Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR566C1716168584810.0
Sklu_2383.11720169854500.0
Kwal_26.91891726170650610.0
KLLA0B08239g1729170450090.0
YMR229C (RRP5)1729169249470.0
Scas_594.41722170448600.0
CAGL0M04829g1706168144450.0
Scas_713.426992071119e-05
KLLA0F17996g6841921010.002
Kwal_56.23875680161980.004
YER013W (PRP22)114572980.004
KLLA0B11638g111142950.010
Kwal_55.21029110574940.010
CAGL0D02376g69579930.014
YLR117C (CLF1)687207930.014
AGL184W683193920.019
CAGL0F02915g835135860.11
Kwal_47.18684809230850.12
YJR007W (SUI2)30469830.16
Scas_479.230269820.19
Scas_617.930269810.27
AGR320W30269790.49
Kwal_33.1542230269780.56
CAGL0J09878g63485770.91
ABL100W905108771.1
Kwal_56.23065907193761.3
KLLA0C14608g48783751.5
AAR020W111273751.8
CAGL0B03795g30362732.2
Scas_720.5044985742.2
YGL130W (CEG1)45967723.7
KLLA0B09262g941112723.8
CAGL0H10098g861102724.0
KLLA0A01969g79878724.4
Scas_705.55907170724.5
Sklu_2440.18824230707.6
KLLA0A12111g236204688.7
YBR112C (SSN6)966112699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR566C
         (1685 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  3271   0.0  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                           2103   0.0  
Kwal_26.9189                                                         1954   0.0  
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  1934   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  1910   0.0  
Scas_594.4                                                           1876   0.0  
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  1716   0.0  
Scas_713.42                                                            47   9e-05
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    44   0.002
Kwal_56.23875                                                          42   0.004
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    42   0.004
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    41   0.010
Kwal_55.21029                                                          41   0.010
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    40   0.014
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    40   0.014
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    40   0.019
CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces c...    38   0.11 
Kwal_47.18684                                                          37   0.12 
YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiat...    37   0.16 
Scas_479.2                                                             36   0.19 
Scas_617.9                                                             36   0.27 
AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH] complement(...    35   0.49 
Kwal_33.15422                                                          35   0.56 
CAGL0J09878g complement(964057..965961) similar to sp|P32367 Sac...    34   0.91 
ABL100W [492] [Homologous to ScYBR055C (PRP6) - SH] complement(2...    34   1.1  
Kwal_56.23065                                                          34   1.3  
KLLA0C14608g 1276354..1277817 highly similar to sp|P38712 Saccha...    33   1.5  
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    33   1.8  
CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharo...    33   2.2  
Scas_720.50                                                            33   2.2  
YGL130W (CEG1) [1856] chr7 (266148..267527) mRNA guanylyltransfe...    32   3.7  
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    32   3.8  
CAGL0H10098g complement(984334..986919) similar to sp|P19735 Sac...    32   4.0  
KLLA0A01969g complement(178458..180854) similar to sgd|S0002824 ...    32   4.4  
Scas_705.55                                                            32   4.5  
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         32   7.6  
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    31   8.7  
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    31   9.9  

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 3271 bits (8481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1612/1685 (95%), Positives = 1612/1685 (95%)

Query: 1    MGTGSVNKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAA 60
            MGTGSVNKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAA
Sbjct: 1    MGTGSVNKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAA 60

Query: 61   SDVLFGRDDGXXXXXXXXXXXXXXXXXXEDAVAGKEDRTDIVEHLSFKGLTSGTVLLGQL 120
            SDVLFGRDDG                  EDAVAGKEDRTDIVEHLSFKGLTSGTVLLGQL
Sbjct: 61   SDVLFGRDDGKPAEERPRKKKKTSKASKEDAVAGKEDRTDIVEHLSFKGLTSGTVLLGQL 120

Query: 121  CGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXXXXXXXXKPH 180
            CGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQL                     KPH
Sbjct: 121  CGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLDQSMDSGSEDEDDDSDDEQRDKPH 180

Query: 181  TITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFETEDLAKHTT 240
            TITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFETEDLAKHTT
Sbjct: 181  TITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFETEDLAKHTT 240

Query: 241  VQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNFE 300
            VQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNFE
Sbjct: 241  VQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNFE 300

Query: 301  FTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTDM 360
            FTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTDM
Sbjct: 301  FTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTDM 360

Query: 361  KHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDNC 420
            KHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDNC
Sbjct: 361  KHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDNC 420

Query: 421  KLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLLA 480
            KLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLLA
Sbjct: 421  KLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLLA 480

Query: 481  KPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFKI 540
            KPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFKI
Sbjct: 481  KPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFKI 540

Query: 541  GSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESFK 600
            GSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESFK
Sbjct: 541  GSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESFK 600

Query: 601  PSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKVS 660
            PSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKVS
Sbjct: 601  PSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKVS 660

Query: 661  SEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQNR 720
            SEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQNR
Sbjct: 661  SEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQNR 720

Query: 721  ALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPMH 780
            ALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPMH
Sbjct: 721  ALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPMH 780

Query: 781  GYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENERF 840
            GYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENERF
Sbjct: 781  GYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENERF 840

Query: 841  LLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLAD 900
            LLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLAD
Sbjct: 841  LLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLAD 900

Query: 901  NLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVNT 960
            NLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVNT
Sbjct: 901  NLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVNT 960

Query: 961  VLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELSD 1020
            VLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELSD
Sbjct: 961  VLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELSD 1020

Query: 1021 DGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIVK 1080
            DGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIVK
Sbjct: 1021 DGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIVK 1080

Query: 1081 VADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINLS 1140
            VADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINLS
Sbjct: 1081 VADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINLS 1140

Query: 1141 LRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEW 1200
            LRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEW
Sbjct: 1141 LRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEW 1200

Query: 1201 KKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVTD 1260
            KKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVTD
Sbjct: 1201 KKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVTD 1260

Query: 1261 FGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLKA 1320
            FGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLKA
Sbjct: 1261 FGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLKA 1320

Query: 1321 SYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXDEDEAMEDIEYEHTPADAPSHETSSKAH 1380
            SYFQKAH                         DEDEAMEDIEYEHTPADAPSHETSSKAH
Sbjct: 1321 SYFQKAHDDEDEAEPAESIEEANGEEINGEASDEDEAMEDIEYEHTPADAPSHETSSKAH 1380

Query: 1381 KEAVPTGLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFXXXXXXXXXSRCNDRQDCRH 1440
            KEAVPTGLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTF         SRCNDRQDCRH
Sbjct: 1381 KEAVPTGLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFKKAKKNNKASRCNDRQDCRH 1440

Query: 1441 HTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEK 1500
            HTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEK
Sbjct: 1441 HTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEK 1500

Query: 1501 LNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAA 1560
            LNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAA
Sbjct: 1501 LNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAA 1560

Query: 1561 AKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGD 1620
            AKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGD
Sbjct: 1561 AKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGD 1620

Query: 1621 PEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVLVAKLSRKQAKFFFN 1680
            PEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVLVAKLSRKQAKFFFN
Sbjct: 1621 PEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVLVAKLSRKQAKFFFN 1680

Query: 1681 KWLQL 1685
            KWLQL
Sbjct: 1681 KWLQL 1685

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 2103 bits (5450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1045/1698 (61%), Positives = 1303/1698 (76%), Gaps = 29/1698 (1%)

Query: 5    SVNKRKLNNEQR-PEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDV 63
            S NKRK ++E     +    Q    S+L S  + +FPRGGAS LTPLELKQVANEAASDV
Sbjct: 4    SNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDV 63

Query: 64   LFGRDDGXXXXXXXXXXXXXXXXXXEDAVAGKEDRTD------IVEHLSFKGLTSGTVLL 117
            LF  D+G                    +  G ++ TD      IVEH+SFK LT G+ LL
Sbjct: 64   LF--DNGTSSAVKPEVERPKKKKKTSKSTTGTKNETDEEESTTIVEHISFKNLTPGSQLL 121

Query: 118  GQLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXXXXXXX- 176
            GQ+  VN+ DLCI+L+D L GYV L NIS  FT+LLE+L                     
Sbjct: 122  GQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMEKDQDSEDDDSDYDSSD 181

Query: 177  ----XKPHTITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFET 232
                 K     ELP+L KYF  GQWLRC V  N+AL++ KKK  RIEL+IEPS  N    
Sbjct: 182  EDEHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEA-KKKQKRIELTIEPSATNQLAD 240

Query: 233  EDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGD 292
            EDL+++ TVQC+VKSIEDHGA+LDLG++ +TGFIS KD   + +++PG+VFL N+ KR D
Sbjct: 241  EDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSD 300

Query: 293  RTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQA 352
            RT  VNF+FT+KN+KVS ISS+DAVIPG ++DFLC+KI+++GI GK FG++ GFL  S  
Sbjct: 301  RTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHL 360

Query: 353  RVFSVTDMKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFP 412
            R FS   +KH YAIGSNI+ RI+ATL  K+G K+ILVS LPHILSLE  +LE +A+ AFP
Sbjct: 361  RTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFP 420

Query: 413  VGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQL 472
            VGY+ ++C + GRDSQY Y+S+  +RIGQ+HIS+ GD      VKARV GYN VDGYYQL
Sbjct: 421  VGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQL 480

Query: 473  TSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLV 532
            ++DPK+L   YLR+ DIP+G ++SGCEI  VS  GI+L+LF  QFKAFV PLHISD++LV
Sbjct: 481  STDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLV 540

Query: 533  YPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKT 592
            YPERKFKIGSKVKGRVL+VDN+GRV VTLKKSLV+ ++ +I LVS+F+QI KLA+ D KT
Sbjct: 541  YPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKT 600

Query: 593  LATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSK 652
             ATVE FK +GCVV+FLGNLK FLPN EISEAFV+R QDHLRLGQTV+VKVL+H  ++++
Sbjct: 601  SATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNR 660

Query: 653  VIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLS 712
            VI+T KVSS+ + +QK AI ++V+GRSIV VTVV KTKDS V+EL DVGLRGVIYVGHLS
Sbjct: 661  VIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLS 720

