Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR563C57656522710.0
Kwal_26.917655142710651e-139
KLLA0B08305g7353829911e-126
CAGL0M11264g5494478771e-111
YMR227C (TAF7)5902668311e-103
Scas_594.66552658251e-102
YDR356W (SPC110)94453658.1
AEL223C80333658.8
Sklu_2392.153093649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR563C
         (565 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   879   0.0  
Kwal_26.9176                                                          414   e-139
KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   386   e-126
CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   342   e-111
YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   324   e-103
Scas_594.6                                                            322   e-102
YDR356W (SPC110) [1182] chr4 (1186096..1188930) Spindle pole bod...    30   8.1  
AEL223C [2283] [Homologous to ScYDR258C (HSP78) - SH] (209852..2...    30   8.8  
Sklu_2392.1 YHR137W, Contig c2392 2001-3593                            29   9.9  

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/565 (80%), Positives = 455/565 (80%)

Query: 1   MGXXXXXXXXXLSPEDLGDGSKAKRIKLKGNGADELKDKQLSPTQAANNAXXXXXXXXXX 60
           MG         LSPEDLGDGSKAKRIKLKGNGADELKDKQLSPTQAANNA          
Sbjct: 1   MGPIIKIKKPKLSPEDLGDGSKAKRIKLKGNGADELKDKQLSPTQAANNAPKIKLKLKKK 60

Query: 61  XXXXXXXXXXAPVKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIED 120
                     APVKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIED
Sbjct: 61  DSEPLLPEPKAPVKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIED 120

Query: 121 DPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLP 180
           DPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLP
Sbjct: 121 DPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLP 180

Query: 181 TVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEIC 240
           TVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEIC
Sbjct: 181 TVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEIC 240

Query: 241 DARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVXXXXXXXXMTGSEIDY 300
           DARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNV        MTGSEIDY
Sbjct: 241 DARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVRNRRFRRRMTGSEIDY 300

Query: 301 VDRTVEFLLKQDGEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGVAQPAHSTDSV 360
           VDRTVEFLLKQDGEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGVAQPAHSTDSV
Sbjct: 301 VDRTVEFLLKQDGEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGVAQPAHSTDSV 360

Query: 361 LFGVXXXXXXXXXXXXXQALQVPSEADAAGAPLDEAGDEVEQDNGXXXXXXXXXXXXXXX 420
           LFGV             QALQVPSEADAAGAPLDEAGDEVEQDNG               
Sbjct: 361 LFGVDDDDHDDLELELEQALQVPSEADAAGAPLDEAGDEVEQDNGDDEDDEDDDEDEDDD 420

Query: 421 XXXXXXXXXXXXXXXXXLQHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAK 480
                            LQHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAK
Sbjct: 421 DEDDAAPKPPKPEPNENLQHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAK 480

Query: 481 LEKEVDIKRKQLLANEEILETSPATSSHRTPRPXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
           LEKEVDIKRKQLLANEEILETSPATSSHRTPRP                           
Sbjct: 481 LEKEVDIKRKQLLANEEILETSPATSSHRTPRPDEDDELDDDEDEDELDEEDLDDQDDDE 540

Query: 541 XVATPAQATTHTSALDDELDQEDMD 565
            VATPAQATTHTSALDDELDQEDMD
Sbjct: 541 EVATPAQATTHTSALDDELDQEDMD 565

>Kwal_26.9176
          Length = 551

 Score =  414 bits (1065), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/427 (55%), Positives = 294/427 (68%), Gaps = 23/427 (5%)

Query: 73  VKLKLNL-KKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILR 131
           +KLK+NL  K+T  +S  ASA  KAPR R+KP R+PGEGYDSEASDIEDDPL+EEG+ILR
Sbjct: 62  IKLKINLGSKET--SSSTASAPPKAPRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILR 119

Query: 132 VLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDR 191
           VLPD+Q EFVKN IESGD+S +S+KWKGERHAVV ING+QYGAVLVNLPT IEVNKS+DR
Sbjct: 120 VLPDVQTEFVKNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDR 179

