Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR244C57256129580.0
Sklu_2433.186275188441e-105
KLLA0A01177g6362846701e-79
Kwal_47.191847125076331e-73
Scas_712.226242665493e-62
YGL228W (SHE10)5775275018e-56
CAGL0I04092g5565474673e-51
Scas_687.205712443204e-31
YFR039C5102592742e-25
CAGL0C02167g4802582404e-21
Sklu_2021.4982154692.5
CAGL0B01639g67795683.5
Scas_676.12698178674.8
AER281C463145666.0
KLLA0F07513g1048102666.0
Scas_621.1*132387666.7
Kwal_26.71231081146658.4
Scas_671.321468117658.7
ACR286C1019129658.8
CAGL0G02497g178045659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR244C
         (561 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...  1144   0.0  
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                        329   e-105
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...   262   1e-79
Kwal_47.19184                                                         248   1e-73
Scas_712.22                                                           216   3e-62
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...   197   8e-56
CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...   184   3e-51
Scas_687.20                                                           127   4e-31
YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...   110   2e-25
CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...    97   4e-21
Sklu_2021.4 YNL123W, Contig c2021 4748-7696 reverse complement         31   2.5  
CAGL0B01639g complement(151250..153283) similar to sp|P16664 Sac...    31   3.5  
Scas_676.12                                                            30   4.8  
AER281C [2783] [Homologous to ScYMR265C - SH] (1151106..1152497)...    30   6.0  
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...    30   6.0  
Scas_621.1*                                                            30   6.7  
Kwal_26.7123                                                           30   8.4  
Scas_671.32                                                            30   8.7  
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...    30   8.8  
CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces c...    30   9.7  

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/561 (98%), Positives = 550/561 (98%)

Query: 1   MRAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYTWPCTYAPAVRDKLGKASEWYG 60
           MRAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYTWPCTYAPAVRDKLGKASEWYG
Sbjct: 1   MRAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYTWPCTYAPAVRDKLGKASEWYG 60

Query: 61  ANAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGADAIVTARVAWNVVQQYQR 120
           ANAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGADAIVTARVAWNVVQQYQR
Sbjct: 61  ANAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGADAIVTARVAWNVVQQYQR 120

Query: 121 RHVVPLTGRLLAKCPCLERWAEQAARGWQWLCKHARALATAVQQQYPAFVAHMGGIWEPL 180
           RHVVPLTGRLLAKCPCLERWAEQAARGWQWLCKHARALATAVQQQYPAFVAHMGGIWEPL
Sbjct: 121 RHVVPLTGRLLAKCPCLERWAEQAARGWQWLCKHARALATAVQQQYPAFVAHMGGIWEPL 180

Query: 181 HGAYNRIYLDLGRPVQEKTSEDASAAPGGTQYXXXXXXXXXXXLDELVTVTAEDGLSDVV 240
           HGAYNRIYLDLGRPVQEKTSEDASAAPGGTQY           LDELVTVTAEDGLSDVV
Sbjct: 181 HGAYNRIYLDLGRPVQEKTSEDASAAPGGTQYITSTITMTMTSLDELVTVTAEDGLSDVV 240

Query: 241 EASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKS 300
           EASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKS
Sbjct: 241 EASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKS 300

Query: 301 QEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITRPLMREYFSQANDELANI 360
           QEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITRPLMREYFSQANDELANI
Sbjct: 301 QEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITRPLMREYFSQANDELANI 360

Query: 361 TNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAE 420
           TNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAE
Sbjct: 361 TNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAE 420

Query: 421 RNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSK 480
           RNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSK
Sbjct: 421 RNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSK 480

Query: 481 ANLSFQEREKNDRLREQHEQEAREMTLREQLSTELAANGTEVIIDTFEVDLDQLLRSNST 540
           ANLSFQEREKNDRLREQHEQEAREMTLREQLSTELAANGTEVIIDTFEVDLDQLLRSNST
Sbjct: 481 ANLSFQEREKNDRLREQHEQEAREMTLREQLSTELAANGTEVIIDTFEVDLDQLLRSNST 540