Query: 713  DSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKD 772
            DS++EQNRA LKKLR+G+ L+G+V+DKD++TRVFN+SCKKSLIKDA   +LPL++ ++K 
Sbjct: 721  DSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKA 780

Query: 773  KDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLR 832
            K  + PMHGYVKS SD+GIFVAF+G+FVGLVLPSYA ESRDVDI KKF+INQS+T YLLR
Sbjct: 781  KGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLR 840

Query: 833  TDEENERFLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKT 892
            TD+ENERFLLT+  P+ + K++D N  V AVNP+D SVK +S+Y VG VTKA++K+VKK 
Sbjct: 841  TDDENERFLLTLKEPKVAEKRQD-NGSVNAVNPIDESVKELSEYVVGKVTKAKIKAVKKN 899

Query: 893  QLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPI 952
            QLNV+LADNLHGRVD SEI+D FE I++ K PL+ +K GDVI+VKVIG+HD KTH+FLPI
Sbjct: 900  QLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPI 959

Query: 953  SHRTGVNTVLELSAKKSALKGAYQ-PIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKA 1011
            SHR   NT+LEL+AK S L    +  +    +K  DEL+GFVNNF+KGF+WLTLSP LKA
Sbjct: 960  SHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKA 1019

Query: 1012 KIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVA 1071
            KI +  LSDDGS F  ++ ESFPLG ALKVK  ++D  H +VSV+ R H+I DI D+KV 
Sbjct: 1020 KISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVG 1079

Query: 1072 DKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVD 1131
            DKLPARI+ +ADSYLLLDLGN L G++FVT+AL+++S+SL++ +E++  S++ A+V+ VD
Sbjct: 1080 DKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVISVD 1139

Query: 1132 VENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSK 1191
            +++KK+ LSLR+    DR I S+KDL +GDVVRGFIK+V+DKGIFVYLS ++QAFVPVSK
Sbjct: 1140 LKDKKVKLSLRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSK 1199

Query: 1192 LTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIF 1251
            LTD++IK+WKKFYK MQP+TGKVVNCE +SRILLT+KESEVNG+L ILK Y+++++G+IF
Sbjct: 1200 LTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIF 1259

Query: 1252 DGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEK 1311
            +G + NVTDFGVFVKL+NTLNVTGLAH+S+I+DS++DDLS LFGEGDKVKAI+LKTNPEK
Sbjct: 1260 EGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEK 1319

Query: 1312 NQVSLGLKASYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXDEDEAME-DIEYEHTPADA 1370
             QVSLGLKASYF+K                           +EDE +  D E E      
Sbjct: 1320 KQVSLGLKASYFKK------EVEKNQEVEDVEMEDVAENESEEDEIIAVDYENESELEAE 1373

Query: 1371 PSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFXXXXXXXXX 1429
            P  E +S++ K  V   GLSLS GFDWT SILD  Q +    SSED+DF           
Sbjct: 1374 PEKEATSQSSKVPVTNDGLSLSTGFDWTASILD--QAQEDEESSEDEDFANTKKSRNRKK 1431

Query: 1430 SRCNDRQD--CRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAER 1487
             R N  +D     +T+APESV DFERLIMGNPNSSV+WMNYMAFQLQLSEV+KARE+AER
Sbjct: 1432 GRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAER 1491

Query: 1488 ALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMS 1547
            ALKTISFR+E EKLNIWIAMLNLENTFGT+ETL+D F+R+CQYMD++T+H KLISIY +S
Sbjct: 1492 ALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLS 1551

Query: 1548 SKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDV 1607
             K ++A ELY+A AKKFGS+ VS+WVSWGEFL++  Q DEA AVL  ALK+LP+R HI+V
Sbjct: 1552 EKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEV 1611

Query: 1608 VRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVLV 1667
            VRKFAQLEF+KGD EQGR+LFEGLLADAPKRID+WNVY+DQE K+  + + + LFER++ 
Sbjct: 1612 VRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIIS 1671

Query: 1668 AKLSRKQAKFFFNKWLQL 1685
             K++RKQAKFFFNKWLQ 
Sbjct: 1672 KKITRKQAKFFFNKWLQF 1689

>Kwal_26.9189
          Length = 1726

 Score = 1954 bits (5061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 967/1706 (56%), Positives = 1243/1706 (72%), Gaps = 27/1706 (1%)

Query: 1    MGTGSVNKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAA 60
            M +G   KRK   E         Q  S S+L +  + +FPRGGASALTPLELKQVANEAA
Sbjct: 1    MSSG--QKRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAA 58

Query: 61   SDVLFGRDDGXXXXXXXXXXXXXXXXXXEDAV--AGKEDRTD----IVEHLSFKGLTSGT 114
             DVLFG +                    + +   A  ED  D    +++HL+F+ L  GT
Sbjct: 59   GDVLFGAESAAPAPVSDSQRPKKKKKTHQKSATKAADEDSEDSSVTVIDHLNFRNLPVGT 118

Query: 115  VLLGQLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXXXXX 174
            +LLGQ+  VN+ DLC++L+D L G+V L +IS PFT LLE L                  
Sbjct: 119  LLLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAE 178

Query: 175  XXXKPHTIT----------ELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEP 224
                  +            ELP+L ++F+ GQWLRC V  NSALD   KK+ RIELSIEP
Sbjct: 179  YDSDEESSKASRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEP 238

Query: 225  SKVNLFETEDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFL 284
            S  N    EDL ++ TVQCAVKSIEDHGA+LDLG++ +TGFIS KD + + +++PGSVFL
Sbjct: 239  SITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFL 298

Query: 285  ANITKRGDRTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLD 344
            AN+ K+  RTATVNF+F  K SKVS ISS+DA+IPG  +DFLC+K T++G+IGK FG++D
Sbjct: 299  ANVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVD 358

Query: 345  GFLSESQARVFSVTDMKH--KYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNL 402
            GFL+ SQ   F  +  K+   Y++GSN +VRI+ATL  K G K ++VS LPHILS     
Sbjct: 359  GFLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEA 418

Query: 403  LETEAMHAFPVGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTG 462
            LE  A++AFPVGY+F++C L+GRDSQY Y+ ++++ +GQ+HISK G       V+ARV G
Sbjct: 419  LERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLG 478

Query: 463  YNTVDGYYQLTSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVA 522
            YN +DGYYQL++DPK L+  YLR++DIPVGTI+  CEIT VS  GI+LS+  GQFKA V 
Sbjct: 479  YNNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVP 538

Query: 523  PLHISDIRLVYPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQI 582
            PLHISDIRLVYPERKFKIGSKVK  ++  +N+G ++V+LKKSLV+ +  ++ L S F+ I
Sbjct: 539  PLHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDI 598

Query: 583  AKLAEEDGKTLATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVK 642
             ++A +  K  ATV+ FK +GCVV+FLG L+ FLPN EISEAFV+R QDHLRLGQTV+VK
Sbjct: 599  DRIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVK 658

Query: 643  VLEHVAKQSKVIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGL 702
            VL+H A+Q++VIVT KVSSE + +QK AI +++VGRSI+ V VVEKTKDS+VVE   VGL
Sbjct: 659  VLQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGVGL 718

Query: 703  RGVIYVGHLSDSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDI 762
            RGV+YVGHLSDS++EQNRA LKK++IG+  +G+V+DKD +TRVFN+SCKKSLIKDA K +
Sbjct: 719  RGVVYVGHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSL 778

Query: 763  LPLTFVDIKDKDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYI 822
            LP+ + D+K++  ++ M+GYVKS+S++G+FVAF G+FVGLVLPSYA +SRDVD+  KFY 
Sbjct: 779  LPVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYS 838

Query: 823  NQSVTVYLLRTDEENERFLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVT 882
            NQSVTVYLLRTD+ NERFLLTM  P+     +       AVNPVD+S+K +S +SVG +T
Sbjct: 839  NQSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKIT 898

Query: 883  KARVKSVKKTQLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFH 942
            KA VK+VK+ QLNVVL+DNLHGR+D SE++D  E+I + K PLA FK GD++DVKVIG+H
Sbjct: 899  KAMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYH 958

Query: 943  DSKTHKFLPISHRTGVNTVLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIW 1002
            D KTHKFLP+SHR+  N +LEL+AK S L GA   +    +K GD ++GFVNN +K  +W
Sbjct: 959  DVKTHKFLPVSHRSSKNVLLELTAKPSRLNGA-GGVAIDNVKVGDSIVGFVNNISKDILW 1017

Query: 1003 LTLSPALKAKIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAI 1062
            LT+SP LKAKI  F+L+D+ S    N++++FPLG AL+  V ++D     +SVS R H++
Sbjct: 1018 LTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSV 1077

Query: 1063 TDIKDIKVADKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSM 1122
            +DIKDI V D LPAR++ VADSYLLL++G  + GVAFVTDAL++++ SL+ VY ++  ++
Sbjct: 1078 SDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNI 1137

Query: 1123 ILASVVGVDVENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRT 1182
              A V+ VD +N K+NLSLR+EDA D  + +HKDLK+G +VRG +K  TDKGIFVYLS +
Sbjct: 1138 FSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSS 1197

Query: 1183 LQAFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSY 1242
            LQAFVPVSKLTD+YIKEWKKFY+ MQ + GK+VNC+ DS IL T+KESEVNG L ILK+Y
Sbjct: 1198 LQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNY 1257

Query: 1243 ADLKSGDIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKA 1302
            AD+K G+IF+GSVKNVTDFG+FVKL NT+NVTGLAHKSE++D+ ++DLS +FG GDKVKA
Sbjct: 1258 ADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKA 1317

Query: 1303 IILKTNPEKNQVSLGLKASYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXDEDEAMEDIE 1362
            ++LK N EK Q+SLGLKASYF++                             ++ +E+I 
Sbjct: 1318 VVLKVNAEKKQLSLGLKASYFKENKNTSPKLENSDVVSEDEVDDERDVDSASEDLVEEIG 1377