Query: 192 KNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQ 251
           KN+LK FDVSQMLLCV  I  EE+VF L PPD+EDLV KH++ Y+ EI + +K + +GF 
Sbjct: 180 KNLLKTFDVSQMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFN 239

Query: 252 GGSLTDAESKHMDAILEKGYDYKHGITAPLYNVXXXXXXXXMTGSEIDYVDRTVEFLLKQ 311
           GG LTDAE+ ++D I++KGYDYKHG+T PLYNV        +T  E+DYV++TVE LL+Q
Sbjct: 240 GGPLTDAEANNIDNIVKKGYDYKHGLTPPLYNVRNRRFRRRLTTQEVDYVEKTVEHLLEQ 299

Query: 312 DGEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGVAQPAHSTDSVLFGVXXXXXXX 371
           D EAE  +Y+LVDED + Q+SAS  +L    Q++A SG+          LFG        
Sbjct: 300 DAEAEGVSYDLVDEDILAQRSASADEL---RQQSADSGID---------LFG--EDDHED 345

Query: 372 XXXXXXQALQV---PSE---ADAAGAPLDEAGDEVEQDNGXXXXXXXXXXXXXXXXXXXX 425
                 QALQ    P E   +D+    ++E GD+VEQDNG                    
Sbjct: 346 LEMELEQALQEDRGPIEQNVSDSCVPAVEETGDDVEQDNGEDDDEDEEEEDVEDEGDEDI 405

Query: 426 XXXXXXXXXXXXLQHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAKLEKEV 485
                        QH+ELL+DEL ELES L QN+ KL KATNPLLKSRF++SI KLEKEV
Sbjct: 406 VPNVTKPAVDEERQHSELLQDELEELESTLHQNKQKLEKATNPLLKSRFIESIKKLEKEV 465

Query: 486 DIKRKQL 492
           ++KRKQL
Sbjct: 466 ELKRKQL 472

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  386 bits (991), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 254/382 (66%), Gaps = 49/382 (12%)

Query: 72  PVKLKLNLKK--DTPPTSVP------------ASALTKAPRIRVKPPRIPGEGYDSEASD 117
           P+KLK+NLKK  D+ P  VP            ++++ K P+ R+KP R+PGEGYDSEASD
Sbjct: 104 PMKLKINLKKREDSHPQLVPHSQSHQQQQQRKSTSVVKTPKFRIKPVRVPGEGYDSEASD 163

Query: 118 IEDDPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLV 177
           +EDDPL+EEGIILRVLPDL AEFVKNSIESGDYS++SIKWKGERHAVV +NG QYGAVLV
Sbjct: 164 VEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLV 223

Query: 178 NLPTVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEK 237
           NLP++IEVNKSVDRKN+LK FDVSQML+CV  +++EE+VF LQ  DTEDL KKHFE Y+K
Sbjct: 224 NLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQK 283

Query: 238 EICDARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVXXXXXXXXMTGSE 297
           EI + RK  ++G+ GG LTDAESK+++ I+ K YDYKHGIT PLYN         M  + 
Sbjct: 284 EITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTA 343

Query: 298 IDYVDRTVEFLLKQDGEAEEFTYELVDEDAV-LQKSASTIDLAHFAQKA-------AASG 349
            DYV+RTVE LLK D EAEEF YELV+EDA+  Q+S S  DLAH+ QKA       ++ G
Sbjct: 344 FDYVERTVEKLLKLDAEAEEFGYELVNEDAIQQQRSTSAADLAHY-QKAGEHMDETSSVG 402

Query: 350 VAQ---PAHSTDSVLFGVXXXXXXXXXXXXXQALQ------------VPSEADAA----- 389
            +Q   P H T +                  QALQ            V   A AA     
Sbjct: 403 YSQEIKPHHVTGAAEEDEEEDHEEDLELELEQALQTETTDGSIPASMVNGPAGAAMSTDT 462

Query: 390 ------GAPLDEAGDEVEQDNG 405
                 G  L+E GD+VEQDNG
Sbjct: 463 GSVVRPGQLLEETGDDVEQDNG 484

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (87%)

