Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR249W1811789371e-131
Kwal_47.192101811784946e-64
YGL231C1901824843e-62
CAGL0H07953g1831754531e-57
Scas_712.201861794149e-52
KLLA0A01067g2021753899e-48
Sklu_2433.1379741661e-15
AFR333W500104660.89
AER451W35561623.0
YHR039C (MSC7)64471597.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR249W
         (178 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   365   e-131
Kwal_47.19210                                                         194   6e-64
YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   191   3e-62
CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   179   1e-57
Scas_712.20                                                           164   9e-52
KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   154   9e-48
Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement      69   1e-15
AFR333W [3525] [Homologous to ScYKL217W (JEN1) - NSH] complement...    30   0.89 
AER451W [2951] [Homologous to ScYDL244W (THI13) - NSH] complemen...    28   3.0  
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...    27   7.9  

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  365 bits (937), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%)

Query: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60
           MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA
Sbjct: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60

Query: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120
           LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL
Sbjct: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120

Query: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQS 178
           LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQS
Sbjct: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQS 178

>Kwal_47.19210
          Length = 181

 Score =  194 bits (494), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 125/178 (70%)

Query: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60
           MS   P WA+ L +P+Y++ I+VV+SN+LP PPGF     S ++   K    A  E + +
Sbjct: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEAENLAS 60

Query: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120
           L V+KAWQ++FQP+K+IPMN  +SYMSGTSLQII IMTALM ++ P+KSV+ +R TFK +
Sbjct: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120

Query: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQS 178
           + N     QVL+AM ++V FQA+LM IG+ KLN+MGL+PN  SDWL  E P  Y  +S
Sbjct: 121 MGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRS 178

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  191 bits (484), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 7/182 (3%)

Query: 1   MSSEAP-TWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQ------KSQTRSVSKEEGEA 53
           MS + P  WA+ L++ +Y++  ++ +SNTLP PPGF          + Q  + S+    A
Sbjct: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60

Query: 54  NRERINALQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQV 113
            + +I  LQV+KAWQ+A QP+K+IPMN FMSYMSGTSLQIIPIMTALMLL+GP+K++   
Sbjct: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120

Query: 114 RSTFKGLLNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMA 173
           RS FK +L N+A   QV  AM +Y+ FQ VLM IG +KLN+MGL+PN   DWL WE    
Sbjct: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180

Query: 174 YS 175
           Y+
Sbjct: 181 YN 182

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  179 bits (453), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 115/175 (65%), Gaps = 1/175 (0%)

Query: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60
           +S+    W   L+ P+ +K     + NT P P G+     S     +    + N+  I  
Sbjct: 2   VSANTEEWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKPDIAN 60

Query: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120
           LQV+KAW++A QP+K+IPMNFFMSYMSGTSLQIIPIMTALMLL+GPVKS+  +R TFK +
Sbjct: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120

Query: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYS 175
           L N  +  Q+   M LYV FQ VLM IGL+KLN MGL+PNK SDW+AWE    Y+
Sbjct: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYN 175

>Scas_712.20
          Length = 186

 Score =  164 bits (414), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 117/179 (65%), Gaps = 3/179 (1%)

Query: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQ--KSQTRSVSKEEGEANR-ER 57
           MS E   WA  L   +  ++    +  TLP PPG+   +  K+Q  S   +  EA R + 
Sbjct: 1   MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKE 60

Query: 58  INALQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTF 117
           +N L  +KA  +A QP+K+IPMN  MSYMSGTSLQIIPIM ALMLL+GP+K++  +R+ F
Sbjct: 61  LNNLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120

Query: 118 KGLLNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSM 176
           K +L N+    QV +AM LY+ FQ  LM IG++KLNAMGL+PN  SDWL WE P+ Y++
Sbjct: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNI 179

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  154 bits (389), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 112/175 (64%), Gaps = 3/175 (1%)

Query: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60
           MS + P WA+ L   + ++  SV +   LP P G  KK + + +   K      + RI  
Sbjct: 23  MSEDIPQWAKDLKVDKVMRRNSV-NGGKLPDPFGI-KKLEIEGQKPPKVIDHDAQNRIAK 80

Query: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120
           L  ++AWQ++ +P K++PMN  MSYMSG SLQIIPIMTA+ML++ P+KS+L V+S F+ L
Sbjct: 81  LTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHL 140

Query: 121 LNNEAAYG-QVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAY 174
           +N +      V+AAM +YV +Q +LM IGL KLN+MGL P   SDWLAW+ P  Y
Sbjct: 141 INKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEY 195

>Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement
          Length = 79

 Score = 68.6 bits (166), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%)

Query: 1  MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60
          M+ + P WA  L  P++ KS++V SSNTLP PPGF    +  +++ +    ++  + IN 
Sbjct: 1  MNVQPPQWATDLCNPKHAKSLTVASSNTLPSPPGFKLVSEGSSKNKNDNANKSKEKDING 60

Query: 61 LQVKKAWQLAFQPS 74
          LQV+KAW+LA QP+
Sbjct: 61 LQVQKAWELALQPA 74

>AFR333W [3525] [Homologous to ScYKL217W (JEN1) - NSH]
           complement(1041323..1042825) [1503 bp, 500 aa]
          Length = 500

 Score = 30.0 bits (66), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 20/104 (19%)

Query: 2   SSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINAL 61
            + AP W  C      +  +SVV    L Q   F ++Q+       KEE     E+++ L
Sbjct: 194 DTTAPGWRSCFWFLSGVSFVSVVFRAFLGQTEAFKERQR------IKEERRKRNEKVSTL 247

Query: 62  -----QVKKAWQLAFQPSKAIPMNFFMS---YMSGTSLQIIPIM 97
                 +KK W +       + M F M+   + + TS  + P M
Sbjct: 248 SQILQSLKKEWYI------VLYMIFLMTAYNFFAHTSQDLFPTM 285

>AER451W [2951] [Homologous to ScYDL244W (THI13) - NSH]
           complement(1502305..1503372) [1068 bp, 355 aa]
          Length = 355

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 12/61 (19%)

Query: 121 LNNEAAYGQ-----VLAAMCLYVFFQAVLMAIGLQKLNAMGLLP-----NKHSDWLAWET 170
           LNNE +Y Q        + CLY   +      G  K   +G+LP     N  +D+LAWE 
Sbjct: 260 LNNELSYKQYQRCYAYFSSCLYNVHRDWRKVTGYGK--RLGVLPPGYVANYTNDYLAWEE 317

Query: 171 P 171
           P
Sbjct: 318 P 318

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score = 27.3 bits (59), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 15/71 (21%)

Query: 65  KAWQLAFQPSKA-IPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGLLNN 123
           K  Q A QPS+   P NFFM +  G  ++  P+        G + S++     F  LL  
Sbjct: 206 KHGQRALQPSRRPGPTNFFMKWYKGAEIRYEPL--------GVISSIVSWNYPFHNLL-- 255

Query: 124 EAAYGQVLAAM 134
               G ++AA+
Sbjct: 256 ----GPIIAAL 262

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.128    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,230,768
Number of extensions: 177113
Number of successful extensions: 625
Number of sequences better than 10.0: 13
Number of HSP's gapped: 622
Number of HSP's successfully gapped: 13
Length of query: 178
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 83
Effective length of database: 13,307,399
Effective search space: 1104514117
Effective search space used: 1104514117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.9 bits)