Query: 1363 YEHTPADAP--SHETSSKAHKEAVPTGLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTF 1420
             E  P +    + + +    K     GLSLSAGFDWT SILD  Q +    SS+++DFT 
Sbjct: 1378 QESEPEEMEDIAEDENHNGGKALSTDGLSLSAGFDWTTSILDQAQDED---SSDEEDFTE 1434

Query: 1421 XXXXXXXXXSRCN-DRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVE 1479
                     S    + Q    +T+APESVGDFER+IMGNPNSSV+WMN+MAFQLQL E++
Sbjct: 1435 TKKSKKKKRSVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEID 1494

Query: 1480 KARELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMK 1539
            KAR++AERALKTISFREE EK+NIWI MLNLENTFG + +L +VF RACQYMD+Y IH K
Sbjct: 1495 KARDVAERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTK 1554

Query: 1540 LISIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSL 1599
            LI+IY MS   DKA  L+KA AKKFGSE V +WVSWGEFL+   Q DEA  VLA ALKSL
Sbjct: 1555 LINIYQMSHNIDKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSL 1614

Query: 1600 PRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARAD 1659
            PRR HI+VVRKFAQLEFAKGD EQGR+LFEGLLAD PKRID+WNVY+DQEIK+ ++ + +
Sbjct: 1615 PRRHHIEVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVE 1674

Query: 1660 ALFERVLVAKLSRKQAKFFFNKWLQL 1685
             LFER++  KL+RKQAKFFF KWL+ 
Sbjct: 1675 DLFERIVNRKLTRKQAKFFFGKWLEF 1700

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 1934 bits (5009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1704 (55%), Positives = 1242/1704 (72%), Gaps = 35/1704 (2%)

Query: 7    NKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLFG 66
            +KRK ++E         +  +KS L+   +++FPRGG+SAL+PLE+KQV NE  +DVLFG
Sbjct: 6    SKRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVADVLFG 65

Query: 67   RDDGXXXXXXXXXXXXXXXXXXEDAVAG-----KEDRTDIVEHLSFKGLTSGTVLLGQLC 121
            +D+                    D +       KED+TD++EH   K +T GT++LGQ+ 
Sbjct: 66   KDESATGAEGPTKKKKKNAKNNFDQITTGDDEEKEDKTDLIEHFGMKQMTKGTIVLGQIQ 125

Query: 122  GVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXXXXXXXXKPHT 181
             +++ +L I+L DGL GYV LT+IS   T +LE L                     +   
Sbjct: 126  SISKHELKISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDSSDDESDI 185

Query: 182  IT--ELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFETEDLAKHT 239
             T  ELP+L+KYF +GQWLRC+V  NSAL+S K  N +++LSIEPS VN+FE +DLAK+ 
Sbjct: 186  TTPKELPDLNKYFKIGQWLRCMVQNNSALESNK--NKKLDLSIEPSVVNVFEDDDLAKNC 243

Query: 240  TVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNF 299
             +QC++KSIEDHGA+LD+G++++TGFIS KD+ +   ++PG VFLA +TKR  RT  VN 
Sbjct: 244  PLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVNVNL 303

Query: 300  EFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTD 359
            +  +KN+KV +ISS+DA++PG +IDFL + ITNHG+IGKAFG++  FL    +  F+V D
Sbjct: 304  DLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFTVED 363

Query: 360  MKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDN 419
            +KH Y+IG  +  RI+AT   K G+KV +VS  PHI+SL   L ETEA+ +FPVGY+FD+
Sbjct: 364  LKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYIFDS 423

Query: 420  CKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLL 479
            C + GRDSQ+ YVS+++E++GQIH+SKAG+      VKAR+ GYN VD  Y LTSDP LL
Sbjct: 424  CTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDPALL 483

Query: 480  AKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFK 539
               YLRS+DIP G +LS CEI  VSG GIEL +F+ QFKAFV PLHISD RLVYPERKFK
Sbjct: 484  DVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPERKFK 543

Query: 540  IGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESF 599
            IGSKVKGRVL+VD+ GRV VTLKKS+V+A++  + LV   + I  +  ++ KT+ TVE F
Sbjct: 544  IGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTVEIF 603

Query: 600  KPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKV 659
            KP+GCV++F  N+KAF+PNKEISEAFV++ Q+HLRLGQ+V+VK+L H  +++++I + K+
Sbjct: 604  KPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIASCKI 663

Query: 660  SSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQN 719
            S+E S KQK+AI  LVVG+SI+D  V+EKTKDSV+VE  D GLRGVIY GHLSD ++EQN
Sbjct: 664  SAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRIEQN 723

Query: 720  RALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPM 779
            RA  KKL+I S ++G+V+DKD++T VFNMSCKKSLIKDA    LPL+F DIK+KD   PM
Sbjct: 724  RASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKTEPM 783

Query: 780  HGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENER 839
            HGYVKS+SDRG+FVAF GKFVGLVLPSYA E+RD+DI KK+YINQSVTVYLLRTDEE+ER
Sbjct: 784  HGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEEHER 843

Query: 840  FLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLA 899
            FLLT+   +T  KK +S    + +NPVD S+K +S +++G VTKA + SVKK QLNV LA
Sbjct: 844  FLLTILKQKTDVKKINS----SVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLA 899

Query: 900  DNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVN 959
            DN+HGR+  SE++D+FE+I+  K PL+ +K  D + V+VIGFHD K+ KFLPISH T  +
Sbjct: 900  DNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKS 959

Query: 960  TVLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELS 1019
             ++ELSAK S+L       +           GF+NN++    WLT++P +KAK+P FE+S
Sbjct: 960  HLVELSAKPSSLTSPVSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEIS 1019

Query: 1020 DDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIV 1079
            D+G  F+  ++E +P+G A++V VK +D  H  + VSAR HAI+ I +IK  D LPAR++
Sbjct: 1020 DEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVI 1079

Query: 1080 KVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINL 1139
             V D+Y+LL LG  +TGV+F+TDAL+++SLSL+ VY+ K  +++ A+V+ VD++N KINL
Sbjct: 1080 SVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINL 1139

Query: 1140 SLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKE 1199
            SLR+    DR I+S  +LK+GD+VRGF+KS+TDKG+F+ LS  LQAFVPVSKLTDA+IK+
Sbjct: 1140 SLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKD 1199

Query: 1200 WKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVT 1259
            WKKF++  Q + GKVVNC++D R+LLT++ESEVNG+L +LKSY+D+  GDIF GSVKNVT
Sbjct: 1200 WKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVT 1259

Query: 1260 DFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLK 1319
            DFGVFVKL  T+NVTGLAHKSE++D+KID+L  LFGEGDKVKAI+LKTNPEK Q+SLGLK
Sbjct: 1260 DFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLK 1319

Query: 1320 ASYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXD---EDEA--------------MEDIE 1362
            ASYF                             D   E +A              M+D +
Sbjct: 1320 ASYFTNEKPETVEEGNEEEEELEGVDDLDIDMEDGQKESDASDKDEDKDEDQDEIMDDAQ 1379

Query: 1363 YEHTPADAPSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFX 1421
            + H  +D+ + +T+   +   V T GLSLS GFDWT SILD  Q +      + +DF   
Sbjct: 1380 FGH--SDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQDEEESSEED-EDFIKS 1436

Query: 1422 XXXXXXXXSRCNDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKA 1481
                        D+     +T+ PESVGDFERLIMGNPNSSV+WMNYMAF LQLSEVEKA
Sbjct: 1437 RKQKKKKTQIVQDKT-VDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKA 1495

Query: 1482 RELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLI 1541
            RE+ ERALKTI+FREE EKLNIWIA LNLENTFGT+ET+EDVF +ACQYMD++T+HMKL+
Sbjct: 1496 REIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLL 1555

Query: 1542 SIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPR 1601
            SIY MS K +KA EL+K  AKKFGSE VS+WV+WGEFL+ +   DEA  VL  +LKSLP 
Sbjct: 1556 SIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPT 1615

Query: 1602 RSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADAL 1661
            R+HI+VVRKFAQLEF+KGDPEQGR+LFEGLLADAPKR+D+WNVY+DQEIK   +++A+ L
Sbjct: 1616 RNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDL 1675

Query: 1662 FERVLVAKLSRKQAKFFFNKWLQL 1685
            FERV+  K++RKQAKFFFNKWLQ 
Sbjct: 1676 FERVITKKITRKQAKFFFNKWLQF 1699

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 1910 bits (4947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1692 (55%), Positives = 1239/1692 (73%), Gaps = 36/1692 (2%)

Query: 19   EAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLFGRD-----DGXXX 73
            E + +Q ++ S++ +  +V+FPRGGASALTPLELKQVANEAASDVLFG +     +    
Sbjct: 18   EDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAASDVLFGNESVKASEPASR 77

Query: 74   XXXXXXXXXXXXXXXEDAVAGKED--RTDIVEHLSFKGLTSGTVLLGQLCGVNRTDLCIA 131
                            +A +   D  R  ++EH++FK L +G+ LLGQ+  + + DLCI 
Sbjct: 78   PLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGSSLLGQISAITKQDLCIT 137

Query: 132  LTDGLRGYVPLTNISAPFTSLLEQL----------XXXXXXXXXXXXXXXXXXXXXKPHT 181
             TDG+ GYV LT+IS  FTS+LE L                               K   
Sbjct: 138  FTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKVEDAEYESSDDEDEKLDK 197

Query: 182  ITELPELSKYFTLGQWLRCVVVKNSALD--SQKKKNSRIELSIEPSKVNLFETEDLAKHT 239
              ELP L +YF +GQWLRC V+KN++L+  ++K K  RIEL+IEPS VN++  EDL K T
Sbjct: 198  SNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTIEPSSVNIYADEDLVKST 257

Query: 240  TVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNF 299
            ++QCAVKSIEDHGA LD+G+   TGFI+ KD      ++PG+VFL NITK+ DR+  VN 
Sbjct: 258  SIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAVFLGNITKKSDRSIVVNT 317

Query: 300  EFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTD 359
            +F+ K +K++QISS+DA+IPG  +D LCE IT +GI GK FG++ G ++ S  R FS  D
Sbjct: 318  DFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGLVSGVVNVSHLRTFSEED 377

