Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR560W22922512241e-173
Sklu_2401.22242257561e-102
Kwal_26.91542322216411e-84
YOR289W2512276361e-83
KLLA0D02464g2272146104e-80
CAGL0M04763g2342265829e-76
Scas_692.462642315511e-70
Sklu_2005.264451700.55
KLLA0B14278g101994671.2
Kwal_47.17099605114671.4
CAGL0M01430g75177661.9
Scas_605.1933747607.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR560W
         (225 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR560W [3752] [Homologous to ScYOR289W - SH] complement(1436468...   476   e-173
Sklu_2401.2 YOR289W, Contig c2401 1376-2050                           295   e-102
Kwal_26.9154                                                          251   1e-84
YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DU...   249   1e-83
KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774....   239   4e-80
CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces c...   228   9e-76
Scas_692.46                                                           216   1e-70
Sklu_2005.2 YBR094W, Contig c2005 1296-3230                            32   0.55 
KLLA0B14278g complement(1252596..1255655) highly similar to sp|P...    30   1.2  
Kwal_47.17099                                                          30   1.4  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    30   1.9  
Scas_605.19                                                            28   7.5  

>AFR560W [3752] [Homologous to ScYOR289W - SH]
           complement(1436468..1437157) [690 bp, 229 aa]
          Length = 229

 Score =  476 bits (1224), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 1   MPQSQGIERSPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFIT 60
           MPQSQGIERSPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFIT
Sbjct: 1   MPQSQGIERSPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFIT 60

Query: 61  WKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVL 120
           WKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVL
Sbjct: 61  WKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVL 120

Query: 121 SHFKTVFEEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFENL 180
           SHFKTVFEEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFENL
Sbjct: 121 SHFKTVFEEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFENL 180

Query: 181 IEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLKV 225
           IEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLKV
Sbjct: 181 IEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLKV 225

>Sklu_2401.2 YOR289W, Contig c2401 1376-2050
          Length = 224

 Score =  295 bits (756), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 175/225 (77%), Gaps = 3/225 (1%)

Query: 1   MPQSQGIERSPFSFYAFYQLYAYFHKD-APTVTFGAVKNKLYHHYPMAAGRENEHSSVFI 59
           MP S  ++ SPF+ YAFYQLYA+F+++ A  +TF  + + L+  YPM   +  E +S+FI
Sbjct: 1   MPDS--LKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFI 58

Query: 60  TWKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNV 119
           TWKK D  G+Y LRGCIGTFAKLPLL+GIEKYSL++ALQD+RFPPI V EL KLK SCN+
Sbjct: 59  TWKKKDSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNI 118

Query: 120 LSHFKTVFEEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFEN 179
           L  FKT+F +  G+I+DW VG HG+ L F+HP T + CSATFLPEVM EQGW + +TF+N
Sbjct: 119 LHDFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQN 178

Query: 180 LIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLK 224
           LIEKAGCW+H+D +M+NY+ YF+EVI Y+GDKSEI Y++F   L+
Sbjct: 179 LIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLE 223

>Kwal_26.9154
          Length = 232

 Score =  251 bits (641), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 163/221 (73%), Gaps = 5/221 (2%)

Query: 7   IERSPFSFYAFYQLYAYFH-KDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKKHD 65
           I  SPF+FYAFYQLYA+ H +D   + F  V+ +L+    + +   +E +S+FITWKK  
Sbjct: 5   IGSSPFAFYAFYQLYAHLHGEDGAELRFEDVQ-ELFPEQRIESQELSEKTSLFITWKKKS 63

Query: 66  -ERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVLSHFK 124
             R  Y+LRGCIGTFAKLPLL+GI++YSLIAAL+D RF PI+  ELA L+CSCN+L +F+
Sbjct: 64  GSRTTYELRGCIGTFAKLPLLKGIQQYSLIAALEDHRFSPIKKSELASLRCSCNILHNFR 123

Query: 125 TVFEEG--AGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFENLIE 182
           T++  G  AG+ YDWK+G HG+ L+FR   + R  SATFLPEV+ EQGW + ETF NLI+
Sbjct: 124 TIYSGGDSAGDAYDWKIGVHGIELKFRDARSNRLLSATFLPEVIPEQGWDKRETFRNLIQ 183

Query: 183 KAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQL 223
           KAGCW++ D ++DN+ +YF+EVI Y G KSEI+Y +F + L
Sbjct: 184 KAGCWENADAILDNWAQYFVEVIRYEGSKSEISYKEFARLL 224

>YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DUF51
           family of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5986p [756 bp, 251 aa]
          Length = 251