Query: 541 SWSVPPADARAEPASGSPIQQ 561
           SWSVPPADARAEPASGSPIQQ
Sbjct: 541 SWSVPPADARAEPASGSPIQQ 561

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/518 (36%), Positives = 284/518 (54%), Gaps = 44/518 (8%)

Query: 2   RAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYT----WPCTYAPAVRDKL----G 53
           R ++++    +L L   +Y+C  Y  CPA ++   +YT    W   Y P + +KL     
Sbjct: 3   RQLTRVTATLLLFLVGCRYFCANY-ECPAALSQCCYYTSSDAWTEVYVPVIEEKLPILEA 61

Query: 54  KASEWYGANAAPHVSVASGWMQGKVMPHL-------------------TKVSQWTEKHVQ 94
           +   W+G    PH++ A+      V+PHL                    KV  + E  + 
Sbjct: 62  RVYPWWGEKVTPHLNKANAAYVSNVVPHLGKLKSNYRTVVAPKLRSLAIKVRDYFETTIF 121

Query: 95  PRMRQAGADAIVTARVAWNVVQQYQRRHVVPL----TGRLLAKCPCLERWAEQAARGWQW 150
           P+  +A        ++ +++    + +H+  +    T   L K P + +++      +  
Sbjct: 122 PQCYKAYHTIAFKIQLYYHIFIVPRAKHIKSVISLKTNDFLGKHPTIGKFSHALNSWFHS 181

Query: 151 LCKHARALATAVQQQYPAFVAHMGGIWEPLHGAYNRIYLDLGRPVQEKTSEDASAAPGGT 210
                R     ++++Y        G  E        +        +    +D     G  
Sbjct: 182 TLDFCRLKVNCIRKRY--------GKREEGMPILKEVEDREEDEEEGYEEDDEEDEDGVL 233

Query: 211 QYXXXXXXXXXXXLDEL---VTVTAEDGLSDVVEASFKDLVADEFSAWQQAIERKADSVL 267
                         DEL   VT  + +     ++   KDLV +E+ AW   +ERKA++ L
Sbjct: 234 HLTSTITTTITLAQDELASAVTAASREEEDSSLDVPLKDLVQNEYQAWSNTVERKANTAL 293

Query: 268 QAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQT 327
            AFT+EV ++E++Q E+V+P   +LL++IS  +Q H+ KIN+AI DIN TME+     Q 
Sbjct: 294 DAFTKEVHDYEIEQLESVSPLMSSLLQNISNTTQLHFQKINKAILDINCTMEIGENGEQ- 352

Query: 328 IWFDAHGTQLHQYITRPLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHI 387
           ++FD HGTQL +YITRPLMR  F+ AN+EL  +++ +RA L+E V++VN  VDVIR EH+
Sbjct: 353 LFFDRHGTQLKEYITRPLMRGLFTAANEELTAMSDDLRARLKEFVNTVNDHVDVIRNEHL 412

Query: 388 EVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAERNRNWKRFLKLKKRVIKVRDQLLEHPV 447
           EVYEEW DVM+SEWS+RMAY+DVV  D + ++E++ NWK FLKLK+ VIK RD L+EHPV
Sbjct: 413 EVYEEWGDVMISEWSKRMAYVDVVALDEQDDSEQHSNWKNFLKLKRNVIKTRDLLVEHPV 472

Query: 448 KFNQLETFLKEIQSTLRILAQENGEYLYILRSKANLSF 485
           KF+ LE FLKE+Q TLR+LA+E+GEYLYILRSKANL+F
Sbjct: 473 KFHDLEVFLKEVQFTLRMLAKESGEYLYILRSKANLTF 510

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 193/284 (67%), Gaps = 5/284 (1%)

Query: 224 LDELVTVTAEDGLSDVVEASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHE 283
           LD   T +A   + D  + S ++++ ++F +W+  IE K  + ++ F  ++ EF  ++ +
Sbjct: 292 LDLKATPSASGLIVDECDMSMEEMLRNDFMSWKITIENKLSNTMKDFENDINEFAQEKLD 351