Query: 360  MKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDN 419
            +KHK+ IGS+I+ RIIA L  K G+KV+++S LPHIL LE  L  TE + AFP+GY F++
Sbjct: 378  LKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDALRSTEGLDAFPIGYTFES 437

Query: 420  CKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLL 479
            C + GRDS+YLY++L D+R+G++H S+ G+    E + +RV GY+ VD  YQL++DPK L
Sbjct: 438  CSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLGYSPVDDIYQLSTDPKYL 497

Query: 480  AKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFK 539
               YLR+ DIP+G +L  CEIT+VS +GIEL +F+GQFKA V PLHISD RLVYPERKFK
Sbjct: 498  KLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVPPLHISDTRLVYPERKFK 557

Query: 540  IGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESF 599
            IGSKVKGRV+ V+++G V+VTLKKSLV+  D+++PLVS +E    + E++ KTLAT++ F
Sbjct: 558  IGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENAKNIKEKNEKTLATIQVF 617

Query: 600  KPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKV 659
            KP+GC+++F G L  FLPN EISE FV+R ++HLRLGQTV+VK+L+  A + ++I T KV
Sbjct: 618  KPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVKLLDVDADRRRIIATCKV 677

Query: 660  SSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQN 719
            S+E + +QK  I ++V GR+I+ V V+EKTKDSV+VE+ DVGLRGVIYVGHLSDS++EQN
Sbjct: 678  SNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVGLRGVIYVGHLSDSRIEQN 737

Query: 720  RALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPM 779
            RA LKKLRIG+ L G+V+DKD +TRVFNMS K SLIKDA K+ LPLT+ D+KD + + PM
Sbjct: 738  RAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKETLPLTYDDVKDLNKDVPM 797

Query: 780  HGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENER 839
            H Y+KSISD+G+FVAF GKF+GLVLPSYA +SRD+DI K FYINQSVTVYLLRTD++N++
Sbjct: 798  HAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYINQSVTVYLLRTDDKNQK 857

Query: 840  FLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLA 899
            FLL++  P+   +K+    ++   +PVD+S+K     S+G++ KA++KSVKK QLNV+LA
Sbjct: 858  FLLSLKAPKVKEEKKKVESNIE--DPVDSSIKSWDDLSIGSIVKAKIKSVKKNQLNVILA 915

Query: 900  DNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVN 959
             NLHGRVD +E++DT+EEI + K+PL+ +K  DVI VK+IG HD K+HKFLPI+H+    
Sbjct: 916  ANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHDVKSHKFLPITHKISKA 975

Query: 960  TVLELSAKKSALKG-AYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFEL 1018
            +VLELS K S LK           +  G EL GFVNN +   +WLT+SP LKA+I   +L
Sbjct: 976  SVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLWLTISPVLKARISLLDL 1035

Query: 1019 SDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARI 1078
            +D+ S F+ N++  FPLG AL+VKV  +D  H  V+   + H   ++  IKV D+LP R+
Sbjct: 1036 ADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVDINMSTIKVGDELPGRV 1095

Query: 1079 VKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKIN 1138
            +K+A+ Y+LLDLGN++TG++F+TDALN+FSL+L+  +EDKI ++I  +V+ VD +NKKI 
Sbjct: 1096 LKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNVIPTTVLSVDEQNKKIE 1155

Query: 1139 LSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIK 1198
            LSLR   A  R I SH+DLKQG++V G +K+V DKGIFVYLSR ++AFVPVSKL+D+Y+K
Sbjct: 1156 LSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRKVEAFVPVSKLSDSYLK 1215

Query: 1199 EWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNV 1258
            EWKKFYK MQ + GKVV C+ DSRI LT++ESE+NG+LK+LK+Y+D+K+GD+F+G++K+V
Sbjct: 1216 EWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTYSDIKAGDVFEGTIKSV 1275

Query: 1259 TDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGL 1318
            TDFGVFVKL NT+NVTGLAH +EI+D K +DLS LFG GD+VKAI+LKTNPEK Q+SL L
Sbjct: 1276 TDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAIVLKTNPEKKQISLSL 1335

Query: 1319 KASYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXDEDEAMEDIEYEHTPADAPSHETSSK 1378
            KAS+F K                           DEDE M D  +  + +++   + +++
Sbjct: 1336 KASHFSKE-------AELASTTTTTTTVDQLEKEDEDEVMADAGFNDSDSESDIGDQNTE 1388

Query: 1379 A---HKEAVPTGLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFXXXXXXXXXSRCNDR 1435
                  E    GLSLSAGFDWT SILD +  +      + +DFT             N  
Sbjct: 1389 VADRKPETSSDGLSLSAGFDWTASILD-QAQEEEESDQDQEDFTENKKHKHKRRKE-NVV 1446

Query: 1436 QD--CRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTIS 1493
            QD     +T+APESV DFERL++GNPNSSV+WMNYMAFQLQLSE+EKARELAERALKTI+
Sbjct: 1447 QDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAERALKTIN 1506

Query: 1494 FREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKA 1553
            FREE EKLNIWIAMLNLENTFGT+ETLE+VF RACQYMD+YTIH KL+ IY +S K DKA
Sbjct: 1507 FREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEISEKFDKA 1566

Query: 1554 VELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQ 1613
             EL+KA AKKFG E VS+WVSWG+FL++H +  EAR +L  ALK+LP+R+HI+VVRKFAQ
Sbjct: 1567 AELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEVVRKFAQ 1626

Query: 1614 LEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVLVAKLSRK 1673
            LEFAKGDPE+GR+LFEGL+ADAPKRID+WNVY+DQE+K+ ++ + + LFER++  K++RK
Sbjct: 1627 LEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIITKKITRK 1686

Query: 1674 QAKFFFNKWLQL 1685
            QAKFFFNKWLQ 
Sbjct: 1687 QAKFFFNKWLQF 1698

>Scas_594.4
          Length = 1722

 Score = 1876 bits (4860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1704 (54%), Positives = 1234/1704 (72%), Gaps = 44/1704 (2%)

Query: 8    KRKLNNEQRP--EEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLF 65
            KRK  +E+ P   E A +Q  + S++ +  +V+FPRGG+SALTPLELKQVANEAA+DVLF
Sbjct: 6    KRK-RDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAANDVLF 64

Query: 66   GRDDGXXXXXXXXXXXXXXXXXXEDAVAGKEDRT-------DIVEHLSFKGLTSGTVLLG 118
            G++                    +     +E           +V+H++FK L  G+++LG
Sbjct: 65   GKETSTDVAESTTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIGSLVLG 124

Query: 119  QLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXX-----XX 173
            Q+  +++TD+CI+ TDGL GYV LT+ISAPF ++LE+L                      
Sbjct: 125  QISEISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDEEYDSS 184

Query: 174  XXXXKPHTITE----LPELSKYFTLGQWLRCVVVKNSAL--DSQKKKNSRIELSIEPSKV 227
                +    T+    LP L  YF +GQWLRC V+ N+AL    +K K  +IELSIEPS V
Sbjct: 185  DDEEEKEKATKDSIGLPSLENYFKVGQWLRCSVISNTALLPKDKKNKKKKIELSIEPSVV 244

Query: 228  NLFETEDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANI 287
            N    ED+ +  +VQCAVKSIEDHGA+LD+G+   TGFIS KD  +   ++PG+VFL N+
Sbjct: 245  NTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVFLGNV 304

Query: 288  TKRGDRTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFL 347
            TK+ DRT T+N +F+ K +K++ ISSVDAV+PG  +D LC+ ITN+GI+GK FG++  F+
Sbjct: 305  TKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLVPSFI 364

Query: 348  SESQARVFSVTDMKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEA 407
            S +  RVF   ++KH +A+GSNI  RIIA L TK+ +K +L+S LPHI SL+  L E E 
Sbjct: 365  STAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLGEVEN 424

Query: 408  MHAFPVGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVD 467
            + AFP+G++ D+C + GRDS YLY+++ D+R+G++H S+ G+    + +KARV G+N++D
Sbjct: 425  LTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGFNSID 484

Query: 468  GYYQLTSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHIS 527
              Y+L++DP++L   YLRS DIP+G +L  CEITAVS  GIEL +F+GQFKA V P+HIS
Sbjct: 485  NLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPPMHIS 544

Query: 528  DIRLVYPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAE 587
            D RLVYPERKFKIGSKVKGRVL+++N+G +YVTLKK+LV+  D DI L+S+F    ++ E
Sbjct: 545  DTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAKEIQE 604

Query: 588  EDGKTLATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHV 647
            ++ KT+ATV +F+PSGC+V F G + AFLPN EISE FV++ ++HLRLGQT+VVK+L+  
Sbjct: 605  KNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKLLKID 664

Query: 648  AKQSKVIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIY 707
             + ++++VT K+S++ +EK+K  I  L+ GRS+V V VVEKTKDSV+VEL +  LRGVIY
Sbjct: 665  QENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLRGVIY 724

Query: 708  VGHLSDSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTF 767
            VGHLSD+++EQNRA +KK+ IGS L+G+V+DKD +T+VFN+S K+SLIKDA  ++ PLT+
Sbjct: 725  VGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVSPLTY 784

Query: 768  VDIKDKDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVT 827
             DIK K   TP+HGY+KSIS++G+FVAF GKFVGLVLPSYA ESRDVDI K FYINQSVT
Sbjct: 785  ADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYINQSVT 844

Query: 828  VYLLRTDEENERFLLTMSPPQTSNKKEDSNH--DVAAVNPVDASVKIISQYSVGTVTKAR 885
             YLLR+D++NERFLLT+  P T   K+DS+       + P+D ++K +  ++ G V K +
Sbjct: 845  AYLLRSDDDNERFLLTLRTPST---KDDSSKVTGTETLKPIDPAMKDLKDFTTGKVVKVQ 901

Query: 886  VKSVKKTQLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSK 945
            +K +KK QLNVVLADNLHGR+D +E++D+F +I+N   PL  FK G++ID K+IG HD K
Sbjct: 902  IKGIKKNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDIK 961

