Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR248C30429915760.0
Kwal_47.192042502423796e-44
Sklu_2433.142502363711e-42
KLLA0A01089g2332383123e-34
YFR043C2372382582e-26
Scas_699.392612692131e-19
CAGL0C02079g2652461902e-16
YMR310C31793720.40
AER304C325867662.7
KLLA0D02926g36446635.9
CAGL0I09592g39267628.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR248C
         (299 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...   611   0.0  
Kwal_47.19204                                                         150   6e-44
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                        147   1e-42
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...   124   3e-34
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...   103   2e-26
Scas_699.39                                                            87   1e-19
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...    78   2e-16
YMR310C (YMR310C) [4264] chr13 complement(895715..896668) Protei...    32   0.40 
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...    30   2.7  
KLLA0D02926g complement(247616..248710) highly similar to sp|P20...    29   5.9  
CAGL0I09592g 916118..917296 highly similar to sp|P07258 Saccharo...    28   8.2  

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/299 (100%), Positives = 299/299 (100%)

Query: 1   MVAEGLCQCYIRRMSTGGPHGAAPDRSCLARDTEGRSPCKNCQGCTQGAADPIPIRILMA 60
           MVAEGLCQCYIRRMSTGGPHGAAPDRSCLARDTEGRSPCKNCQGCTQGAADPIPIRILMA
Sbjct: 1   MVAEGLCQCYIRRMSTGGPHGAAPDRSCLARDTEGRSPCKNCQGCTQGAADPIPIRILMA 60

Query: 61  DSDVEQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEV 120
           DSDVEQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEV
Sbjct: 61  DSDVEQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEV 120

Query: 121 DLDLYIDSYESLQTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFTDER 180
           DLDLYIDSYESLQTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFTDER
Sbjct: 121 DLDLYIDSYESLQTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFTDER 180

Query: 181 VLVACDLSSAEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERM 240
           VLVACDLSSAEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERM
Sbjct: 181 VLVACDLSSAEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERM 240

Query: 241 LRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE 299
           LRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE
Sbjct: 241 LRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE 299

>Kwal_47.19204
          Length = 250

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 139/242 (57%), Gaps = 14/242 (5%)

Query: 67  APSVSVLP-RNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLY 125
           + S + LP R+KI++        QAEVI DLF I   +  RI  D++W+ KYY V +DLY
Sbjct: 12  SDSSNSLPIRDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLY 71

Query: 126 IDSYESLQTWGAEFCSDECADLRDVVAGIFLVFE---ETEDAETFQQLIEDCHFTDERVL 182
           IDS++SL+ W  +FC+ EC +LRDV+AG+ LV     E  D ETF QL  DC    E   
Sbjct: 72  IDSFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLA-DCMADAESFF 130

Query: 183 VACDLSSAEHPA-----SLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWS 237
           V   L +  +P+     S E  L  + V +V   + G NE GE  G  RVRE++D + W 
Sbjct: 131 VV--LKARSNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDWQ 188

Query: 238 ERMLRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHEL 297
            ++L++   +A    EL+   + +PL+ ++TR+++AR +YL +      + +A  +AHEL
Sbjct: 189 TQLLKLRQPSAT--KELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHEL 246

Query: 298 TE 299
           +E
Sbjct: 247 SE 248

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 131/236 (55%), Gaps = 12/236 (5%)

Query: 73  LPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYESL 132
           +PRNKIL++  A    +  +I  LFN        I++++ W NKYY+ ++D+YID Y+SL
Sbjct: 16  IPRNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSL 75

Query: 133 QTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFT---DERVLVACDLSS 189
             W  EF   E  DLR+V+AG+ L+F    + +TF   ++  + T   DE+  +AC++SS
Sbjct: 76  DEWTREFQQSEYNDLREVLAGVILLFNYRSE-QTFSHFLDIINSTSQNDEKFYIACNVSS 134

Query: 190 ---AEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERMLRMHAS 246
              AE   SL      H + L+ W E G N  G++ G ER+RE++D H W++  L +   
Sbjct: 135 KIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEWTQCELDVKEQ 194

Query: 247 TAAALAELDPLQ---ADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE 299
               +  L  LQ   A+  L+ V+ ++ +AR RY  + +   A+ +A  I+ ELT+
Sbjct: 195 PTIGVGSL--LQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELTK 248