Query: 284 AVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITR 343
            + P    LLK  S  SQ ++  I +AI D+N T  +DP TN+TIWFD + TQL +Y+TR
Sbjct: 352 HIQPTLADLLKRASNTSQTNFQIITKAIMDVNCTESVDPKTNKTIWFDQNNTQLPKYMTR 411

Query: 344 PLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSR 403
            LMREYFS A+ +   ++  IRA LR++ D VN  V+V+RQE++E++EEWADVM++EWS+
Sbjct: 412 ELMREYFSAAHSQFDALSQEIRAHLRKLADEVNDHVEVLRQENVELFEEWADVMITEWSK 471

Query: 404 RMAYIDVV---DRDLEAEAERNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQ 460
            +AY+DV    ++  + E E+ +NWK F+KLK++VIK RD L+EHPVK + L++F+  +Q
Sbjct: 472 NLAYVDVAVNEEKLADLEKEQRKNWKDFMKLKRQVIKTRDTLMEHPVKLDSLQSFVNTVQ 531

Query: 461 STLRILAQENGEYLYILRSKANLSFQEREKNDRLREQHEQEARE 504
            +L+ L+ ENGEYLYILRSKANL FQ RE  +  R+Q E+E  E
Sbjct: 532 QSLKTLSHENGEYLYILRSKANLEFQAREALE--RQQREKEKAE 573

>Kwal_47.19184
          Length = 712

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 173/507 (34%), Positives = 254/507 (50%), Gaps = 33/507 (6%)

Query: 7   LFVFTVLVLGSLQ--YYCGRYGACPAQIAVISHYT--WPCTYAPA-VRDKLGKASEWYGA 61
           L    V+VLG  Q   YC R  A   Q   +S  +  W    AP   R+  G+   W  A
Sbjct: 8   LITILVVVLGIQQASRYCQRQDASFCQYTSLSRMSPWWAANGAPVWEREVAGRVERW-SA 66

Query: 62  NAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGADAIVTARVAWNVVQQYQRR 121
            A  +      W + +V           E HV P + +    A +  ++ +NV    + +
Sbjct: 67  AAHEYEKRVEAWAEPRVQQGWAWSRDVVETHVVPTVYKWSKLAQLKVQLWYNVYVMPRVK 126

Query: 122 HVVPLTGRLLAKCPCLERWAEQAARGWQWLCKHARALATAVQQQYPAFVAH----MGGIW 177
           H      R +A     +R+  +     QW     R + T + QQ    +      +  + 
Sbjct: 127 HFQYRVQRWVASNTYAQRFLARI----QWAVAETRVVVTWLTQQVARVLEQAPIVVRDLL 182

Query: 178 EPLHGAYNRIYLDLGRP-----------VQEKTSEDASAAPGGTQYXXXXXXXXXXXLD- 225
           + +    +R+  +L              V+E  S+D       T Y            D 
Sbjct: 183 KSISSRKSRVENNLEEENNLEEENFTIIVEELPSDDEYDDDDETLYLTSTIIETVTISDA 242

Query: 226 -ELVTVTAEDGLSD--VVEASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQH 282
            EL   TA     D   +E   +DLV DEF AW  A+++KA + L  F  E+ +    + 
Sbjct: 243 NELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKL 302

Query: 283 EAVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYIT 342
             + P    LL+ IS   Q +Y  IN+AI D++  MELDP T + ++F+  GTQL +Y+T
Sbjct: 303 SEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKYMT 362

Query: 343 RPLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWS 402
           RPLMREYFS A+  +      +RA+L + V  VN +VD IRQE +E+YEEW DVM+SEWS
Sbjct: 363 RPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWS 422

Query: 403 RRMAYIDV---VDRDLEAEAERNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEI 459
           +RMAY D+   +  D   + +++ NWK+FLKLKKRV+  RDQL++HP K   L+TFL++I
Sbjct: 423 KRMAYGDIFHAIGSD-SFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDI 481

Query: 460 QSTLRILAQENGEYLYILRSKANLSFQ 486
           Q TL  L ++ GEYL+ILRS+ANL+FQ
Sbjct: 482 QFTLSALQRDAGEYLFILRSQANLAFQ 508

>Scas_712.22
          Length = 624

 Score =  216 bits (549), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 175/266 (65%), Gaps = 8/266 (3%)

Query: 228 VTVTAEDGLSDVVEASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAP 287
           V  T+ + + D+ +   + L+  +F  W   IE+K  S+ + F ++V +   ++ ++   
Sbjct: 263 VATTSGEAVKDL-DVDEQQLLQSDFDNWSNTIEQKIASINKLFDKDVAKLIKKEMKSNEQ 321

Query: 288 KFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFDAHG-TQLHQYITRPLM 346
           KF+  +++++ +S+  +  +N+AI+DIN T  LDP TN+TI+FD +G TQL QYI RPL+
Sbjct: 322 KFKDKIQNLNQESELLFQDLNKAIQDINCTESLDPQTNETIYFDRNGETQLEQYIERPLI 381

Query: 347 REYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMA 406
           RE F +    L  +   I+ +   +++ VN +V+ IR EH++VYEEW ++MV+EWS+RMA
Sbjct: 382 RELFEKTRATLNELIADIQNDENVLIEKVNKKVESIRDEHLDVYEEWGEIMVNEWSKRMA 441

Query: 407 YIDVVDRDLEAEAERNR------NWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQ 460
           Y+DVV   L AE +  +      NWK+FLK+KK+VI  RD+L+EH      +E FL  IQ
Sbjct: 442 YVDVVAAHLNAEEKEAKKTMSEENWKKFLKVKKQVIGARDELVEHVPNIKTMEQFLNNIQ 501

Query: 461 STLRILAQENGEYLYILRSKANLSFQ 486
            TL++L+++ GEYLYILR++ANL+FQ
Sbjct: 502 ETLKMLSKDAGEYLYILRARANLAFQ 527

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 1  MRAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYTWPCTYAPAVRDKLGKASEWYG 60
          M+  SKLFV  + ++ SL Y+C +   C  Q+  I HYT P T+   + DK    S  Y 
Sbjct: 1  MKFCSKLFVTVLTLVVSLHYFC-QVNDCADQLLQICHYTSPNTWDQFLSDK----SVTYK 55

Query: 61 ANAAPHVSVASGWMQGKVMPHLTKVSQWT-EKHVQP 95
             AP +  A       V P L ++ +   EK ++P
Sbjct: 56 LQVAPRIIQAKEQYSIHVEPSLNELYEKVHEKAIRP 91

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score =  197 bits (501), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 147/527 (27%), Positives = 248/527 (47%), Gaps = 58/527 (11%)

Query: 8   FVFTVLVLGSLQYYCGRYGA----CPAQIAVISHYTWPCTYAPAVRDKLGKASEWYGANA 63
            + T+ VL SL  YC  + +    C  +   + HYT P  +         +  E Y    
Sbjct: 7   LITTLTVLVSLLQYCCEFNSGSISCE-RTQTLCHYTNPRVWNTY----FSRNCELYKNKV 61

Query: 64  APHVSVASGWMQGKVMPHLTKVSQWTEK-HVQPRMRQAGADAIVTARVAWNVVQQYQ--R 120
           +P   + +      V P +   +    K  +QP  +      I +    WN  + YQ  R
Sbjct: 62  SPGFDIVARKYDTAVKPVIDDATVKVNKVAIQPAFK-----VIHSQCKKWNCGKYYQLVR 116

Query: 121 RHVVPLTGRLLAKC-----PCLERW--AEQAARGWQWLCKHARA-------LATAVQQQY 166
             +V       AK      P L+++  AE  +   + + K+           +  ++ +Y
Sbjct: 117 SPMVKTRRFFFAKYNAFVKPNLDKFFTAEFRSHLKERILKYKNIGHYYFTITSRCIKSKY 176

Query: 167 PAFVAH-----MGGIWEP----LHGAYNR--IYLDLGRPVQEKTSEDASAAPGGTQYXXX 215
              V +     MG         +HG+  R     D+   V    S++       TQ    
Sbjct: 177 DFIVGNTEEKLMGKFKNKDTHGIHGSVTREPSSEDMVLTVSTMESDEEELTTTSTQTVVE 236