Query: 946  THKFLPISHRTGVNTVLELSAKKSALKGA-YQPIEFSGMKNGDELIGFVNNFAKGFIWLT 1004
            +H+FLPISH     +VLELS K S ++    + +  S +  GDEL GFVNN+    +WLT
Sbjct: 962  SHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWLT 1021

Query: 1005 LSPALKAKIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITD 1064
            +SP LKAKI  F+L++DG   +  ++++FPLGCAL VKV  +D  H +V+V+ R H    
Sbjct: 1022 VSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEIS 1081

Query: 1065 IKDIKVADKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMIL 1124
             + +KV D +P+RI+K+ADSY+LLDLGN++ G+AF+TDAL++FS+ L+  Y+     ++ 
Sbjct: 1082 FESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIVS 1141

Query: 1125 ASVVGVDVENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQ 1184
            A +V +D ENKK+NLSLRTE A    I SH D+ QGDVV G +KS++DKGIFVYLSR++ 
Sbjct: 1142 AKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSIN 1201

Query: 1185 AFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYAD 1244
            AFVPVSKL+D Y+K+WKKF+K MQ + GKVVN E DSRILLT++ESEVNG+LKILK+Y D
Sbjct: 1202 AFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYDD 1261

Query: 1245 LKSGDIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAII 1304
            +K  +I++GSVKNVTDFGVFVKL NT+NVTGLAH SEI+D K +DL+ LFG GD+VKA +
Sbjct: 1262 IKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAYV 1321

Query: 1305 LKTNPEKNQVSLGLKASYFQKAHXXXXXXXXXXXXXXXXXXXXXXXXXDEDEAMEDIEYE 1364
            LK NPEK Q+SL LKAS F   +                         D DE ME ++Y 
Sbjct: 1322 LKVNPEKKQLSLSLKASRFGNTN-------------ESKVEEKETVDADGDEIMEAVDYN 1368

Query: 1365 HTPAD--APSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFX 1421
            + P+D    + E      K  + T GLSLS GFDWT SILD  Q +      ED   T  
Sbjct: 1369 NAPSDNENETEEILETVSKPKISTDGLSLSTGFDWTASILDQAQAEESSEEDEDFTETKR 1428

Query: 1422 XXXXXXXXSRCNDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKA 1481
                    +   D+     +T+APESV DFERLI+GNPNSSVIWMNYMAFQLQLSE+EKA
Sbjct: 1429 NRHKKRKQTIVEDKT-IDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKA 1487

Query: 1482 RELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLI 1541
            RELAERALKTI+FREE EK NIW+AMLNLENTFG+DETLEDVF+RACQYMD++T+H +L+
Sbjct: 1488 RELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLL 1547

Query: 1542 SIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPR 1601
            SIY MS K DKA EL+K  AKKFGSENVS+WVSWG+FL +H +  EAR +L+ ALK+LP+
Sbjct: 1548 SIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPK 1607

Query: 1602 RSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADAL 1661
            R HI+VVRKFAQLEFAKGDPE GR+LFEGL+ADAPKRIDIWNVYLDQEIK++ + + + L
Sbjct: 1608 RDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDL 1667

Query: 1662 FERVLVAKLSRKQAKFFFNKWLQL 1685
            FERV+  K++RKQAKFFFNKWL+ 
Sbjct: 1668 FERVVSRKITRKQAKFFFNKWLEF 1691

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 1716 bits (4445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1681 (50%), Positives = 1162/1681 (69%), Gaps = 28/1681 (1%)

Query: 18   EEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLFGRD-----DGXX 72
            +E   RQ    +++ +  +++FPRGG+SALTPLELK VANEAA DVLFG +     +   
Sbjct: 11   KEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPLTEDDA 70

Query: 73   XXXXXXXXXXXXXXXXEDAVAGKEDRTDIVEHLSFKGLTSGTVLLGQLCGVNRTDLCIAL 132
                                   E R+ I+EHL+F  +  GT+LLGQ+  + + DL I  
Sbjct: 71   GKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLRITF 130

Query: 133  TDGLRGYVPLTNISAPFTSLLEQLXXXXXXXXXXXXXXXXXXXXXKPHTITELPELSKYF 192
            TDGL G+V LT+IS   TSLLE +                            LP L  YF
Sbjct: 131  TDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKEDDAEYESSDDESEQK--SLPNLRHYF 188

Query: 193  TLGQWLRCVVVKNSALDSQK-KKNSRIELSIEPSKVNLFETEDLAKHTTVQCAVKSIEDH 251
             +GQWLRC V KN+AL  +  K+  RIEL+IEPS VN F+ ED+ K+T +QC+V+SIEDH
Sbjct: 189  KVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQCSVESIEDH 248

Query: 252  GALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNFEFTAKNSKVSQI 311
            GA LDLGV  +TGFI+ KD +   ++ PGSVF++ ITK+ DR+  V+ +F+ K +K++ I
Sbjct: 249  GATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSVKKNKMTSI 308

Query: 312  SSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTDMKHKYAIGSNIK 371
            SS+D+V+PG  +D LCE+IT+ GI+GK FG +  F+ +   + FS  D+KHK+++GSNI 
Sbjct: 309  SSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHKFSLGSNIP 368

Query: 372  VRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDNCKLLGRDSQYLY 431
             RI+A++  K G++V+++S LPH++SL   L   E++ AFP+G++ D   + GRDS YLY
Sbjct: 369  CRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVKGRDSSYLY 428

Query: 432  VSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLLAKPYLRSADIPV 491
            +++SD+ IG++H S  G+ I Q+ +K+RV GY+  D  ++LT+DP+ L   Y+RS DIPV
Sbjct: 429  LAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKYIRSKDIPV 488

Query: 492  GTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFKIGSKVKGRVLHV 551
            G + + CEI   S +G+EL L  GQF AFV PLHISDIRL+YPERKFKI SK K R+L+V
Sbjct: 489  GEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASKTKCRILNV 548

Query: 552  DNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESFKPSGCVVTFLGN 611
            DN G +  T+KKSLV+  + + P++  FE    +  ++ KT+ TV+SF   GCV+ F G 
Sbjct: 549  DNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHGCVIMFFGG 608

Query: 612  LKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKVSSEDSEKQKAAI 671
            +  FLP  E+SE FV+RA+DHLRLGQTV VKVLE   ++ ++IVT KVS+E++++QK+ I
Sbjct: 609  VTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEEAQQQKSII 668

Query: 672  NDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQNRALLKKLRIGSS 731
              L +G+SI++  VVEKTKDSV+VE+ DVG+RGVIYVGH+SD ++EQ RA +KK+RIGS 
Sbjct: 669  ESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEIKKIRIGSK 728

Query: 732  LQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPMHGYVKSISDRGI 791
            L G+V+DKD +T++FN+S KKSL+KDA    LP TF +I       P+HGYVKSIS  G+
Sbjct: 729  LTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYVKSISSTGV 788

Query: 792  FVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENERFLLTMSPPQTSN 851
            FVAFTGKFVGLVLPSYA ESR VDI K FY NQSVT YLLRTD++NERFLLT+  P    
Sbjct: 789  FVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLTLKAP---- 844

Query: 852  KKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLADNLHGRVDASEI 911
            K E +   ++A N +D S+K +    +G +  A++K VKK QLN++LADN+HGRVD SE+
Sbjct: 845  KVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVDISEV 904

Query: 912  YDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVNTVLELSAKKSAL 971
            +D + +I++ K PL+ +K+ D + VK+IG HD K+HK LPI+H     TV EL+ K S L
Sbjct: 905  FDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQL 964

Query: 972  KGA-YQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELSDDGSVFTGNLD 1030
            K    + ++   +  GDE+I FVNN+    +WLT++P +KAK+  F+LS++  +   N++
Sbjct: 965  KSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNVE 1024

Query: 1031 ESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIVKVADSYLLLDL 1090
            + FPLG  LKV V   D    I+ V+ R   I  I D+KV      +IVKV   YLL++L
Sbjct: 1025 DDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIEL 1084

Query: 1091 GNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINLSLRTEDATDRY 1150
             N++TG++   +ALN+F+  L  V+  K    + A +  V  + KK+ L L  +++T + 
Sbjct: 1085 ENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQK 1144

Query: 1151 ILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEWKKFYKTMQPI 1210
            I SH DLK G+VV G +K+VTDKG+FV+L ++++AFVPVSKL+D+Y+KEWKKFYK MQP+
Sbjct: 1145 ITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQPV 1204

Query: 1211 TGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVTDFGVFVKLHNT 1270
             GK+V+C  D RILLT++E+EVNG+LK+LK+Y+D+K GDIF+G+V+NVTDFGVFVKL NT
Sbjct: 1205 VGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDNT 1264

Query: 1271 LNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLKASYFQKAHXXX 1330
             NVTGLAH +EI+D   +D+  +FG GD+VKA +LK+NPEK Q+SL LKAS+F       
Sbjct: 1265 ANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFN------ 1318

Query: 1331 XXXXXXXXXXXXXXXXXXXXXXDEDEAMEDIEYEHTPADAPSHETSSKAHKEAVPT---G 1387
                                  D+DE M+D    ++ ++A   E +  +    V +   G
Sbjct: 1319 --TNETITEKAESQPQPRKIDEDQDELMDDEVVYNSESEASDDEEAHSSKSTTVISNDGG 1376

Query: 1388 LSLSAGFDWTGSILDPEQGKTMRMSSEDD--DFTFXXXXXXXXXSRCNDRQDCRHHTKAP 1445
            LSLSAGFDWT SILD     +   S E+D  +            +   D+     +T+AP
Sbjct: 1377 LSLSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKNLVEDKT-IDINTRAP 1435

Query: 1446 ESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWI 1505
            ESV DFERLI+GNPNSSVIWMNYMAFQLQLSE++KARELAERALKTI++REE EKLNIWI
Sbjct: 1436 ESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWI 1495

Query: 1506 AMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFG 1565
            AMLNLENTFG++ETLEDVF R+CQYMD++T+H KLI IY +S K DKA EL+K   KKFG
Sbjct: 1496 AMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFG 1555