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score =  124 bits (312), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 127/238 (53%), Gaps = 19/238 (7%)

Query: 73  LPRNKILILAPAGKAYQAEV--IRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYE 130
           +  +K+LIL P     Q  +  I  +F  +  E++ I RDV+W  KYYE  LDLYID+Y+
Sbjct: 1   MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYD 60

Query: 131 SLQTWGAEFCSDECADLRDVVAGIFLVFEETED---AETFQQLIED--CHFTDERVLVAC 185
            LQ W  +F SDEC +LRDV++GI  VF++ +     E  + LI++    FT  +  + C
Sbjct: 61  VLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFT-AKFFIGC 119

Query: 186 ----DLSSAEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERML 241
               ++   +    L   L V +  +V W ++    + ++ G ER++E++D+HPW     
Sbjct: 120 YFNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPE 178

Query: 242 RMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE 299
            +  +       + P    I LDS +T+++QA+ERY    D   A+ +  +I  EL++
Sbjct: 179 TLKKNQGQ--INISP----IDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD 230

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score =  103 bits (258), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 121/238 (50%), Gaps = 22/238 (9%)

Query: 74  PRNKILILAPAGKAY-QAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYESL 132
           P+NKIL+L+     + + + ++DLF+  +S    IV+D  W N+YY+V  DLYIDS + +
Sbjct: 6   PQNKILVLSDHPHNFLKTQFLQDLFHC-SSTGISIVKDQTWENRYYKVHFDLYIDSCKEI 64

Query: 133 QTWGAEFCSDECADLRDVVAGIFLV--FEETEDAETFQQLIEDCHFTDERVLVACDLSSA 190
             W  EF + EC  LR+V+AGI L+    +T+  E   Q +   H      +V  +++  
Sbjct: 65  PVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAH--RNTFVVLANVNEE 122

Query: 191 EHPASLERALEV------HDVALVRWRER----GTNELGEQQGRERVRELLDIHPWSERM 240
                ++   E+      + +  V W+        N+ GE+ G +R++E++D H W    
Sbjct: 123 VEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDW---- 178

Query: 241 LRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELT 298
           L      A  + E  P   ++PL+ ++  ++ AR +Y  I +   AD +A  +A EL+
Sbjct: 179 LNCEVQPATKIREEIP--NEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234

>Scas_699.39
          Length = 261

 Score = 86.7 bits (213), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 120/269 (44%), Gaps = 70/269 (26%)

Query: 73  LPRNKILILAPAGK---AYQAEVIRDLFN--IEASESDRIVRDVKWSNKYYEVDLDLYID 127
           +P+NKIL++    +     Q E ++  F+  IE   SD I++ + W NKY+E+ LDLYID
Sbjct: 6   VPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLDLYID 65

Query: 128 SYESLQTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFTDERVLVACDL 187
            +E  + +  E+C DE ++LR V+AGI ++       +T+       HF D +++     
Sbjct: 66  EFEDFEEFVYEYCLDEMSELRSVIAGIIII------DDTY-------HFEDNKLVNKLQT 112

Query: 188 SSAEHPAS-------LERALEVHDVALVRWR---ERGTNE-------------------- 217
            S    +S        E   E  D+A  +WR   E  TN+                    
Sbjct: 113 DSGSETSSSFMVIGNFEGDYEEEDIA--QWRFPSESMTNDEDIIAEYVPLDKHFRMEKNS 170

Query: 218 LGEQQGRERVRELLDIHPWSERMLRMHASTAAALAELDPLQ-------ADIPLDSVVTRI 270
           LG++ G   ++E LD+H W+             + +LD +Q        D+ + +++ ++
Sbjct: 171 LGDKVGVPGIKEKLDLHEWNPN---------CNIQKLDQIQPTHPPSNMDVDISAIINQL 221

Query: 271 KQARERYLEITDVHAADEYAARIAHELTE 299
           + AR  +      H   E A  IA  L E
Sbjct: 222 RDARINF----QTHKDQEEAKSIATALAE 246

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 125/246 (50%), Gaps = 22/246 (8%)