Query: 216 XXXXXXXXLDELVTVTAEDGLSDVVEASF------KDLVADEFSAWQQAIERKADSVLQA 269
                      +     +D  S  VE S       + L+ ++F  W + I +K   V+Q 
Sbjct: 237 TITLDQEEASAVANHAHDDEASTDVEGSTDVNVNEQALLQEDFDMWSETILQKTQDVIQL 296

Query: 270 FTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIW 329
           F ++V ++   +    A  F+A  + +  KS++ ++KI+ AI DI     +D  T + I+
Sbjct: 297 FEKDVSKYINGKLVEEANHFKAKFQSLDDKSKKFFSKISLAINDIECVEGIDSETGKKIF 356

Query: 330 FDAHG-TQLHQYITRPLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIE 388
           FD  G T++ QYITR L+REYF++    L  +TN +  +L E+ D +  +V+ IR+E++E
Sbjct: 357 FDKSGSTEISQYITRELVREYFNETRSTLDELTNAMEKDLSEITDEIEKKVNAIREENVE 416

Query: 389 VYEEWADVMVSEWSRRMAYIDVVDRDL---------EAEAERNRNWKRFLKLKKRVIKVR 439
           V+EEW D++V+EWS+RMAY+DV++  +         E +A+ + NWK+FLK KK++I+ R
Sbjct: 417 VFEEWGDIIVNEWSKRMAYVDVINAHMGADDDTTLDEEKAKSSVNWKKFLKGKKQIIESR 476

Query: 440 DQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKANLSFQ 486
           D+L  H    +++  F +++Q  +    QE+GE+LYILRSKANL FQ
Sbjct: 477 DKLAHHSADLSRVNAFRQKVQKKILSFTQESGEFLYILRSKANLQFQ 523

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score =  184 bits (467), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 145/547 (26%), Positives = 257/547 (46%), Gaps = 48/547 (8%)

Query: 1   MRAISKLFVFTVLVLGSLQYYC-GRYGACPAQIAVISHYTWPCTYAPAVRDKLGKASEWY 59
           MR ++K  +F   V   L+Y C     A   Q+ +  HY+ P  +     D L K S  Y
Sbjct: 1   MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPALW----NDYLLKNSPAY 56

Query: 60  GANAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGAD-AIVTARVAWNVVQQY 118
             +  P + VA G  +  V PH+  V +     +    ++   D A   A +A+   Q Y
Sbjct: 57  KNSVHPQLVVAKGKYEELVQPHVKDVCKRVHTQLDRIDKKKYCDLAHSYANLAYQKAQFY 116

Query: 119 QR----RHVVPLTGRLLAKCPC---LERWAEQAARGWQWLCKHARALAT--AVQQQYPAF 169
                 ++V       L        +ER  E  ++ +         L T   V++   + 
Sbjct: 117 YSISAGKYVHDFCKSDLYNKNLKRHVERAKEDLSKAYHLAVVRIPQLFTRENVEKFTSSA 176

Query: 170 VAHMGGIWEPLHGAYNRIYLDLGRPVQEK-----TSEDASAAPGGTQYXXXXXXXXXXXL 224
            A++    E L     +I  D+ + V+ +     TS ++   P  +              
Sbjct: 177 SAYINEKTESLKKEAKQITSDVKKTVESEIKKRTTSSESEEEPIVSTSTIVKTITRTRHS 236

Query: 225 DELVTV------TAEDGLSDVVEASFKDLVAD-------EFSAWQQAIERKADSVLQAFT 271
               T       T+E  L    E    D+  D       +F  W   I++K   V +   
Sbjct: 237 SSSTTSTKSAEETSEKNLETKEEEDITDIEIDHQAQLQRDFDKWTSNIDKKVKMVNKMLV 296

Query: 272 EEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFD 331
            +V +    + +A    F+  LK +  ++ +++  IN+AI+DIN T  +DP T + I+FD
Sbjct: 297 RDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFD 356

Query: 332 AHG-TQLHQYITRPLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVY 390
           + G +Q+ +YITR ++R   +     L ++   I  ++ ++++      +  R++H+  +
Sbjct: 357 SEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTF 416