Query: 1566 SENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGR 1625
            SE  S+WVSW  F+L+  +PD+   +L+ ALKSLP+R+HI+VVRKFAQLEF++G+PE+GR
Sbjct: 1556 SEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGR 1615

Query: 1626 ALFEGLLADAPKRIDIWNVYLDQEIKSS-NRARADALFERVLVAKLSRKQAKFFFNKWLQ 1684
            +LFEGLLADAPKRIDIWNVYLDQEIK   N++R + LFERV+  K++RKQAKFFFNKWLQ
Sbjct: 1616 SLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQ 1675

Query: 1685 L 1685
             
Sbjct: 1676 F 1676

>Scas_713.42
          Length = 699

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 18/207 (8%)

Query: 1439 RHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEH 1498
            +H  +   SV  FER ++ N +   +W+ Y+  +L+L  +  AR L +RA+ T+   ++ 
Sbjct: 84   QHDIRRARSV--FERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTLPRVDK- 140

Query: 1499 EKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYK 1558
                +W   L +E +    + +  +FR+ C            +      +  +   E+Y 
Sbjct: 141  ----LWYKYLFVEESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVYS 196

Query: 1559 AAAKKFGSENVSLWVSWGEFLLTHEQPDEARA-------VLAQALKSLP--RRSHIDVVR 1609
                      V+ W+SW +F + H      R        VL +  K+ P  +   I+   
Sbjct: 197  KYVA--IHPKVATWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAI 254

Query: 1610 KFAQLEFAKGDPEQGRALFEGLLADAP 1636
             FA  E ++ + ++ RA+++ L+   P
Sbjct: 255  AFANWEASQMEYDRSRAIYKILIDKWP 281

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 91/237 (38%), Gaps = 35/237 (14%)

Query: 1464 IWMNYMAF-QLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLED 1522
            +W+ Y+A+ +L ++++   R L ++ +  I   +      IWI     E       T   
Sbjct: 372  LWVRYLAYIELSINDIVSCRNLFKKLINEIIPHKSFTFGKIWIMYSEFEIRQNDIGTARK 431

Query: 1523 VFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTH 1582
            +  R+        +  + I I     + D+   LY+   + F   N+  W+++ E     
Sbjct: 432  ILGRSLGLCPKPKVFRRYIEIEISLREFDRVRRLYEKFLE-FDPSNLKTWIAYAELEQNL 490

Query: 1583 EQPDEARAVL------AQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAP 1636
            +  + AR++       A  + S+   S + V+++F + E    +    R L+E  L  + 
Sbjct: 491  DDEERARSIFNILLDDANDVISMSDSSKVIVIKRFIEFETDMEEYNNARELYEHYLQLSN 550

Query: 1637 KRIDIWNVY---------------------------LDQEIKSSNRARADALFERVL 1666
               ++W  Y                           +D +I+  N+ R  A+FER L
Sbjct: 551  FSPEVWTSYAMYESATPTDDQLKALREKMDENEDEEVDFKIEEVNKERCRAIFERAL 607

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 74/192 (38%), Gaps = 13/192 (6%)

Query: 1451 FERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNL 1510
            +ER ++ +     +W+ Y+  +++   +  AR L +RA   +   ++     +W   L L
Sbjct: 86   YERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNALPRVDK-----LWFKYLLL 140

Query: 1511 ENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVS 1570
            E + G    +  ++ R C +          I         +    +Y           + 
Sbjct: 141  EESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLNFENVRNIYSKFV--LVHPQID 198

Query: 1571 LWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSH---IDVVR---KFAQLEFAKGDPEQG 1624
             W+ W  F  TH      R V + AL +L   S    +D+ R    FA  E ++G+ E+ 
Sbjct: 199  TWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEASQGEYERS 258

Query: 1625 RALFEGLLADAP 1636
            R L+   +   P
Sbjct: 259  RTLYRLAVERWP 270

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 1601 RRSHIDVVR--KFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARA 1658
            +R+ +D+ +  ++AQ EF + D  + R+++E  L      I +W  Y+D EIK  N   A
Sbjct: 57   KRNRLDLRQWMRYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHA 116

Query: 1659 DALFER 1664
              L +R
Sbjct: 117  RNLLDR 122

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 1468 YMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETL 1520
            Y+AF+   +E EKAREL E+ L    +      +NIWI     E+T  T+  L
Sbjct: 510  YIAFETDAAEYEKARELYEKYLILSRY-----DVNIWINQALFESTIPTETQL 557

>Kwal_56.23875
          Length = 680

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 65/161 (40%), Gaps = 9/161 (5%)

Query: 1439 RHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEH 1498
            +H  +   S+  FER +  N     +W+ Y+  +L+   +  AR L +RA   +   E+ 
Sbjct: 72   QHDMRRARSI--FERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRACNLLPRVEK- 128

Query: 1499 EKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYK 1558
                +W+  + +E + G    +  +F R C    +   +   +       + +KA ++Y 
Sbjct: 129  ----LWLKYVIVEESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKVYS 184

Query: 1559 AAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSL 1599
                   +  V  W+ W  F   H   D  R V +  L +L
Sbjct: 185  GYVSVHPA--VDTWLKWVAFEKRHGSLDTTRQVFSLGLDTL 223

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 74/183 (40%), Gaps = 5/183 (2%)

Query: 1464 IWMNYMAF-QLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLED 1522
            +W+ Y+ + +L ++++ K R   E  +K +   ++     IW+     E           
Sbjct: 357  LWIRYLLYLELDIADIPKTRSSFETLVKDVIPHKKFTFAKIWVMYSKFELRQENLAKARK 416

Query: 1523 VFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTH 1582
            +F  A        I  + I+      + D+  ++Y+     F   + + W+++ E     
Sbjct: 417  IFGYALGTCPKQKIFKEYINFEIQLKEFDRVRKIYEQLLA-FDPLSNANWIAYAELEENL 475

Query: 1583 EQPDEARAVLAQALKS---LPRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRI 1639
               D AR +   A+     LP  S I ++++    E   G+ E  RA++  LLA +    
Sbjct: 476  GDEDRARGIYHIAISENLGLPNESKIGIIKRLISFETDLGEYENARAVYRTLLALSNNSA 535

Query: 1640 DIW 1642
             IW
Sbjct: 536  KIW 538

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 1610 KFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERV 1665
            ++A+ E  + D  + R++FE  L    + + +W  Y+D E+K+ N   A  L +R 
Sbjct: 64   RYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRA 119

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 1250 IFDGSVKNVTDFGVFVKLHNTL--NVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKT 1307
            +++G V+N+T FG FV++  T   N  GL H SE+SD +  D   +  +G  +   ++K 
Sbjct: 180  VYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKI 239

Query: 1308 NPEKNQVSLGLK 1319
                 ++SL +K
Sbjct: 240  Q-NNGKISLSMK 250

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 4/42 (9%)

Query: 1250 IFDGSVKNVTDFGVFVKL---HNTLNVTGLAHKSEISDSKID 1288
            ++ G V+NVT FG FV++    NT NV GL H SE+S S +D
Sbjct: 181  VYPGKVQNVTKFGCFVRIFGVRNT-NVDGLVHVSELSSSHVD 221

>Kwal_55.21029
          Length = 1105

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 7/74 (9%)

Query: 1250 IFDGSVKNVTDFGVFVKLHNTLN--VTGLAHKSEISDSKIDDLSLLFGEGDK--VKAIIL 1305
            I+ GSVK +T FG F+++  T +    GL H SE+++ +++D S L     +  VK I +
Sbjct: 179  IYSGSVKKITTFGCFIRIQGTKDPRCDGLLHISEMANRRLEDPSELVSLNQQVYVKVIRI 238

Query: 1306 KTNPEKNQVSLGLK 1319
            + N    ++SL +K
Sbjct: 239  QNN---GKISLRMK 249

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1571 LWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEG 1630
            +W+ + EF +  +  ++AR++L ++L   P+R      + +  LE    + ++ R L+E 
Sbjct: 402  IWILYAEFEIRQDNLEKARSILGRSLGLCPKRK---TFKYYIDLETKLREFDRVRILYEN 458

Query: 1631 LLADAPKRIDIWNVYLDQE 1649
             L   P  +D W  Y++ E
Sbjct: 459  FLKFDPLNLDTWRAYVEFE 477

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 77/174 (44%), Gaps = 16/174 (9%)

Query: 1465 WMNYMAFQLQLSEVEKARELAERALKT-ISFREEHEKLNIWIAMLNLENTFGTDETLEDV 1523
            WM Y  F+++  ++ +AR + ERAL+  IS+      + +WI  +  E   G      ++
Sbjct: 64   WMRYAVFEIEQHDMRRARSIFERALRVHISY------VPLWIRYIESELKLGYINHARNI 117

Query: 1524 FRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGS--ENVSLWVSWGEFLLT 1581
              RA   +       KL   Y +  +     ++ +   +K+ S      +W S+ +F + 
Sbjct: 118  LERAITKLPRVD---KLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAHVWDSFTDFEVR 174

Query: 1582 HEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADA 1635
             E+ ++ R + ++ +   P+ S     RK+   E   G  +  R+++  L  DA
Sbjct: 175  QERYEDVRNIYSKYVLIHPQFS---TWRKWINFEVRYGSTKTVRSVY-SLALDA 224

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 84/207 (40%), Gaps = 18/207 (8%)

Query: 1439 RHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEH 1498
            +H  +   S+  FER ++ + +   +W+ Y+  +L++  +  AR L  RA+ T+   ++ 
Sbjct: 78   QHDMRRARSI--FERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDK- 134

Query: 1499 EKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYK 1558
                +W   L +E +    E +  ++ + C            +         +   E+Y 
Sbjct: 135  ----LWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIYS 190

Query: 1559 AAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQA------LKSLPRRSHIDV---VR 1609
                      +  W+ W  F   H   +  R+V + A      L++L   S ++V   V 
Sbjct: 191  KYV--MAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVN 248

Query: 1610 KFAQLEFAKGDPEQGRALFEGLLADAP 1636
             FA  E A+ + E+  AL++  +   P
Sbjct: 249  SFAHWEAAQQEYERSSALYQIAIEKWP 275

