Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR247W2112079901e-138
Kwal_47.192032352034774e-60
Sklu_2433.152101914702e-59
YFR042W2001924475e-56
Scas_687.172222094052e-49
KLLA0A01111g2091983772e-45
CAGL0C02101g1971893571e-42
Kwal_56.2304224357597.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR247W
         (207 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   385   e-138
Kwal_47.19203                                                         188   4e-60
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     185   2e-59
YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   176   5e-56
Scas_687.17                                                           160   2e-49
KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   149   2e-45
CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   142   1e-42
Kwal_56.23042                                                          27   7.5  

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  385 bits (990), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/207 (91%), Positives = 190/207 (91%)

Query: 1   MADLQGIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGF 60
           MADLQGIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGF
Sbjct: 1   MADLQGIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGF 60

Query: 61  LIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIG 120
           LIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIG
Sbjct: 61  LIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIG 120

Query: 121 YSIFILSIGMNQALHHXXXXXXXXXXXXXXXXXSDTFVLQPALYISQFYLLLLNVQNPSF 180
           YSIFILSIGMNQALHH                 SDTFVLQPALYISQFYLLLLNVQNPSF
Sbjct: 121 YSIFILSIGMNQALHHGGRLFRGRRRRRSWWWRSDTFVLQPALYISQFYLLLLNVQNPSF 180

Query: 181 HSTPKLDIINRTVLVAYVPLALQCFRR 207
           HSTPKLDIINRTVLVAYVPLALQCFRR
Sbjct: 181 HSTPKLDIINRTVLVAYVPLALQCFRR 207

>Kwal_47.19203
          Length = 235

 Score =  188 bits (477), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 134/203 (66%), Gaps = 3/203 (1%)

Query: 6   GIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLL 65
            IP  P    +++ SR YQ++RLS   L+AALVARW  LFPLVG++++PGGIH FL YL+
Sbjct: 30  NIPANPG--TSALKSRLYQYFRLSSSLLFAALVARWAVLFPLVGSKFLPGGIHEFLCYLM 87

Query: 66  GGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFI 125
             +   E++W   F  F + L +RTLLK  + LY+V ++HFYDDYEHA VLKNI YS FI
Sbjct: 88  LYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFI 147

Query: 126 LSIGMNQALHHXXXXXXXXXXXXXXXXXS-DTFVLQPALYISQFYLLLLNVQNPSFHSTP 184
           +++G++Q   H                   DTF+  P LY+S+FYLLLLNVQ P+FHS  
Sbjct: 148 VTLGLSQTYCHWCKLFKSPSKNRNTILWKIDTFLTLPILYLSEFYLLLLNVQTPNFHSYH 207

Query: 185 KLDIINRTVLVAYVPLALQCFRR 207
            L+I+N+ VL+ ++P++L  FR+
Sbjct: 208 WLEIVNKVVLIIFIPISLHAFRK 230

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  185 bits (470), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (65%), Gaps = 1/191 (0%)

Query: 18  MVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWMI 77
           +VSR YQ+YRLS  FL+AAL+ARWL L PLVGT+++PGGIH +L YL+  ++  E+  + 
Sbjct: 15  IVSRLYQYYRLSASFLFAALLARWLVLLPLVGTKFLPGGIHEYLCYLILYASFGELFCLF 74

Query: 78  WFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHH- 136
            F+     L + TLLK  NMLYFVAVMHFYDDYEHAPVLKN  YS FI+ +   Q   H 
Sbjct: 75  GFHGLFGALTSSTLLKNLNMLYFVAVMHFYDDYEHAPVLKNSSYSSFIIGLSFTQMYCHW 134

Query: 137 XXXXXXXXXXXXXXXXXSDTFVLQPALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLVA 196
                             DT  + P  Y+S+FYL LLNVQNP+FHST  LD +N+ VLVA
Sbjct: 135 KKLFKHTHGRKNSIWRKVDTLAMMPLFYLSEFYLFLLNVQNPNFHSTLLLDRLNKFVLVA 194

Query: 197 YVPLALQCFRR 207
           ++PL+L  F++
Sbjct: 195 FIPLSLHMFKK 205

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  176 bits (447), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 132/192 (68%), Gaps = 1/192 (0%)

Query: 17  SMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWM 76
            +  + YQ+Y+L+  FLYAAL+ RWL L PLVG+R++PGGIH FLIYL+  S+++EV+W+
Sbjct: 5   KLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWL 64