Query: 391 EEWADVMVSEWSRRMAYIDVVDRDLEAEAE-------RNRNWKRFLKLKKRVIKVRDQLL 443
           EEW D+M++EWS+++AY+DV+    +AE E         +NWK+F+ +KK+++  RD++ 
Sbjct: 417 EEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSEKNWKKFMAIKKQILDARDKMA 476

Query: 444 EHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKANLSFQEREKNDRLREQHEQEAR 503
           +  +K ++ +  L  +Q+TL+ +  ENGEYLYILR++ANL+FQERE   RL    E+EA 
Sbjct: 477 KRQIKISEFKLLLDNVQNTLQAVTNENGEYLYILRAQANLAFQERE---RL----EKEAE 529

Query: 504 EMTLREQ 510
           E  LR++
Sbjct: 530 EAKLRKE 536

>Scas_687.20
          Length = 571

 Score =  127 bits (320), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 134/244 (54%), Gaps = 6/244 (2%)

Query: 248 VADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKI 307
           + +EF+AW  A+E K+ + L AF +E+     ++ E    +    L ++  + +    KI
Sbjct: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318

Query: 308 NQAIRDINSTMELDPATNQTIWFDAHGT-QLHQYITRPLMREYFSQANDELANITNHIR- 365
            + I+DI+   + DP++N+ ++FD++GT ++ +Y++RPLM   F +A+ ++    N +  
Sbjct: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378

Query: 366 AELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE----AER 421
             +   + S+  +++ I QE++EVYEEW D+M+SEWSRRMA  DVV   L  +     + 
Sbjct: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDDPLFEQS 438

Query: 422 NRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKA 481
            + W+RFL LK  V+++RD L         LE  +   +  L  +  E       L  KA
Sbjct: 439 AKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKA 498

Query: 482 NLSF 485
           +++F
Sbjct: 499 DVAF 502

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score =  110 bits (274), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 132/259 (50%), Gaps = 13/259 (5%)

Query: 251 EFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQA 310
           E+ AW +AI+ K  S +     E+      + +  + +    L  ++    E    ++  
Sbjct: 251 EYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSK 310

Query: 311 IRDINSTMELDPATNQTIWFDAHG-TQLHQYITRPLMREYFSQANDELANITNHIRAELR 369
           I+DIN T + DP  N+  +FD  G  +L  YIT+  +          L +    +   L 
Sbjct: 311 IKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLD 370

Query: 370 EVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE------AERNR 423
             +  +    + IR E++EVYEEW DVM+S+WS+RMAY+DV    LE +       E + 
Sbjct: 371 SFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHS 430

Query: 424 NWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILR-SKAN 482
           NW RF++LKK+VI  R++L++H +    +  ++ ++++  +   + N +  ++ R + A+
Sbjct: 431 NWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQN-TKNNIQDTFLQRMNTAD 489

Query: 483 LSFQEREKNDRLREQHEQE 501
             F+ RE    L+EQ E+E
Sbjct: 490 TLFKNRE----LKEQLEEE 504

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 118/258 (45%), Gaps = 20/258 (7%)

Query: 252 FSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAI 311
           F+ W ++I RK  ++    ++EV         +    F+  ++ + +      + +   +
Sbjct: 214 FNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTV 273

Query: 312 RDINSTMELDPATNQTIWFDAHGTQL-HQYITRPLMREYFSQANDELANITNHIRAELRE 370
           ++IN TM  D  T+   ++D  G +L   Y+TRPL+  +       L  +   ++ ++  
Sbjct: 274 QNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN 333

Query: 371 VVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE------------ 418
           +V+  +  ++ +R E IE YEEW D   +EWS+ MAY D+ D D E              
Sbjct: 334 MVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIDGKGKGE 393

Query: 419 -------AERNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENG 471
                  A+   +W  F   KK +I+ RDQLL   +   +L+ F   + S L  L +   
Sbjct: 394 DQGDDEVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYT 453

Query: 472 EYLYILRSKANLSFQERE 489
             +  LRS+A+   ++R+
Sbjct: 454 AQIQSLRSQADRLLKDRD 471

>Sklu_2021.4 YNL123W, Contig c2021 4748-7696 reverse complement
          Length = 982

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 9/154 (5%)

