Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR251C86885242900.0
Sklu_2433.1188485125840.0
KLLA0A01023g86183623200.0
Scas_712.1888283821660.0
Kwal_47.1921487684421570.0
YGL233W (SEC15)91087321360.0
CAGL0H07909g88284521140.0
KLLA0B02827g94284722.0
Kwal_0.7077247694.2
CAGL0L00627g847148685.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR251C
         (852 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...  1657   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        999   0.0  
KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...   898   0.0  
Scas_712.18                                                           838   0.0  
Kwal_47.19214                                                         835   0.0  
YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...   827   0.0  
CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...   818   0.0  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    32   2.0  
Kwal_0.70                                                              31   4.2  
CAGL0L00627g 75801..78344 similar to tr|Q08886 Saccharomyces cer...    31   5.8  

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score = 1657 bits (4290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/852 (95%), Positives = 816/852 (95%)

Query: 1   MSLELEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLMCLSDQTFEKWVPYLRQ 60
           MSLELEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLMCLSDQTFEKWVPYLRQ
Sbjct: 1   MSLELEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLMCLSDQTFEKWVPYLRQ 60

Query: 61  AVESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQ 120
           AVESDRLDG           NFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQ
Sbjct: 61  AVESDRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQ 120

Query: 121 VADLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQELIRDGN 180
           VADLQAHLSASTNEVVSKKRALTSNRRT              FQMLELTNKCQELIRDGN
Sbjct: 121 VADLQAHLSASTNEVVSKKRALTSNRRTSIKISESIILIEKIFQMLELTNKCQELIRDGN 180

Query: 181 FYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKT 240
           FYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKT
Sbjct: 181 FYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKT 240

Query: 241 LSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLD 300
           LSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLD
Sbjct: 241 LSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLD 300

Query: 301 EFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQVDSFYQQL 360
           EFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQVDSFYQQL
Sbjct: 301 EFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQVDSFYQQL 360

Query: 361 SLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRFIKEK 420
           SLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRFIKEK
Sbjct: 361 SLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRFIKEK 420

Query: 421 LTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLND 480
           LTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLND
Sbjct: 421 LTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLND 480

Query: 481 DDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKSY 540
           DDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKSY
Sbjct: 481 DDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKSY 540

Query: 541 ANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDYF 600
           ANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDYF
Sbjct: 541 ANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDYF 600

Query: 601 IVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVEL 660
           IVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVEL
Sbjct: 601 IVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVEL 660

Query: 661 DWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHE 720
           DWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHE
Sbjct: 661 DWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHE 720

Query: 721 SPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFNVKSPNMI 780
           SPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFNVKSPNMI
Sbjct: 721 SPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFNVKSPNMI 780

Query: 781 ESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSRPXXX 840
           ESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSRP   
Sbjct: 781 ESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSRPTTA 840

Query: 841 XXXXXXXXVSDY 852
                   VSDY
Sbjct: 841 TTDGDNTTVSDY 852

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/851 (58%), Positives = 650/851 (76%), Gaps = 21/851 (2%)

Query: 5   LEQEPHTQLSQELQKVLLTAEFAA----------TRDDDYTPGETGDGLMCLSDQTFEKW 54
           ++QEP + +SQELQKVLL+++F+            +  + +     D ++ L +Q+F++W
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNNNKQSNTSASLLQDDIIELDEQSFDRW 60

Query: 55  VPYLRQAVESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLAE 114
           VP LR ++E   L             NFQ+ ET+ILQDSQ++DNL+ SI+E + IQ L  
Sbjct: 61  VPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQKLIN 120

Query: 115 SYLQGQVADLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQE 174
             LQ +V+DLQ  LS STN+V+ KK+ L +NR+T               Q+LEL+N+CQ+
Sbjct: 121 GSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSNRCQD 180

Query: 175 LIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLS 234
           LI++G+F+KALQ+LD LE+IY+ DFKNY F+FL  IYNSIP LK+IIKDESINLIKKS +
Sbjct: 181 LIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIKKSFT 240