Query: 65  EQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDL 124
           E+     VLP   +++       ++ +++  +F ++  +   IV+ + W  KYY V+ DL
Sbjct: 25  EEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ--DQGNIVKQLSWDTKYYAVEYDL 82

Query: 125 YIDSYESLQTWGAEFCSDECADLRDVVAGIFLV--FEETEDAETFQQLIEDCHFTDERVL 182
           Y+D    +  W  E  SD+  +LRD++  I +V  F+ T+D + +  ++ D    +   +
Sbjct: 83  YVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGNSVSV 142

Query: 183 VACDLSSAEH-PASLERALEV--HDVALVRWR-ERGTNELGEQQGRERVRELLDIHPWSE 238
           ++ + +SA     + +  LE+    +  + +  +R   E  E +G  R++E++D HPW++
Sbjct: 143 ISVNTNSARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTD 202

Query: 239 --RMLRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITD-----VHAADEYAA 291
              +L+   ST+  + + D       L+ ++  +K+A+  Y ++++        A+++A 
Sbjct: 203 CKVVLKNKESTSDKVNKPD-------LEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFAL 255

Query: 292 RIAHEL 297
           ++A ++
Sbjct: 256 QMATDI 261

>YMR310C (YMR310C) [4264] chr13 complement(895715..896668) Protein
           containing an uncharacterized ACR domain, has low
           similarity to uncharacterized S. cerevisiae Ygr283cp
           [954 bp, 317 aa]
          Length = 317

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 6/93 (6%)

Query: 209 RWRERGTNELGEQQ-GRERVRELLDIHPWSERMLRMHASTAAAL-AELDPLQADIPLDSV 266
           R+RE  T ++ +    R+++ ++        + + +  S A AL ++L P+ A + +D++
Sbjct: 129 RYREGLTIKMQKPTLARKKIGKVFK----QTKYINIGKSKALALQSQLVPINARVTIDTI 184

Query: 267 VTRIKQARERYLEITDVHAADEYAARIAHELTE 299
             +I   +E Y + T + +   Y  RIA   T+
Sbjct: 185 TRKIVSPQEAYGDFTGLDSQYGYYTRIASSFTD 217

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
            (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 4/67 (5%)

Query: 186  DLSSAEHPASLERALEVHDVALVRWRERGTNEL---GEQQGRERVRELLDIHPWSERMLR 242
            DLS +E  +  ER     D   VRW      E     +++GR     +  + P  E++ R
Sbjct: 2053 DLSDSEAYSDEERTNNTGD-GFVRWYSDDGVEFEDDTDEEGRGLFTGIQHVFPTEEQLFR 2111

Query: 243  MHASTAA 249
            +HAS AA
Sbjct: 2112 VHASGAA 2118

>KLLA0D02926g complement(247616..248710) highly similar to sp|P20051
           Saccharomyces cerevisiae YLR420w URA4 dihydroorotase
           singleton, start by similarity
          Length = 364

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 239 RMLRMHASTAAALAELDPLQADI--PLDSVVTRIKQARERYLEITD 282
           +++  H +TAAA+  ++ + AD+  PLD +V     A   +L I D
Sbjct: 177 KIILEHCTTAAAIKTIEEINADVKDPLDVMVAATITAHHLFLTIDD 222

>CAGL0I09592g 916118..917296 highly similar to sp|P07258
           Saccharomyces cerevisiae YOR303w CPA1 arginine-specific
           carbamoylphosphate synthase, hypothetical start
          Length = 392

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 32/67 (47%)

Query: 55  IRILMADSDVEQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWS 114
           ++ L+A+ D++Q P   +   +++L LA  GK ++ +      NI A +       +   
Sbjct: 240 LKELLANEDLQQLPIFGICLGHQLLALASGGKTHKLQYGNRAHNIPAMDLTTGQCHITSQ 299

Query: 115 NKYYEVD 121
           N  Y VD
Sbjct: 300 NHGYAVD 306

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,930,426
Number of extensions: 356870
Number of successful extensions: 903
Number of sequences better than 10.0: 15
Number of HSP's gapped: 890
Number of HSP's successfully gapped: 15
Length of query: 299
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 198
Effective length of database: 13,099,691
Effective search space: 2593738818
Effective search space used: 2593738818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)