Query: 285 VAPKFRAL-LKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITR 343
           V P++RA  L+ IS      Y   +  + D + T+       + +W    G +L      
Sbjct: 665 VIPRYRATNLEAISIDCSVSYRCNSGILADKDGTV-------RALWLSFLGERLEDKEKI 717

Query: 344 PLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSR 403
            LM    +   D +  + N  R  +  +VD+  G + V++     V EEW   M +E   
Sbjct: 718 YLMGLDLADLQDIITILKNGKRPRVN-IVDAGFGSISVLQARIRSVPEEWITRMENECDN 776

Query: 404 RMAYIDVVDRDLEAEAERNRNWKRFLKLKKRVIK 437
           R+ +++V       E E+       L +  +++K
Sbjct: 777 RLQFMNVTRVSYTEEKEKLLPGDVILSVNDKLVK 810

>CAGL0B01639g complement(151250..153283) similar to sp|P16664
           Saccharomyces cerevisiae YDR137w RGP1, start by
           similarity
          Length = 677

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 51/95 (53%), Gaps = 7/95 (7%)

Query: 365 RAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAERNRN 424
           R  L   ++++NG++  IRQE+ E+ E   ++  S+WS R  +    + D  A+   + N
Sbjct: 47  RDHLETTLNNLNGKIQRIRQENREILEN--EIPESKWSLRNMF-SKKNGDESAQNATDSN 103

Query: 425 WKRFLKLKKRVI---KVRDQLLEHPVKFNQLETFL 456
                 +K++++   K R++L +  +KFN +  F+
Sbjct: 104 LTLITDVKEQLVLLEKSRERLTKD-LKFNSIVNFV 137

>Scas_676.12
          Length = 698

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 25/178 (14%)

Query: 350 FSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYID 409
           F    +EL N     + ++    +++   +D + + + ++ EEW     SEW   +   +
Sbjct: 178 FEDQRNELLNKVEDFKNKILTNDEALQNMLDEVEESNRKIKEEWLQKYHSEWKENLELNE 237

Query: 410 VVDRDLEAEAERNRNWKRFLKLKKRV-IKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQ 468
            + +D+E              LK R+ IK+  +     +K  QL+  L+ ++S L    +
Sbjct: 238 KISKDIET-------------LKNRISIKLEPEANTKKIKVEQLKNNLQALKSMLETKQR 284

Query: 469 ENG---EYLYILRSKANLSFQERE------KNDR--LREQHEQEAREMTLREQLSTEL 515
           E     E +   + K     Q+R+      KN    LRE +E   +E T+R  L  EL
Sbjct: 285 ETSTLEEQIEQKKLKTTEVVQKRQELEEYIKNTELDLREINEILIKEETMRRSLHNEL 342

>AER281C [2783] [Homologous to ScYMR265C - SH] (1151106..1152497)
           [1392 bp, 463 aa]
          Length = 463

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 56/145 (38%), Gaps = 24/145 (16%)

Query: 258 AIERKADSVLQA------FTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAI 311
           A ER   SVL        F+E +GE   +  +     F A+L     K + H + +    
Sbjct: 112 AKERGTVSVLMTGRREVVFSELIGELLRRPVDGECLCFNAVL----LKKEGHRSTLAYKT 167

Query: 312 RDINSTMELDPATNQTIWFDAHGTQLHQYITRPLMREYFSQANDELANITNHIRAELR-- 369
             +   ++  PA  +   +D    QL  +  R  + EY +  N+ L     HI  E+R  
Sbjct: 168 ACMKDLLDAYPALEEITIYDDRPWQLAGF--RTFLNEYVTAVNNRLTPNLVHIPGEIRYL 225

Query: 370 ----------EVVDSVNGQVDVIRQ 384
                      VV+  N  VD++R 
Sbjct: 226 EPRKEVAIITAVVEEHNRDVDLLRN 250

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
           cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 365 RAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAERNRN 424
           RAELR++++   GQ DVI    +  Y   A         R    DVV  D E    +N  
Sbjct: 588 RAELRDILEENEGQYDVI----VTTYNLAAGTKYDVSFLRNRNFDVVVYD-EGHMLKNSM 642