Query: 235 SNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLE 294
           SNLEKTL  VG  YF+VY + LL  WL +K +MKL N+KFNS VE++LRD   L  LK E
Sbjct: 241 SNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLELLKAE 300

Query: 295 DYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQV- 353
           ++Y+LDEF+DSI+IF++LKE +YLC+EF KEYDFRK KLVYPL+ K+TTT + S N Q  
Sbjct: 301 NFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTT-SSSLNGQNQ 359

Query: 354 ----DSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKV 409
               D F + L++ FLKEYLLKILGFL+YDK L+KSTDY+ ++N+Y TT EFW+  M K+
Sbjct: 360 SHLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFNSYNTTNEFWDILMKKL 419

Query: 410 SPHLSRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHV 469
           +PHL +F+   LTTE++L++FK+FLGI IAILEN+KLN E++Y+I + VFEKYC LL+H 
Sbjct: 420 APHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYRIHITVFEKYCNLLVHK 479

Query: 470 FDKEFTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPDSVPIVT--QDDANG-FSVTLPFS 526
           F +EF+ LLNDDDFMPL  +DRN YEKV+K+CW+K +    +   QD ANG F  TLPFS
Sbjct: 480 FSEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKEQQDPANGDFLATLPFS 539

Query: 527 PLYPMTCALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTS 586
           PLYPM C L KK+Y  ++ FLN F+QH+L +LN +LV+T+D IF KVVNNKIRSKLDTTS
Sbjct: 540 PLYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSIFQKVVNNKIRSKLDTTS 599

Query: 587 REEIAQILINLDYFIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIEL 646
           REEIAQ+LINLDYF++AA+EFS I+T+ENI QNPD+EI+L+S +QL +++KYAETKLIEL
Sbjct: 600 REEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASAEQLTESRKYAETKLIEL 659

Query: 647 IDSKVTDLMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREF 706
           IDSKV+DLMEFVELDW    ++ EP +SIRDIAQFLEMMFTSTL NLPYS+K+LLIFREF
Sbjct: 660 IDSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTSTLVNLPYSVKTLLIFREF 719

Query: 707 DQLTRKFLELLVHESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTT 766
           D LTR+FLE+L++ +PS IT QSV NFE DMKFLE ++S IFP+E+ E   E SPS P +
Sbjct: 720 DSLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFPSETKELPFESSPS-PDS 778

Query: 767 PVADSFNVKSPNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEV 826
           P+  S   ++ N+IE+NVRSL STFTDL QHI LMK++N +EYKD SIRMRKYPRI+PEV
Sbjct: 779 PLQ-SDQARASNLIENNVRSLQSTFTDLKQHIQLMKASNLEEYKDPSIRMRKYPRIRPEV 837

Query: 827 AHLLMNKLSRP 837
           A LL++K++ P
Sbjct: 838 AQLLVSKVAIP 848

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/836 (53%), Positives = 610/836 (72%), Gaps = 8/836 (0%)

Query: 5   LEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLMCLSDQTFEKWVPYLRQAVES 64
           ++Q+P   +SQ+LQ+ LLTAEF + +       +  D L  L  Q F++WVP LRQ ++ 
Sbjct: 1   MDQDPQLAVSQDLQRALLTAEFVS-KSGSSNQDQGEDELFELDPQIFDRWVPLLRQTIDE 59

Query: 65  DRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQVADL 124
            +L+            +F+N ETQILQDSQ+++NL  SI+E  ++Q + +  LQ  + +L
Sbjct: 60  GQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQNDIKNL 119

Query: 125 QAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQELIRDGNFYKA 184
           Q+ +  ST  +VS+K+ L  N +T               Q+LEL N+C+ELI + +F+KA
Sbjct: 120 QSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILELFNRCRELIEEKDFFKA 179

Query: 185 LQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKTLSQV 244
           LQ ++  E IY+ DFK Y FEFL  IY SIP LK+ IKDESINLIKKSL+ NLEKT S +
Sbjct: 180 LQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLEKTFSVI 239

Query: 245 GQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLDEFYD 304
           G+ Y+ VY  Q+L  WL  K++MKL NYKFNSPVE+SLRD S L  L+L+++  L EF+D
Sbjct: 240 GEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQLHEFHD 299

Query: 305 SIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQVDSFYQQLSLPF 364
           SI+IF+SL E ++  DEF KEY+FRK KL++PL  K  +T++HS N ++D+F ++L L F
Sbjct: 300 SILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHS-NGKIDAFAEKLDLSF 358

Query: 365 LKEYLLKILGFLLYDKFLHKSTDYIFAYNTY-TTTEEFWEQFMTKVSPHLSRFIKEKLTT 423
            KEY+LKILGFL+YDK LHKSTDY+ + N    +T+ FW   M K+ P+L   +KEKLTT
Sbjct: 359 FKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTT 418

Query: 424 EDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDF 483
           E  L EFK+FLG+LIAILEN+KLN E +YK+QV+ F +YC LL+ +F KEFTNLL DDDF
Sbjct: 419 EQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFTNLLQDDDF 478

Query: 484 MPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKSYANM 543
           MPL I+D+  YEK++K+CW+  D     +    + FS T PFSPLYPMTC L+KK+Y+++
Sbjct: 479 MPLAITDKALYEKILKICWL-ADQGSDTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSL 537

Query: 544 LLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDYFIVA 603
             F++ F++HD+S+LN+++++ +D+IF +VVN+ I+SKLDTTSREEIAQIL+NLDYF++A
Sbjct: 538 HSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIA 597

Query: 604 AKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVELDWT 663
           AKEFS I+T+EN+T NPD+EI+LSS K+L +T+K AETKLI LIDSKV DLMEF+E DW 
Sbjct: 598 AKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVIDLMEFIEFDWN 657

Query: 664 TEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPS 723
           + EVR EP ++I DIAQFLEMMFTSTLA +PY+IK LLIFREFD +TR+FLE L++E+P 
Sbjct: 658 STEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPD 717

Query: 724 YITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTP--VADSFNVKSPNMIE 781
            I+ QSV NFETDM +LE  I+ IFPN+ +  +V  SPS P TP  V  +   +S   +E
Sbjct: 718 RISPQSVQNFETDMLYLEKTITKIFPNDVS--SVPTSPSIPATPTDVPSTAGNRSSTQVE 775

Query: 782 SNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSRP 837
           +N++SL STFTDL QHI LMK N++DEYKD+ IR++KY R+KPEVA  L++KL  P
Sbjct: 776 NNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVAQSLLSKLQPP 831

>Scas_712.18
          Length = 882

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/838 (50%), Positives = 588/838 (70%), Gaps = 19/838 (2%)

Query: 13  LSQELQKVLLT-----AEFAATRDDDYTPGETGDGLMC-----LSDQTFEKWVPYLRQAV 62
           LSQ+ QK+LL+     AE   + D +    E  D  M      L  Q+F+KWVP+LR AV
Sbjct: 7   LSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVPFLRSAV 66

Query: 63  ESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQVA 122
           E ++L             NFQ  E Q+LQDSQ++D L  SI+E   IQN+ ++ L G + 
Sbjct: 67  EKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTSLSGGIL 126

Query: 123 DLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQELIRDGNFY 182
           +LQ  L+ +TNE++ KK+   +N++T               ++LEL++KCQELI +GNF+
Sbjct: 127 NLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELITEGNFF 186

Query: 183 KALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKTLS 242
           KALQNLD LE+IY+ +F+NY F+FL  IY+SIP LK++ KDE +NLI+ SL+SNL K L+
Sbjct: 187 KALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIRNSLNSNLGKNLT 246

Query: 243 QVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLDEF 302
            VG ++F  Y ++LLP WL +KK+MKL  +KFNSPVE+S+RD + L  L LE +++++EF
Sbjct: 247 DVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKFFHIEEF 306

Query: 303 YDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHS---ANEQVDSFYQQ 359
           YDSIMIF++L + +YL  EF+KEY+FRK KL+YPL WK  +    +    +   D+F +Q
Sbjct: 307 YDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIPPGDISSDAFTKQ 366

Query: 360 LSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRFIKE 419
           ++L FLKEY  KILGFLLYD  L+KSTD++   N Y  T EFW+  M ++ P+L  FI  
Sbjct: 367 MNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQPYLRHFIVT 426

Query: 420 KLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLN 479
            L  +D  +EFK+F+ I +AILEN KL+ + +Y+I + +F++YC + I  FD EF  LLN
Sbjct: 427 GLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYFDTEFEVLLN 486

Query: 480 DDDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKS 539
           DDDFMPL I+D+  ++KV ++CWMK D   +  Q+D +GFS+TLPFSPLYPMTC L+KK+
Sbjct: 487 DDDFMPLTINDKTLFQKVSQICWMKEDE-HLEPQEDMSGFSITLPFSPLYPMTCTLLKKA 545

Query: 540 YANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDY 599
           Y+ +  F+  F++HDL  LN +LV  +D IFI +VN KIR+KL +TSREEIAQILINLDY
Sbjct: 546 YSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIAQILINLDY 605

Query: 600 FIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVE 659
           FIVA K FS IMT+ NI QNPDIEI+L STK L D++KYAE KLI+LIDSKV D++E V+
Sbjct: 606 FIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKVADILETVD 665

Query: 660 LDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVH 719
           LDW ++E+  +P +SI D+AQFLEMMF +TL NLPYSI+ LLIFREFD LTR+FL++L++
Sbjct: 666 LDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTRRFLDILLN 725

Query: 720 ESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPS--TPTTPVADSF-NVKS 776
           ++P +IT +SV NFE ++K+LE +I  IFP+   E+    S    TP +PV +   N  S
Sbjct: 726 DTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPVFNGTNNGHS 785

Query: 777 PNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKL 834
           P +IE+NV+SL  TF +L Q+I L+K+ N  EY D  +RMRKY R+KPE A++LM K+
Sbjct: 786 PELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVKPEHANILMRKV 841

>Kwal_47.19214
          Length = 876

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/844 (50%), Positives = 586/844 (69%), Gaps = 13/844 (1%)

Query: 5   LEQEPHTQLSQELQKVLLTAEFA------ATRDDDYTPGETGDGLMCLSDQTFEKWVPYL 58
           +E +  + +S+ELQ+VLL+ + +        +D+        +  + L + TF KW P L
Sbjct: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDEIAEVAGEYEEELDLDEHTFNKWTPLL 60

Query: 59  RQAVESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQ 118
           R A+E + L             NF+N E+QILQDSQ+SDNL+ S+ +   I+ + E  L 
Sbjct: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL 120

Query: 119 GQVADLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQELIRD 178
            ++ DL   L+ +TN+V+++K+   +N++                Q+LEL+ KCQ+LI++
Sbjct: 121 QEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILITKVLQILELSKKCQDLIKE 180

Query: 179 GNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLE 238
            +++KALQ+L  LE+IY+ DFKNY F+FL  IY SIP LK+ IKDESINL+K S +SNLE
Sbjct: 181 RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE 240

Query: 239 KTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYN 298
           K L  VGQT+F  Y+D LL  WL  +  +KLSN+KFNSPVE+SLRD + L  L +   Y 
Sbjct: 241 KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP 300

Query: 299 LDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANE-QVDS-F 356
           LDEFYDSI+IF++LKE +YL  EF KEYDFR  K+V+PL+ K + + T +  + QV + F
Sbjct: 301 LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF 360