Query: 453 SILQQNRDKLAKATNPLLKSRFVDSIAKLEKEVDIKRKQL 492
           S L+ NR+K ++ TNPLLK+RF++SI KLEKEV++KRKQL
Sbjct: 554 STLELNRNKASRTTNPLLKTRFLESIKKLEKEVELKRKQL 593

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  342 bits (877), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/447 (44%), Positives = 265/447 (59%), Gaps = 29/447 (6%)

Query: 73  VKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILRV 132
           VKLKL  KK+   +        + PR+R+KP RIPGEGYDSEASD+EDDPL+E GIILRV
Sbjct: 58  VKLKLGSKKEEKQS--------RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRV 109

Query: 133 LPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDRK 192
           LPD+Q +F+KNSIESGDY+ ISIKWKGERHA++ +N   YGA+LV+LPT+IEVNKSVDRK
Sbjct: 110 LPDVQVDFIKNSIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRK 169

Query: 193 NMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQG 252
           N+ K FDV+QML+CV  I+ E+++F L+ P+TEDL+ KH+E Y  EI D +  + +    
Sbjct: 170 NLFKTFDVTQMLVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANH 229

Query: 253 GSL-TDAESKHMDAILEKGYDYKHGITAPLYNVXXXXXXXXMTGSEIDYVDRTVEFLLKQ 311
            +L ++ E+K+++ +  K Y YKHG+T PLYNV        M   E +Y ++ V+ LLK 
Sbjct: 230 VNLHSETEAKNLEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKA 289

Query: 312 DGEAEEFTYELVDEDAVLQKSASTIDLAHFAQKAAASGVAQPAHSTDSVLFGVXXXXXXX 371
           D +AE+  ++L+    V +K + +         AA S V     +   VL          
Sbjct: 290 DAQAEDVKFDLIAPSDVPEKGSVS---------AAPSHVDLSVANKPEVLNEDVTLQDDD 340

Query: 372 XXXXXXQALQ-------VPSEADAA-GAPLDEAGDEVEQDNGXXXXXXXXXXXXXXXXXX 423
                 +A Q           +DA  G   +E GDEVEQDNG                  
Sbjct: 341 EDLDLEEAFQSDEDESESTKRSDALFGDQDEEGGDEVEQDNGEDEDDDDDDEDDDEEEEE 400

Query: 424 XXX-XXXXXXXXXXXLQHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAKLE 482
                           QH ELL DEL EL S L+  +DKL KATNPLLKSRFVDSI KLE
Sbjct: 401 EEVGSVAKSGDDNEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSIKKLE 460

Query: 483 KEVDIKRKQLLANEEILE--TSPATSS 507
           KEV++K+KQL  +E  L   T P +S+
Sbjct: 461 KEVELKKKQLKESENQLSGGTGPVSST 487

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/266 (57%), Positives = 197/266 (74%), Gaps = 1/266 (0%)

Query: 89  PASALTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILRVLPDLQAEFVKNSIESG 148
           P   + KAP++R+KP RIPGE YDSEASDIEDDPL+E G+ILR+LPD+Q EFVKNS+ESG
Sbjct: 77  PVKKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESG 136

Query: 149 DYSNISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDRKNMLKAFDVSQMLLCVA 208
           DYS ISIKWK ERHAVV+IN   YGA+LV+LPTVIEVNKSVDRKN+LK FDVSQMLLC+ 
Sbjct: 137 DYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIR 196

Query: 209 LISREEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQGGSLTDAESKHMDAILE 268
            I  EE+V+ L+ PDTEDLV KHFE  E EI + ++  ++G+ G  L+D E+KH+  I  
Sbjct: 197 PIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIAL 256

Query: 269 KGYDYKHGITAPLYNVXXXXXXXXMTGSEIDYVDRTVEFLLKQDGEAEEFTYELVDEDAV 328
           KGYDYKHGI+ PLYNV        M  +EIDYV++ V+ LLKQD +AEE +Y+LVD+  +
Sbjct: 257 KGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSEL 316

Query: 329 LQKSASTIDLAHFAQKAAASGVAQPA 354
             +        +F ++     +++PA
Sbjct: 317 QARQERVSSWENFKEEPGEP-LSRPA 341

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (77%)