 Score =  249 bits (636), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 122/227 (53%), Positives = 163/227 (71%), Gaps = 15/227 (6%)

Query: 10  SPFSFYAFYQLYAYFHK-DAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKKHDER- 67
           SPF+FYAFYQLY++ +   + +++   ++ +LY  + +     NE +S+FITWKK   + 
Sbjct: 24  SPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDY---NEKTSLFITWKKKSNKH 80

Query: 68  -------GEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVL 120
                    Y LRGCIGTFAK+P+  GIEKYSLIAAL+D RF PI+  EL  LKCSCN+L
Sbjct: 81  HTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNIL 140

Query: 121 SHFKTVFEEGA---GNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETF 177
            +FKT+F  G    G+I+DW++G+HG+ L F+HP TG TCSATFLP+VM EQ W++ +TF
Sbjct: 141 GNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDTF 200

Query: 178 ENLIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLK 224
            NLIEKAG W ++ E+MDN++ YFIEVI Y G KS ITY++F KQLK
Sbjct: 201 ANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQLK 247

>KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774.1
           Kluyveromyces lactis hypothetical protein, start by
           similarity
          Length = 227

 Score =  239 bits (610), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 115/214 (53%), Positives = 160/214 (74%), Gaps = 8/214 (3%)

Query: 10  SPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKKHDERGE 69
           SP++FYAFYQLY+ F++  P +T   V + LY    +    E   S +F+TWKK  ++GE
Sbjct: 7   SPYAFYAFYQLYSQFYR-VPKITLETVNDFLYQGKGLKP--EFARSPLFVTWKKL-KKGE 62

Query: 70  YQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVLSHFKTVFE- 128
           YQLRGCIGTF++  +  G+++Y+LI+ALQDSRF PIE  EL++L+C CN+LS FKT++  
Sbjct: 63  YQLRGCIGTFSEGKIEEGLKRYALISALQDSRFTPIEREELSQLRCGCNLLSQFKTIYSS 122

Query: 129 EGAGN---IYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFENLIEKAG 185
           EG GN   I++W++G+HG+ ++FRHP T    SATFLPEV+ EQGW Q ETFENLIEKAG
Sbjct: 123 EGTGNSGDIWNWEIGKHGIEIKFRHPKTNSRMSATFLPEVIPEQGWDQRETFENLIEKAG 182

Query: 186 CWQHVDELMDNYDRYFIEVITYRGDKSEITYDDF 219
           CW +++E+M ++++YF EVI Y G KSEI +D+F
Sbjct: 183 CWNYLEEVMKHWEKYFDEVIRYEGTKSEIAWDEF 216

>CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces
           cerevisiae YOR289w, hypothetical start
          Length = 234

 Score =  228 bits (582), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 150/226 (66%), Gaps = 15/226 (6%)

Query: 6   GIERSPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKK-- 63
           G     ++FYAF QLY +        +   V   LY    +      E +S+FITWK+  
Sbjct: 3   GKNNELYAFYAFLQLYKHMGHVQRDYSLRQVAEALYDTTLII----KEDTSLFITWKRLD 58

Query: 64  -------HDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCS 116
                   D+   Y LRGCIGTFAKLP+  GI++YSLIAAL+DSRF PI   EL  LKCS
Sbjct: 59  SQKTSIDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDSRFTPISERELKTLKCS 118

Query: 117 CNVLSHFKTVFEEGA--GNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQL 174
           CN+L HF+ ++  G   G+I +W++G++G+ L F+HP +G+TCSATFLP+VMVEQGW + 
Sbjct: 119 CNILRHFEKIYSSGDDHGDIDNWEIGKNGIELLFKHPKSGKTCSATFLPDVMVEQGWDKK 178

Query: 175 ETFENLIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFV 220
           ETF NLI+KAGCW    +++++Y++YF+EVI Y G KSEITYD F+
Sbjct: 179 ETFLNLIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEITYDAFI 224

>Scas_692.46
          Length = 264

 Score =  216 bits (551), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 110/231 (47%), Positives = 155/231 (67%), Gaps = 19/231 (8%)

Query: 5   QGIERSPFSFYAFYQLYAYFHKDAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKKH 64
           + +  SP++FYAFY+LY Y    A   T   V   LY  + +        +S+FITWKK 
Sbjct: 36  ESLASSPYAFYAFYELYKYLGLTAKRHTLNQVGEILYPDFKLNPKL---ITSLFITWKKQ 92