Query: 357 YQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRF 416
               +   LK YLL+ILGF++YD+ L+KST+Y+ ++N + T+E FWE F+ + SP L  F
Sbjct: 361 ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHF 420

Query: 417 IKEKLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTN 476
           +  ++ TE+++I+ K+FLG+ IAILEN+ +N E +Y+I V +F+KY   L+ +FD EF+ 
Sbjct: 421 VNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFST 480

Query: 477 LLNDDDFMPLPISDRNFYEKVMKLCWMKPDSV---PIVTQDDANGFSVTLPFSPLYPMTC 533
           LL+DDDFMPL I+D   YEKV+K+CW++ D +     + Q     F  TLPFSPLYPMTC
Sbjct: 481 LLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMTC 540

Query: 534 ALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQI 593
            L KK Y  ++ FL  FFQ+DL  LN V+V+ +DDIF K+VN+KI +K DTTSREEIAQI
Sbjct: 541 TLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQI 600

Query: 594 LINLDYFIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTD 653
           LINLDYFIVA KEFS+I+++ENI  NP +E+ L +TKQL+ ++   ETKLI LIDSKV+D
Sbjct: 601 LINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVSD 660

Query: 654 LMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKF 713
           LMEFVE +W ++E+  EP  SI+DIAQFLEMMF STL NLP S+K+LLIFREFD LTR+F
Sbjct: 661 LMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRF 720

Query: 714 LELLVHESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFN 773
           L++L++++PS IT QS+ NFE +M FLE +I+ +FP+  +      SP  P+   +D  N
Sbjct: 721 LDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFPSSDSTPQTPTSPEIPSGQFSD--N 778

Query: 774 VKSPNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNK 833
            +S N+I + VRSL STF+DL QHI  +KS + +EYKDSSIRMRKYPRIKPEVA +L NK
Sbjct: 779 ARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNK 838

Query: 834 LSRP 837
           +  P
Sbjct: 839 IVPP 842

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/873 (49%), Positives = 593/873 (67%), Gaps = 52/873 (5%)

Query: 5   LEQEPHTQLSQELQKVLLTAEFAATRDDDYT----------------PGETGDGLMCLSD 48
           ++QE    LS++ Q+VLL    A+  +  +T                P    + +  L  
Sbjct: 1   MDQEGQPLLSKDFQQVLLAT--ASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDP 58

Query: 49  QTFEKWVPYLRQAVESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDR 108
            +F+KWVP+LR+A++ ++LD            NFQ  E Q+LQDSQ++D L  SIDE   
Sbjct: 59  LSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIAN 118

Query: 109 IQNLAESYLQGQVADLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLEL 168
           IQ + +  L  +++  Q  LS S NE++ KK+   +N++                ++LEL
Sbjct: 119 IQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILEL 178

Query: 169 TNKCQELIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINL 228
           ++KCQELI +  F+K LQNLD LE++Y+ +FKNY F+FL  IYNSIP L+ + KDE INL
Sbjct: 179 SSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINL 238

Query: 229 IKKSLSSNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFL 288
           I+ SL+ NL K L +VGQ +  +Y ++LLP WL  +  MKL+N+KFNSP+E+S+RD+SFL
Sbjct: 239 IRNSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFL 298

Query: 289 AGLKLEDYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWK-------- 340
           A L L +++ LD+F+DSIMIF++L E + L  EF KEY+ RK KL+YPL WK        
Sbjct: 299 AKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQ 358

Query: 341 ------STTTMTHSANEQV---DSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFA 391
                  T T   S    V   D F Q LSL FL++Y LKILGFLLYD  L+K+T++I  
Sbjct: 359 MDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418

Query: 392 YNTYTTTEEFWEQFMTKVSPHLSRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSESM 451
            N Y +T EFW+  M ++SP+LS FI EKL TE+ +I+ K+FL I +AILEN KLN E +
Sbjct: 419 DNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPL 478