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 1571 LWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEG 1630
            +W+ + +FL+ H+   +AR +L +A+   P+       + + +LE    + ++ R ++E 
Sbjct: 406  IWLMYAKFLIRHDDVPKARKILGKAIGLCPKAK---TFKGYIELEVKLKEFDRVRKIYEK 462

Query: 1631 LLADAPKRIDIWNVY--LDQEIKSSNRARA 1658
             +   P  + IW+ Y  L++ +   +R R 
Sbjct: 463  FIEFQPSDLQIWSQYGELEENLGDWDRVRG 492

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 63/150 (42%), Gaps = 27/150 (18%)

Query: 1555 ELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVR--KFA 1612
            ++YK   K  GS N+ +        L  E+  E +       +   +R+ +D+ +  ++A
Sbjct: 21   DVYKKGQKARGSTNIDI--------LDLEELREYQRRKRTEYEGYLKRNRLDMGQWIRYA 72

Query: 1613 QLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSS---------NRA-----RA 1658
            Q E  + D  + R++FE  L      I +W  Y+D E+K           NRA     R 
Sbjct: 73   QFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRV 132

Query: 1659 DALFERVLVAKLSRKQAKF---FFNKWLQL 1685
            D L+ + L+ + S    +     + KW  L
Sbjct: 133  DKLWYKYLIVEESLNNVEIVRSLYTKWCSL 162

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 74/193 (38%), Gaps = 13/193 (6%)

Query: 1451 FERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNL 1510
            FER +   P   V+W+ Y+  +L+  +V  AR L  RA   +   +      +W   + +
Sbjct: 83   FERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALLPRVD-----KLWYKYVLM 137

Query: 1511 ENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVS 1570
            E + G  E +  V+ + C    A       +       + +   E+Y            +
Sbjct: 138  EESLGQVELVRGVYTKWCTLEPAAAAWDAFVDFETRQGQVEHVREVYSRYV--MVHPVAA 195

Query: 1571 LWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDV------VRKFAQLEFAKGDPEQG 1624
             W+ W  F   H      R V + A  +L   +  DV      V  FA+ E  + + E+ 
Sbjct: 196  TWLKWVAFERKHGDAGTVRRVYSLACDTLTAFAGADVHEVEQLVVSFAEWEATQQELERS 255

Query: 1625 RALFEGLLADAPK 1637
            RA+    ++  P+
Sbjct: 256  RAVLSVAVSRWPE 268

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 13/86 (15%)

Query: 1589 RAVLAQALKSLPRRSHIDVVR--KFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYL 1646
            R+   +ALK    R+ +DV +  ++A  E+ + D  + R++FE  LA AP  + +W  Y+
Sbjct: 46   RSEFEEALK----RNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYV 101

Query: 1647 DQEIKSS--NRA-----RADALFERV 1665
            D E+++   N A     RA AL  RV
Sbjct: 102  DCELRARDVNHARNLLVRATALLPRV 127

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 36/131 (27%)

Query: 1572 WVSWGEFLLTHEQPDEARAVLAQALKSLPR----RSHIDV---------VRK-------- 1610
            W+ + EF +  E+ D+AR +L  +L   P+    + +ID+         VR+        
Sbjct: 398  WIMYAEFEIRQEKLDKARKILGMSLGMCPKPKLFQYYIDLEIKLKEFDRVRRLHEKLLEF 457

Query: 1611 ----------FAQLEFAKGDPEQGRALFE-GLLADA----PKRIDIWNVYLDQEIKSSNR 1655
                      +A+LE   GD ++ R ++E GL AD      +++ +   Y+  E  +S  
Sbjct: 458  QPDVLSNWIEYAELEENLGDEDRARGIYEIGLTADGGLSQARQLQLMQRYIQFETDASEF 517

Query: 1656 ARADALFERVL 1666
             RA AL+ R +
Sbjct: 518  ERARALYSRYV 528

>CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces
            cerevisiae YDR416w SYF1 synthetic lethal with CDC40,
            hypothetical start
          Length = 835

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 25/135 (18%)

Query: 1534 YTIHMKLISIYAMSSKDDKAVELYKAAAKKFGS------ENVSLWVS----WGEFLLTHE 1583
            + IH KL S         +A++L  + A++  +      + V LW S      EFL    
Sbjct: 661  FEIHNKLFS---------RAIDLLMSGARRPYTNKEQLKQRVDLWESAISKCEEFL---- 707

Query: 1584 QPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFE--GLLADAPKRIDI 1641
             PD  R +L++ ++ LP    I  V KF +LE +  D  + R L +    L    K  ++
Sbjct: 708  GPDSLRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQYGAQLLPPIKNEEL 767

Query: 1642 WNVYLDQEIKSSNRA 1656
            W ++   E++  +++
Sbjct: 768  WGLWEQFELEHGDKS 782

>Kwal_47.18684
          Length = 809

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 97/230 (42%), Gaps = 16/230 (6%)

Query: 1438 CRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREE 1497
            C       E+   +E LI     S + ++NY  F       E++  + ERA+ T     +
Sbjct: 529  CSTKDDVSETKSAYEELISLKLASPLQFLNYAQFLQTQDRWEESFRVYERAIATFPAEVQ 588

Query: 1498 HEKLNIWIAMLNLENTFGTD---ETLEDVFRRACQY----MDAYTIHMKLISIYAMSSKD 1550
             E   +W   L L+ +   D   ETL D+F +A +     +D  T  +    +      D
Sbjct: 589  FE---VW--SLYLQYSLERDRPIETLRDLFEQALRLVDEGIDCPTFFILYSDLEHSQGLD 643

Query: 1551 DKAVELYKAAAKKFGS--ENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVV 1608
             +A+++      K  +    ++LW +  E    +  P+ +R++  Q +++LP    I  V
Sbjct: 644  KRAIDILARGCVKCKNVPAQLTLWQTCIERSKEYLGPESSRSLYEQCIQTLPNSKAIVFV 703

Query: 1609 RKFAQLEFAKGDPEQGRAL--FEGLLADAPKRIDIWNVYLDQEIKSSNRA 1656
              FA+ E +  +  + RA   +   L    +   +W  + + E++  +++
Sbjct: 704  IDFAKTEESLHENGRARAALKYGAHLLPPGRNTQLWEFWNEFELRHGDKS 753

>YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiation
            factor eIF2alpha subunit [915 bp, 304 aa]
          Length = 304

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 1249 DIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTN 1308
            DI   +V+ + + G +VKL    N+ G+   SE+S  +I  +  L   G    A++L+ +
Sbjct: 18   DIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVD 77

Query: 1309 PEKNQVSLG 1317
             EK  + L 
Sbjct: 78   KEKGYIDLS 86

>Scas_479.2
          Length = 302

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 1249 DIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTN 1308
            DI   +V+ + + G +VKL    N+ G+   SE+S  +I  +  L   G    A++L+ +
Sbjct: 18   DIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVD 77

Query: 1309 PEKNQVSLG 1317
             EK  + L 
Sbjct: 78   KEKGYIDLS 86

>Scas_617.9
          Length = 302

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 1249 DIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTN 1308
            DI   +V+ + + G +VKL    N+ G+   SE+S  +I  +  L   G    A++L+ +
Sbjct: 18   DIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVD 77

Query: 1309 PEKNQVSLG 1317
             EK  + L 
Sbjct: 78   KEKGYIDLS 86

>AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH]
            complement(1330185..1331093) [909 bp, 302 aa]
          Length = 302

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 1249 DIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTN 1308
            D+   +V+ + + G +VKL    N+ G+   SE+S  +I  +  L   G     ++L+ +
Sbjct: 18   DVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIHKLIRVGKNEVVVVLRVD 77

Query: 1309 PEKNQVSLG 1317
             EK  + L 
Sbjct: 78   KEKGYIDLS 86

>Kwal_33.15422
          Length = 302

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 1249 DIFDGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTN 1308
            D+   +V+ + + G +VKL    N+ G+   SE+S  +I  +  L   G     ++L+ +
Sbjct: 18   DVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIQKLIRVGRNEVVVVLRVD 77

Query: 1309 PEKNQVSLG 1317
             EK  + L 
Sbjct: 78   KEKGYIDLS 86

>CAGL0J09878g complement(964057..965961) similar to sp|P32367
            Saccharomyces cerevisiae YBR123c TFC1, hypothetical start
          Length = 634

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 8/85 (9%)

Query: 1169 SVTDKGIFVYLSRTLQAFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRIL-LTM 1227
            SVTDKG+ ++L+  L    PV    DA     K F+    PI GK V    DS +L +TM
Sbjct: 71   SVTDKGLELFLNNGLS---PVDPWDDATSSARKPFFNE-HPIIGKRVPFRDDSIVLKITM 126

Query: 1228 KES--EVNGELKILKSYADLKSGDI 1250
             E   E NG   + K+   L S D+
Sbjct: 127  PEGTLEKNGN-DVAKALRSLDSKDV 150

>ABL100W [492] [Homologous to ScYBR055C (PRP6) - SH]
            complement(209849..212566) [2718 bp, 905 aa]
          Length = 905

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 5/108 (4%)

Query: 1536 IHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHE-QPDEARAVLAQ 1594
            +++ L  +Y+ +S   KA++L  +A KK  S +  LW+    +L  H+    +AR+ L  
Sbjct: 674  LYLLLSRVYSETSHLTKALDLLSSAVKKLPSSD-KLWIQLA-YLQEHDLNTIKARSTLE- 730

Query: 1595 ALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIW 1642
             L  L   S I +    A+LE   G+ E  R L +  +   PK  ++W
Sbjct: 731  -LGQLKNSSSIALYEARAELEDRLGNREHARLLVQEGIRKFPKSPELW 777

>Kwal_56.23065
          Length = 907

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 1459 PNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKL-NIWIAMLNLE-NTFGT 1516
            P +   W+      +  SE E A  L + A+  ++ +   E++ + +I+ L     T   
Sbjct: 601  PRNVEFWLAKSKLLVVRSEFEAAENLLKSAISALAGQSGLERVFHRFISFLRYRGRTQEA 660

