbjct: 1066 LPEGKAEKIQW 1076

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1136 IYARMSPDEKHELVERLQSI---GYQVGFCGDGANDCGALKAADIGISLS 1182
            + A + P+ K E ++ ++     G  +   GDG ND  A+ AAD+GISL+
Sbjct: 1061 VIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLA 1110

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 45/217 (20%)

Query: 576 DSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKL 635
           D++++ G+   +ES LTGES P++          Q+    ++    + ++K         
Sbjct: 681 DALIVQGETEFDESSLTGESRPITHFPGD-----QIFAGTVNVGQCAVIAK--------- 726

Query: 636 IRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFG 695
             V    G S+   +++       +G+ +  +     TG+        ++ +I ++A+  
Sbjct: 727 --VSTAPGNSLLDHVISAVRDGQLRGAPIERIA-DVLTGY--------FVPFIVLLAILT 775

Query: 696 FAVSFIQFLRLGLDKRTM-----------ILRALDIITVVVPP----ALPASLSIGTGFA 740
           +A+  I      L +  +           +  A+ +  +  P     A P +L +G   A
Sbjct: 776 WAIWLILGFAGVLSQEKLDGSVGGWPFWSLEFAIAVFVIACPCGIGLAAPTALFVGANIA 835

Query: 741 LNRLKKKGIFCISPTRV-NVGGKIDVMCFDKTGTLTE 776
                K GI     +    +G K+  +CFDKTGTLT+
Sbjct: 836 ----AKYGILARGGSAAFQMGSKVTTVCFDKTGTLTK 868

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..514400)
            [2433 bp, 810 aa]
          Length = 810

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 1135 SIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLS 1182
            ++++   P+ K +++ +L+     V F GDG ND  AL  +D+GISLS
Sbjct: 631  NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 16/130 (12%)

Query: 487 YIFQIFSII--LWMFDA---YYYYATCIFIISVLSVIDTLVETKQSSERLSELSQF---- 537
           Y+F + +I   +W+  A     +  T + +++ + V   L+E++  +     L++     
Sbjct: 192 YLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICV-GKLLESRARARAADSLARMVSSA 250

Query: 538 --YCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGES 595
              C +R    G   +V    L  GD+  +  P  + LP D  ++ G+  V+ES++TGES
Sbjct: 251 PSMCTIR--ESGSDREVEVELLQAGDVV-VMRPG-TKLPADGTVLEGEAEVDESLMTGES 306

Query: 596 VPVSKVAATR 605
             V K   +R
Sbjct: 307 TLVPKYPGSR 316

>Scas_505.4
          Length = 1025

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 1131 LLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAEASVA 1189
            + K  +  R+SP +K  +V+ ++     +    GDGAND   ++AA +G+ +S  E   A
Sbjct: 585  ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644

Query: 1190 A 1190
            A
Sbjct: 645  A 645

>Scas_666.26
          Length = 335

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 1080 NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYAR 1139
            NV N +   D++  R LSG+     ++ T EVF L     +  +EEV++ I  + ++Y  
Sbjct: 254  NVGNGNTKNDNLITRALSGENG---MSKTQEVFNLYMAQSQVDLEEVMDTIQEQITLYDH 310

Query: 1140 MSPDEKHE 1147
               D+ HE
Sbjct: 311  W--DKYHE 316

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 44,157,408
Number of extensions: 1895759
Number of successful extensions: 5264
Number of sequences better than 10.0: 89
Number of HSP's gapped: 5218
Number of HSP's successfully gapped: 175
Length of query: 1422
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1308
Effective length of database: 12,649,657
Effective search space: 16545751356
Effective search space used: 16545751356
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)