Query: 425 WKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRIL 466
            +RF KL K     R  L   P++ N     LKE+ S L  +
Sbjct: 643 SERFNKLMKINAHFRLLLTGTPLQNN-----LKELMSLLEFI 679

>Scas_621.1*
          Length = 1323

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 45/87 (51%), Gaps = 9/87 (10%)

Query: 337 LHQYITR---PLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEW 393
           L+QY TR    L+ +  +  NDE  +I+N++R   +E +++ +  ++ + Q    + +  
Sbjct: 735 LNQYATRIYETLVNQDVNVKNDEFFDISNYLRVTTQEYIETTDDIINAVEQ----LIDAR 790

Query: 394 ADVMVSEWSRRMAYIDVVDRDLEAEAE 420
            +++   +  RM   D+ +  L+ E E
Sbjct: 791 GNLL--NYVARMMKNDITNALLKGEGE 815

>Kwal_26.7123
          Length = 1081

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 61/146 (41%), Gaps = 15/146 (10%)

Query: 365 RAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAERNRN 424
           RAELR++++  +GQ DVI   +        D  VS    R   + V D   E    +N  
Sbjct: 610 RAELRDILEDNDGQYDVIVTTYNLASGNKYD--VSFLKNRGFNVVVYD---EGHMLKNSM 664

Query: 425 WKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTL-----RILAQENGEYLYILRS 479
            +RF KL K     R  L   P++ N     LKE+ S L      +   +  +   + R 
Sbjct: 665 SERFTKLMKIEANFRLLLTGTPLQNN-----LKELMSLLEFIMPNLFISKKNDLSAVFRQ 719

Query: 480 KANLSFQEREKNDRLREQHEQEAREM 505
           +A  S   ++ N  L ++    A+ M
Sbjct: 720 RARTSDSNKDYNPLLAQEAIARAKTM 745

>Scas_671.32
          Length = 1468

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 22/117 (18%)

Query: 231 TAEDGLSDVVEASFKD------LVADEFS---AWQQAIERKADSVLQAFTEEVGEFEMQQ 281
           + ED +SD+     K       LV   FS   A Q+  E K DS   +FT E+       
Sbjct: 821 STEDSISDITNRIKKTANISTPLVDSHFSIPAATQETSEFKTDSPFSSFTNEL------- 873

Query: 282 HEAVAPKFRALLKHISAKSQEHYAKIN---QAIRDINSTMELDPATNQTIWFDAHGT 335
           +++ AP F    K +  K ++  A ++   Q ++DI    EL  A++      ++GT
Sbjct: 874 NKSTAPTF-TFNKEL--KEEKQIASVDSSEQPLKDIKRQSELSTASDTEFRIPSNGT 927

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 9/129 (6%)

Query: 365 RAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAERNRN 424
           RAELR++++  +GQ D I   +       AD  VS    R   + + D   E    +N  
Sbjct: 557 RAELRDILEENDGQYDAIVTTYNLASGNKAD--VSFLKNRQFNVVIYD---EGHMLKNSM 611

Query: 425 WKRFLKLKKRVIKVRDQLLEHPVKFN--QLETFLKEIQSTLRILAQENGEYLYILRSKAN 482
            +RF KL K     R  L   P++ N  +L + L+ I  +L     +  E   + + +A 
Sbjct: 612 SERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFIMPSL--FVSKKDELAAVFKQRAR 669

Query: 483 LSFQEREKN 491
            S   ++ N
Sbjct: 670 TSDSNKDYN 678

>CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces
           cerevisiae YKR095w MLP1, hypothetical start
          Length = 1780

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 442 LLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKANLSFQ 486
           LLEH  K N+L+T   E+QS  + ++ +N +   +LR + +L+ Q
Sbjct: 450 LLEHATKENELKT--NELQSLKKKISDDNSQLEILLRQRTDLAHQ 492

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.130    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,862,785
Number of extensions: 673429
Number of successful extensions: 2675
Number of sequences better than 10.0: 76
Number of HSP's gapped: 2745
Number of HSP's successfully gapped: 79
Length of query: 561
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 454
Effective length of database: 12,891,983
Effective search space: 5852960282
Effective search space used: 5852960282
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)