Query: 65  --------DERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCS 116
                   D+ G Y LRGCIGTFAK+P+ +GIE++S+IAA +D+RFPP+   E++KLKC 
Sbjct: 93  TKKYLQFADDDG-YILRGCIGTFAKMPIDKGIERFSIIAATEDNRFPPVGEEEISKLKCC 151

Query: 117 CNVLSHFKTVF----EEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWS 172
           CN+L +F+T+F    ++  G+I++W++G HG+ L+F++       S+TFLPEVM+EQ W 
Sbjct: 152 CNILQNFETIFSKNGDDKEGDIFNWELGVHGIELKFKYKGIH---SSTFLPEVMIEQDWD 208

Query: 173 QLETFENLIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQL 223
           + +TF NLIEKAGC +HV E+MDNY+ YFIEVI Y G KS I+Y  F K+L
Sbjct: 209 KEDTFRNLIEKAGCERHVTEIMDNYEEYFIEVIRYEGRKSAISYKTFKKEL 259

>Sklu_2005.2 YBR094W, Contig c2005 1296-3230
          Length = 644

 Score = 31.6 bits (70), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 159 ATFLPEVMVEQGWSQLETFENLIEKAGCWQHVD-ELMDNYDRYFIEVITYR 208
           A +LP+V +      L TF+  I + G ++H+D + +   DRYF     YR
Sbjct: 267 AKYLPQVGILNSLPDLSTFQGKIFQFGDYEHMDMDQLSRNDRYFTNSYIYR 317

>KLLA0B14278g complement(1252596..1255655) highly similar to
           sp|P22515 Saccharomyces cerevisiae YKL210w UBA1 E1-like
           (ubiquitin-activating) enzyme, start by similarity
          Length = 1019

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 9/94 (9%)

Query: 45  PMAAGRENEHSSVFI-TWKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFP 103
           P+A+ +   +   F   W + D +G+  LR  I  F K   L        ++ L  S FP
Sbjct: 906 PIASQKGKYNDKTFDKIWDRFDIQGDITLRELIDHFNKEEGLEITMVSYDVSLLYASFFP 965

Query: 104 P--------IEVGELAKLKCSCNVLSHFKTVFEE 129
           P        + + E+ KL     +LSH KT+  E
Sbjct: 966 PKKLKDRMDLPITEVVKLVTKKEILSHVKTMILE 999

>Kwal_47.17099
          Length = 605

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 23/114 (20%)

Query: 20  LYAYFHKDAPTVTFGA---VKNKLYHHYPMAAGRENEHSSVFITWKKHDERGEYQLRGCI 76
           L ++F   A     GA    K K Y   P+ +    +  S+ +T  + DE  +    G +
Sbjct: 191 LLSFFAAGAQEQDKGAGINYKKKRYMECPLCSTIIRKEKSIPVTLSETDEVLKLPQVGQV 250

Query: 77  GTFA----------KLPLLRGIEKYSLIAALQDSRFPPIEVGELAK----LKCS 116
            TF            LP++  I+  SL        FPP+E+ ELA     +KCS
Sbjct: 251 ETFQLMCKPHGSMLPLPVMLDIDPMSL------HHFPPVELSELAPYSRIMKCS 298

>CAGL0M01430g 164428..166683 highly similar to tr|Q06679
           Saccharomyces cerevisiae YDR324c, hypothetical start
          Length = 751

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 19/77 (24%)

Query: 23  YFHKDAPTVTFGAVKNKLYHHYPMAAGRE--------------NEHSSVFITW-KKHDER 67
           Y H+   TV     +NK+Y     +  RE              NE +SVF  W K++ E 
Sbjct: 540 YIHEQRKTVIVVTAENKIYELSLASIFREDTEDKEGDEQADVTNEENSVFTAWSKRNTEN 599

Query: 68  GEYQLRG----CIGTFA 80
              QL+     C+G FA
Sbjct: 600 IPKQLKDMRQKCLGVFA 616

>Scas_605.19
          Length = 337

 Score = 27.7 bits (60), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 163 PEVMVEQGWS--QLETFENLIEKAGCWQHVDELMDNYDRYFIEVITY 207
           P ++ EQGW   Q E   NLI+ AG ++ + +L    D Y +E   Y
Sbjct: 177 PFLLEEQGWGEFQFEIVCNLIDNAGNFKIIHDLSFEDDAYIVEYSAY 223

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,756,430
Number of extensions: 322889
Number of successful extensions: 579
Number of sequences better than 10.0: 12
Number of HSP's gapped: 563
Number of HSP's successfully gapped: 12
Length of query: 225
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 127
Effective length of database: 13,203,545
Effective search space: 1676850215
Effective search space used: 1676850215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)