Query: 452 YKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPD---SV 508
           YKI V +FEK+C + +  FD EF  LLNDDDFMPL I+D+  YEKV+K+CWMK     S+
Sbjct: 479 YKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSL 538

Query: 509 PIVTQDDANG--FSVTLPFSPLYPMTCALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTV 566
           P    D  NG  F+VTLPFSPLYPMTC L KK+Y+ +  FL+ F++H+L  LN +LV+T+
Sbjct: 539 P----DPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTM 594

Query: 567 DDIFIKVVNNKIRSKLDTTSREEIAQILINLDYFIVAAKEFSDIMTKENITQNPDIEIKL 626
           DDIF  +VN KIRSKL++TSREEIAQIL+NLDYFI+AAKEFS+ MT+ENI QNPD+EI+L
Sbjct: 595 DDIFNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRL 654

Query: 627 SSTKQLADTKKYAETKLIELIDSKVTDLMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMF 686
           SS K LA+++K AETKLIELIDSK++D++E +E+DW   EVR +P +SI D+AQFLEMMF
Sbjct: 655 SSIKYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMF 714

Query: 687 TSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVANFETDMKFLENVISN 746
            STL NLPYS+++LLIFREFD LTR+F+ LL+H++PS IT +S+ NFE D+ +LE++I  
Sbjct: 715 ASTLQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPR 774

Query: 747 IFPN-----ESTEQNVEISPSTPTTPVADSFNVKSPNMIESNVRSLFSTFTDLNQHILLM 801
           IFP+     +S      ++PSTPT P A+   V +P + E+N++SL +TF +L Q I L+
Sbjct: 775 IFPSTPGTIDSNGYQSPMTPSTPTFPNANG--VDAPTLFENNIKSLEATFMELKQCIELL 832

Query: 802 KSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKL 834
           K+   D Y +  IR+RKY RI+ E A LL++K+
Sbjct: 833 KTQGKD-YNEPEIRLRKYSRIRQEDAALLLSKI 864

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/845 (48%), Positives = 581/845 (68%), Gaps = 14/845 (1%)

Query: 5   LEQEPHTQLSQELQKVLLTAEFAAT-----RDDDYTPGETGDGL------MCLSDQTFEK 53
           ++QE    +S++ Q VLL            +++    GE   G+      + +  +  +K
Sbjct: 1   MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60

Query: 54  WVPYLRQAVESDRLDGXXXXXXXXXXXNFQNFETQILQDSQVSDNLSFSIDENDRIQNLA 113
           W+PYLR+  E+D+L+            NFQ  E Q+LQDSQ++D L  S+DE   IQ++ 
Sbjct: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120

Query: 114 ESYLQGQVADLQAHLSASTNEVVSKKRALTSNRRTXXXXXXXXXXXXXXFQMLELTNKCQ 173
           E  L   + + Q +L++STNE++ +K+   ++++T               ++LEL+NKCQ
Sbjct: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180

Query: 174 ELIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSL 233
           ELI +GNF+KALQNLD LE++Y+ +F++Y F+ L  IY SIP LK++ KDE INLIK SL
Sbjct: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECINLIKNSL 240

Query: 234 SSNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKL 293
           +SNL K L+ VGQT++ +Y D+LL  WL  ++ MKL   KFNSP+E+S+RD+  L  L+L
Sbjct: 241 NSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300

Query: 294 EDYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANEQV 353
           E ++NLD F+DS+MIFE+L ET+YL +EF KEY+F+K K + PL WK++       +   
Sbjct: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360

Query: 354 DSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHL 413
           D F + LS+PFLKEYLL ILGFLLYD  L++ TDYIF  N Y  T EFWE  M ++ P+ 
Sbjct: 361 DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRLKPYF 420

Query: 414 SRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKE 473
             F+   L TE  +IEFK+FLGI + I+EN KLN + +Y + + +FEKYC   + +FDK+
Sbjct: 421 KYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDKD 480