Query: 77  IWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHH 136
           + F+ F  GL +RT LK  N +Y V+V+HFYDDYEHA +LKN  YS FI+S+ ++QA  H
Sbjct: 65  LRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQAYCH 124

Query: 137 XXXXXXXXXXXXXXXXXS-DTFVLQPALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLV 195
                              +TFV  P LY+S+F LLLLN+Q  ++HSTP LDIINR VL+
Sbjct: 125 WCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLL 184

Query: 196 AYVPLALQCFRR 207
           AY P+ L  +++
Sbjct: 185 AYFPVLLTAYKK 196

>Scas_687.17
          Length = 222

 Score =  160 bits (405), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 137/209 (65%), Gaps = 3/209 (1%)

Query: 2   ADLQGIPG--KPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHG 59
           A + G P   +P       + + YQ+Y+LS  FL+AAL+ARWL +FPL G R++PGG+H 
Sbjct: 10  AAVTGDPASRRPIEPKTPFIYKLYQYYQLSTSFLFAALLARWLIIFPLAGARFLPGGVHE 69

Query: 60  FLIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNI 119
           FL YL+  ++V E++W+  FY     ++++TLLK  N +YFV V+HFYDDYEHA VLKNI
Sbjct: 70  FLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNI 129

Query: 120 GYSIFILSIGMNQALHH-XXXXXXXXXXXXXXXXXSDTFVLQPALYISQFYLLLLNVQNP 178
            YS+FI+ + +NQA HH                   +  +  P LY+S++YLLLLNVQNP
Sbjct: 130 SYSVFIIGLSLNQAYHHWCKLFKRSGRKKNTLVFKVNNLLGSPLLYLSEYYLLLLNVQNP 189

Query: 179 SFHSTPKLDIINRTVLVAYVPLALQCFRR 207
           +FHSTP LDIINR +L+ Y P+AL  +R 
Sbjct: 190 NFHSTPLLDIINRIILIIYFPIALAVYRN 218

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  149 bits (377), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 4/198 (2%)

Query: 13  HTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLE 72
             P  +V + YQF+ +S  FLY AL+ RWL L PLV  +++PGGIH FL  L+  SAV  
Sbjct: 7   QQPRRLVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRKYLPGGIHRFLCCLMVYSAVGN 66

Query: 73  VLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQ 132
           +LW I        ++ R  LK  N++Y VA++HFYDD+EH+P+LKN  YS FI+ +   Q
Sbjct: 67  ILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQ 126

Query: 133 ALHHXXXXXX----XXXXXXXXXXXSDTFVLQPALYISQFYLLLLNVQNPSFHSTPKLDI 188
             +H                      + F++ P LY+S+FYLLLLN +  ++H+ PK  +
Sbjct: 127 MYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPLLYLSEFYLLLLNTEIDNYHNGPKTVL 186

Query: 189 INRTVLVAYVPLALQCFR 206
            N+ VLV ++PL L  ++
Sbjct: 187 FNKFVLVVFIPLCLHLYK 204

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  142 bits (357), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 116/189 (61%), Gaps = 3/189 (1%)

Query: 21  RAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWMIWFY 80
           + +Q Y+L    LY AL  RWL L PLVG+R++PGGIH +L YLL   +V EVLW ++F+
Sbjct: 5   KLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFH 64

Query: 81  RFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHHXXXX 140
              +G  ++ +LK  N LY V  +HFYDDYEHAP+LK   YS FI+ + + ++  H    
Sbjct: 65  GL-RGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRL 123

Query: 141 XXXXXXXXXXXXXSD--TFVLQPALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLVAYV 198
                            ++V+ P LY+S+F LLLLN Q P+ H+T +L+++N  VL+ Y 
Sbjct: 124 FKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYF 183

Query: 199 PLALQCFRR 207
           P+AL  ++R
Sbjct: 184 PMALTVYKR 192

>Kwal_56.23042
          Length = 243

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 6   GIPGKPAH---TPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHG 59
           G P KPA+   +P ++    Y F+       +    A+W A +   G  W  G +HG
Sbjct: 94  GGPPKPAYPIASPQTL--EEYNFFLFGIPTRFGNFPAQWKAFWDATGGLWARGALHG 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.332    0.144    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,019,358
Number of extensions: 211278
Number of successful extensions: 522
Number of sequences better than 10.0: 12
Number of HSP's gapped: 514
Number of HSP's successfully gapped: 12
Length of query: 207
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 110
Effective length of database: 13,238,163
Effective search space: 1456197930
Effective search space used: 1456197930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)