Query: 1517 DETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWG 1576
             + LE+ F     Y     ++++   I A      ++ E Y    +K   EN +LW++  
Sbjct: 661  LQMLENDFLDQAPYCG--KLYLQWGQIQAELGNATQSRECYAIGTRKL-PENANLWIALA 717

Query: 1577 ---EFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQLEFAKGDPEQGRALFEGLLA 1633
               E LL   QP  AR+    AL  +P+ +   ++    Q+E   G+ +Q R L    L 
Sbjct: 718  HADESLLN--QPTRARSDFEIALLKVPKENSEPILVAQVQMEKKLGNTDQARLLVTRALK 775

Query: 1634 DAPKRIDIWNVYL 1646
              P    +W  +L
Sbjct: 776  QFPSSALLWVEHL 788

>KLLA0C14608g 1276354..1277817 highly similar to sp|P38712
           Saccharomyces cerevisiae YHR065c RRP3 required for
           maturation of the 35S primary transcript, start by
           similarity
          Length = 487

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 700 VGLRGVIYVGHLSDSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDAS 759
           +G+R    VG +S   ++Q R L++K  I  +  G +MD    T+ FN+   K L+ D +
Sbjct: 162 MGVRSTCIVGGMS--MMDQARDLMRKPHIIIATPGRLMDHLENTKGFNLRKLKYLVMDEA 219

Query: 760 KDILPLTFVDIKDKDPN-TPMHG 781
             +L + F  + D+  N  P  G
Sbjct: 220 DRLLDMEFGPVLDRILNIIPTQG 242

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 1248 GDIFDGSVKNVTDFGVFVKLHNT-LNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILK 1306
            G I+   ++N+  FG F ++  T  +  GL H S++S S++   + +   GD V   I K
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHVYVKITK 242

Query: 1307 TNPEKNQVSLGLK 1319
               +  ++SL ++
Sbjct: 243  VQ-DNGKLSLSMR 254

>CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharomyces
            cerevisiae YJR007w SUI2, translation initiation factor
            eIF2, start by similarity
          Length = 303

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 1256 KNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVS 1315
            + + + G +VKL    N+ G+   SE+S  +I  +  L   G    A++L+ + EK  + 
Sbjct: 25   QQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYID 84

Query: 1316 LG 1317
            L 
Sbjct: 85   LS 86

>Scas_720.50
          Length = 449

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 13/85 (15%)

Query: 1172 DKGIFVYLSRTLQAFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNCESDSRI----LLTM 1227
            DK  F  L RT + F  +S ++D   ++W++     QP+ G++V C  D       +L  
Sbjct: 309  DKKEFDLLERTYKKFAELS-ISD---EQWQELKSLEQPLNGRIVECTKDQETGTWSMLRF 364

Query: 1228 KESEVNGE-----LKILKSYADLKS 1247
            ++ ++NG       K+L+S  D  S
Sbjct: 365  RDDKLNGNHTSVVQKVLESINDCVS 389

>YGL130W (CEG1) [1856] chr7 (266148..267527) mRNA guanylyltransferase,
            subunit of mRNA capping enzyme, also required for
            pre-mRNA splicing, involved in Cet1p-mediated inhibition
            of transcription reinitiation [1380 bp, 459 aa]
          Length = 459

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 1172 DKGIFVYLSRTLQAFVPVSKLTDAYIKEWKKFYKTMQPITGKVVNC----ESDSRILLTM 1227
            D+  F  L RT + F  +S ++D   +EW+      QP+ G++V C    E+ +  +L  
Sbjct: 313  DRKEFEILERTYRKFAELS-VSD---EEWQNLKNLEQPLNGRIVECAKNQETGAWEMLRF 368

Query: 1228 KESEVNG 1234
            ++ ++NG
Sbjct: 369  RDDKLNG 375

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
            Saccharomyces cerevisiae YBR112c CYC8 general repressor
            of transcription singleton, hypothetical start
          Length = 941

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 1451 FERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNL 1510
            ++R +  NP    IW       L L E++ A    ++AL  +S         +W  +  L
Sbjct: 165  YQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLS---NPNIPKLWHGIGIL 221

Query: 1511 ENTFGTDETLEDVFRRAC----QYMDAYTIHMKLISIYAMSSKDDKAVELYK 1558
             + +G+ +  E+ F +      Q+  A  I+ +L  IY    K ++A+E ++
Sbjct: 222  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFR 273

>CAGL0H10098g complement(984334..986919) similar to sp|P19735
            Saccharomyces cerevisiae YBR055c PRP6
            snRNP(U4/U6)-associated splicing factor, hypothetical
            start
          Length = 861

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 1504 WIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKK 1563
            WIA   LE   G  E   ++ ++ C  +      +  +    ++  +++  ++  A A +
Sbjct: 212  WIASAKLEENCGNYELARELIQQGC--LQCPLDEIIWLENLRLNVSNNEKKKIIVANAIR 269

Query: 1564 FGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHI 1605
            F  ++V+LW+   E +   EQP     V+ +AL+ +P    I
Sbjct: 270  FQPKSVALWL---EGIKYEEQPANKFRVIQKALREIPAEEEI 308

>KLLA0A01969g complement(178458..180854) similar to sgd|S0002824
            Saccharomyces cerevisiae YDR416w SYF1 synthetic lethal
            with CDC40, start by similarity
          Length = 798

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1433 NDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTI 1492
            ND    RH  +  +    FE+ +         W+ YM + +Q  ++++ REL  +AL+++
Sbjct: 74   NDCDIFRHKDEYNKISLLFEQCLTSCGKVGDAWIMYMEWVIQFKDLKRIRELLGKALRSM 133

Query: 1493 SFREEHEKLNIWIAMLNL 1510
            S+ E HE   IW  +++ 
Sbjct: 134  SW-EYHEA--IWRVVIDF 148

>Scas_705.55
          Length = 907

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 71/170 (41%), Gaps = 11/170 (6%)

Query: 1451 FERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNL 1510
            +ER +  NP  S +W       L L ++++A    ++AL  +S         +W  +  L
Sbjct: 113  YERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLS---NPNVPKLWHGIGIL 169

Query: 1511 ENTFGTDETLEDVFRRAC----QYMDAYTIHMKLISIYAMSSKDDKAVELYKAAAKKFGS 1566
             + +G+ +  E+ F +      Q+  A  I+ +L  IY    K  +A+E ++    +  +
Sbjct: 170  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

Query: 1567 --ENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHIDVVRKFAQL 1614
              +   +W   G  L +  +   AR      L  L   +H  V+++   L
Sbjct: 230  PLQEWDIWFQLGSVLESMNEWQGAREAYEHVL--LQNENHAKVLQQLGCL 277

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 45/230 (19%), Positives = 94/230 (40%), Gaps = 18/230 (7%)

Query: 1438 CRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREE 1497
            C +    P +   +E+ I     + +I++NY  F  +    E++ ++ ERA+ T      
Sbjct: 536  CDNKDAIPSTRAAYEQAISLKIATPLIFINYAHFLQEQKLWEESFKIYERAIDTFPSDTS 595

Query: 1498 HEKLNIWIAMLNLENTFGTDETLEDVFRRACQY----MDAYTIHMKLISIYAMSSKDDKA 1553
             E  NI++A   L+N   + E + D+F +A +     +D    +         +    ++
Sbjct: 596  FEIWNIYLAE-GLKNGL-SKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEEKNGLTKRS 653

Query: 1554 VELYKAAAKKFG--SENVSLWVSWGEFLLTHEQP----DEARAVLAQALKSLPRRSHIDV 1607
            V++     K+        +LW    E  +   +       +R +  + ++ LP    +  
Sbjct: 654  VDILHRGCKETSHLDSKCTLW----ELCIYKCKKLLGDVNSRELYEECIQDLPNSKSVKF 709

Query: 1608 VRKFAQLEFAKGDPEQGRAL--FEGLLADAPKRIDIWNVYLDQEIKSSNR 1655
               FA  E + GD E+ RA+  F   L        +W+ + + E++  N+
Sbjct: 710  SLDFAVTEASHGDFERARAILNFGAQLLHPSTNQALWDYWNEFELRYGNK 759

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 80/204 (39%), Gaps = 47/204 (23%)

Query: 183 TELP-ELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSI--EPSKVNLFETEDLAKHT 239
           T+LP + SK F   Q      VK+ A  S  K N   + S+    S + LF +   +   
Sbjct: 20  TQLPIKYSKRFVRTQ--SASAVKDKARYSNPKYNKSTKASVLTGASSLALFLSYFFSGDD 77

Query: 240 TVQCAVKSIEDHGAL------LDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDR 293
           T   +VK ++ H  +      +D  V D+TGF+S           PG V    + +   R
Sbjct: 78  TNTVSVKEVKSHNRIDDCWIVIDGDVYDITGFLSKH---------PGGV--TRLMEFAGR 126

Query: 294 TATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNH-GIIGKAFGVLDGFLSESQA 352
            AT  F          Q+ S            + EK+  H   IGK  G  D  LSE + 
Sbjct: 127 DATERFH---------QMHS----------SAMLEKMKEHLTYIGKLKGAFDEELSEEEI 167

Query: 353 RVFSVTDMKHKYAIGSNIKVRIIA 376
           R+     M+ K  I S  KV  I+
Sbjct: 168 RI-----MEQKSKIPSLSKVFCIS 186

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 52/112 (46%), Gaps = 7/112 (6%)

Query: 1451 FERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAERALKTISFREEHEKLNIWIAMLNL 1510
            +ER ++ NP  S +W       L L ++++A    ++AL  +S         +W  +  L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS---NPNVPKLWHGIGIL 159

Query: 1511 ENTFGTDETLEDVFRRACQ----YMDAYTIHMKLISIYAMSSKDDKAVELYK 1558
             + +G+ +  E+ F +  +    +  A  I+ +L  IY    K  +A+E ++
Sbjct: 160  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFR 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 50,049,428
Number of extensions: 2095651
Number of successful extensions: 6638
Number of sequences better than 10.0: 52
Number of HSP's gapped: 6666
Number of HSP's successfully gapped: 79
Length of query: 1685
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1570
Effective length of database: 12,615,039
Effective search space: 19805611230
Effective search space used: 19805611230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)