Query: 439 QHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAKLEKEVDIKRKQLLANEE 497
           QH ELL DEL ELE+ L   + KL+KATNPLLKSRF+DSI KLEKE ++KRKQL   E+
Sbjct: 440 QHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIKKLEKEAELKRKQLQQTED 498

>Scas_594.6
          Length = 655

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 199/265 (75%), Gaps = 2/265 (0%)

Query: 71  APVKLKLNLKKDTPPTSVPASALTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIIL 130
            P+KLKL+ K    P  +    + KAPR+R+KP RIPGEGYDSEASDIEDDPL+E GIIL
Sbjct: 91  GPLKLKLHRKPSASP--IVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIIL 148

Query: 131 RVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVD 190
           RVLPD+Q EFVKNSIESGDYS +++KW G RHAVV+ING+ YGA+LV+LPTVIEVNKSVD
Sbjct: 149 RVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVNKSVD 208

Query: 191 RKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGF 250
           RKN+LK FDVSQML+C+  I +E++VF L+ P++EDLV KH+ + E+EI   +K++++  
Sbjct: 209 RKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVLMKEQ 268

Query: 251 QGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVXXXXXXXXMTGSEIDYVDRTVEFLLK 310
               L++ E +++D I  KGYDYKHG++ PLYNV        M  SE +Y +  VE LL+
Sbjct: 269 NTDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVETLLR 328

Query: 311 QDGEAEEFTYELVDEDAVLQKSAST 335
           QD +AE  TYELVDE  +L +S ST
Sbjct: 329 QDEKAENVTYELVDESEMLGRSNST 353

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 54/76 (71%), Gaps = 3/76 (3%)

Query: 439 QHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAKLEKEVDIKRKQLLANEEI 498
           QH ELL DEL ELE+ L   R+KL K TNPLL+SRF+D+I KLEKEV++KR+Q    E+ 
Sbjct: 489 QHVELLADELSELETTLTHTRNKLQKVTNPLLRSRFIDNIKKLEKEVELKRRQFKIREDQ 548

Query: 499 L-ETSPATSS--HRTP 511
           L   +P  S+  H++P
Sbjct: 549 LNNVNPHDSNDLHKSP 564

>YDR356W (SPC110) [1182] chr4 (1186096..1188930) Spindle pole body
           component with coiled-coil structure, determines the
           spacing between the ends of microtubules and the central
           plaque [2835 bp, 944 aa]
          Length = 944

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 444 LRDELGELESILQQNRDKLAKATNPLLKSRFVDSIAKLEKEVDIKRKQLLANE 496
           L+DEL ELE+   +N  + +   N L      + IA+LE+E+  K  QL+A E
Sbjct: 330 LKDELNELETKFSENGSQSSAKENEL--KMLKNKIAELEEEISTKNSQLIAKE 380

>AEL223C [2283] [Homologous to ScYDR258C (HSP78) - SH]
           (209852..212263) [2412 bp, 803 aa]
          Length = 803

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 232 FENYEKEICDARKIMIQGFQGGSLTDAESKHMD 264
           F+ +EK   D  K+++Q    G LTD++  H+D
Sbjct: 598 FDEFEKAHPDVCKVLLQVLDDGKLTDSQGHHVD 630

>Sklu_2392.1 YHR137W, Contig c2392 2001-3593
          Length = 530

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 22/93 (23%)

Query: 118 IEDDPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKW-----KGERHAVVSINGHQY 172
           +EDDP  +E           AEF+K+ I+ G   NI   W     K +R ++      QY
Sbjct: 89  LEDDPEFDE-----------AEFIKSKIDDGSMVNI---WRYDPCKPDRLSIA--RAFQY 132

Query: 173 GAVLVNLPTVIEVNKSVDRKNMLKAFDVSQMLL 205
                 LP+V+E +K + ++    A+D   +LL
Sbjct: 133 SETR-GLPSVVEFSKKIVKRFNPPAYDNWDVLL 164

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,077,794
Number of extensions: 570256
Number of successful extensions: 1571
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1587
Number of HSP's successfully gapped: 17
Length of query: 565
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 458
Effective length of database: 12,891,983
Effective search space: 5904528214
Effective search space used: 5904528214
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)