Query: 474 FTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTC 533
           F  +L+DDDFMPL I ++ FYEKV+K+CWMK +   I   DD N FSVTLPFSPLYPMTC
Sbjct: 481 FQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDEN-FSVTLPFSPLYPMTC 539

Query: 534 ALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQI 593
            + +K YA +  F+++F++H L  LN +LV T+D I   VVN +IR+KL+TTSREEIAQ+
Sbjct: 540 TMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQL 599

Query: 594 LINLDYFIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTD 653
           LINLDYF++A+KEFS++MTK+NI +NPD+EI+L+STK  A+++KYAE+KLI+LID+K+ D
Sbjct: 600 LINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESKLIDLIDTKIKD 659

Query: 654 LMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKF 713
           ++E V  DW   + R +P +SI D+AQFLEMMF +TL NLPYS++ LLIFREFD LTR F
Sbjct: 660 ILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHF 719

Query: 714 LELLVHESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTP-VADSF 772
           L++L+H++P YI+ +SV NFE DM +LE +I  IFP     +N  +   TP TP + D  
Sbjct: 720 LDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPTIDDES 779

Query: 773 NVKSPNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMN 832
             +S + I++N++SL STF +L Q I L++S + +EY D  +R RKY RIKP+ A++L+ 
Sbjct: 780 RSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILIG 839

Query: 833 KLSRP 837
           K+ RP
Sbjct: 840 KI-RP 843

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 677 DIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVANFETD 736
           D + FL+ +   T +N+   I+SL  F+ FD+L R F+E L        T ++   +E  
Sbjct: 831 DYSAFLDELVQMTPSNIDLEIRSLKAFQPFDELCR-FIESLAQ---GLATNKNFELYEAY 886

Query: 737 MKFLENVISNIFPNESTEQNVEIS 760
           +  L  V  ++  + +T QN++ +
Sbjct: 887 ITILFRVHGDVIHSNNTNQNIKTA 910

>Kwal_0.70
          Length = 772

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 390 FAYNTYTTTEEFWEQFMTKVSPHLSRFIKEKLTTEDQLIEFKNFLGI 436
           FAY +    EEF+E F   +S H     K+K   +D L+   N   I
Sbjct: 328 FAYRSANKCEEFYEMFANVISAHFRASYKKKGDIDDILLTCSNIYSI 374

>CAGL0L00627g 75801..78344 similar to tr|Q08886 Saccharomyces
           cerevisiae YOR371c GPE1 or sp|P39717 Saccharomyces
           cerevisiae YAL056w GPE2, hypothetical start
          Length = 847

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 12/148 (8%)

Query: 677 DIAQFLEMMFTSTLANLPY-----SIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVA 731
           +++ ++++      +N+PY     SI SLL+  +      K+ E L+ +   Y  ++   
Sbjct: 37  NVSNYVDVSDLKQFSNIPYLSNYNSILSLLLSNQKKSNFSKYNETLLKK---YYLSRRNI 93

Query: 732 NFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFNVKSPNMIESNVRSLFSTF 791
           N++T ++  +N I +I  N S E N+    S   + +A+S +  S N  +  V SL  T 
Sbjct: 94  NYQTSIRN-DNPIKSISNNSSVEHNINEEHSDDGSYIANSSDTGSDNNSKVQVPSL--TH 150

Query: 792 TDLNQHILLMK-SNNFDEYKDSSIRMRK 818
            D + +I+L K     DE K SS+   K
Sbjct: 151 IDFDMNIILEKLEKPLDEEKLSSLIQSK 178

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,341,283
Number of extensions: 1249153
Number of successful extensions: 5147
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5297
Number of HSP's successfully gapped: 53
Length of query: 852
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 742
Effective length of database: 12,788,129
Effective search space: 9488791718
Effective search space used: 9488791718
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)