Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR243C44944122180.0
Sklu_2433.1944944120590.0
YER043C (SAH1)44944120500.0
KLLA0A01199g44944120330.0
Kwal_47.1918044944120220.0
CAGL0C02189g44944120190.0
Scas_687.2144944120130.0
CAGL0M12837g46691840.026
Scas_701.20469122840.030
YIL074C (SER33)469122810.069
YER081W (SER3)469122800.087
Kwal_23.5953470122720.84
YKL060C (FBA1)35974711.0
Sklu_2438.247093701.4
YCR045C491165682.2
YAL060W (BDH1)38294682.5
KLLA0C09306g47091673.0
YFL055W (AGP3)55849656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR243C
         (441 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH] (876308..87...   858   0.0  
Sklu_2433.19 YER043C, Contig c2433 31749-33098                        797   0.0  
YER043C (SAH1) [1469] chr5 complement(235769..237118) Adenosylho...   794   0.0  
KLLA0A01199g 111159..112508 highly similar to sp|P39954 Saccharo...   787   0.0  
Kwal_47.19180                                                         783   0.0  
CAGL0C02189g 222418..223767 highly similar to sp|P39954 Saccharo...   782   0.0  
Scas_687.21                                                           780   0.0  
CAGL0M12837g 1265948..1267348 highly similar to sp|P40510 Saccha...    37   0.026
Scas_701.20                                                            37   0.030
YIL074C (SER33) [2597] chr9 complement(221078..222487) 3-phospho...    36   0.069
YER081W (SER3) [1513] chr5 (322682..324091) 3-phosphoglycerate d...    35   0.087
Kwal_23.5953                                                           32   0.84 
YKL060C (FBA1) [3199] chr11 complement(326053..327132) Fructose-...    32   1.0  
Sklu_2438.2 YER081W, Contig c2438 2568-3980                            32   1.4  
YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member o...    31   2.2  
YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R, 3R)-...    31   2.5  
KLLA0C09306g complement(810584..811996) highly similar to sp|P40...    30   3.0  
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...    30   6.4  

>AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH]
           (876308..877657) [1350 bp, 449 aa]
          Length = 449

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/441 (94%), Positives = 418/441 (94%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWTSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                TTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           VKLTKLSSTQSEYLGIPEEGP
Sbjct: 421 VKLTKLSSTQSEYLGIPEEGP 441

>Sklu_2433.19 YER043C, Contig c2433 31749-33098
          Length = 449

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/441 (85%), Positives = 405/441 (91%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PAQNYK+AD+SLAAFGRKEIEL+EHEMPGLMAIR+AY +AQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIREAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                T+LVHEK+PEML+DCFG+SEETTTGVHHLYRM+KE KLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHEKHPEMLEDCFGISEETTTGVHHLYRMVKEAKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVNDSVTKSKFDNLYGCRESL+DG+KRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQV  M++ AS+GQVFVTTTGCRDII  EHFL+MPEDAIVC
Sbjct: 241 RVVVTEIDPINALQAAMEGYQVIPMEEAASFGQVFVTTTGCRDIITSEHFLSMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDRYLLSSG+HVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFKAND+ FR+KYIEFQKTGPF++GVHVLPKILDEAVAKFHLDKLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDKEFREKYIEFQKTGPFELGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           VKLT+LS  QSEYLGIP+EGP
Sbjct: 421 VKLTQLSDVQSEYLGIPQEGP 441

>YER043C (SAH1) [1469] chr5 complement(235769..237118)
           Adenosylhomocysteinase (S-adenosylhomocysteine
           hydrolase) [1350 bp, 449 aa]
          Length = 449

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/441 (85%), Positives = 402/441 (91%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PAQNYK+AD+SLAAFGRKEIEL+EHEMPGLMAIRKAYGD QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                TTLVHEK+PEML+DCFG+SEETTTGVHHLYRM+KEGKLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVNDSVTKSKFDNLYGCRESLVDG+KRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQV TM+  +  GQVFVTTTGCRDII  EHF+ MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDRYLLSSGRHVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFK+ND++FR+K+IEFQKTGPF++GVHVLPKILDEAVAKFHL  LG
Sbjct: 361 MSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           V+LTKLS  QSEYLGIPEEGP
Sbjct: 421 VRLTKLSKVQSEYLGIPEEGP 441

>KLLA0A01199g 111159..112508 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1
           S-adenosyl-L-homocysteine hydrolase singleton, start by
           similarity
          Length = 449

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/441 (85%), Positives = 397/441 (90%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PA NYKVAD+SLAAFGRKEIEL+EHEMPGL+AIR+AYG  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                T+LVH+KYP+ML DCFG+SEETTTGVHHLYRM+KE KLKVPA
Sbjct: 121 AFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVNDSVTKSKFDNLYGCRESL+DG+KRATDVMLAGKVAVVAGYGDVGKGCAAALRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV  M++  S GQVFVTTTGCRDII KEHFL MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDRYLL SG+HVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFKA D+AFR+KYIEFQKTGPFDIGVHVLPKILDEAVAKFHLD LG
Sbjct: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           VKLTKLS  QSEYLGIPEEGP
Sbjct: 421 VKLTKLSDVQSEYLGIPEEGP 441

>Kwal_47.19180
          Length = 449

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/441 (85%), Positives = 399/441 (90%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PAQN KVAD+SLAAFGRKEIEL+EHEMPGLMAIR+AYG+AQPLKGARIAGCLHMTIQ
Sbjct: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                TTLVHEK+PEML DCFG+SEETTTGVHHLYRM+K+ KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVND+VTKSKFDNLYGCRESL+DG+KRATDVMLAGKV+VVAGYGDVGKGCAAALRGMG+
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV  M++  S GQVFVTTTGCRDII  EHF+AMPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E VNIKPQVDR+LL SG+HVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFKA+D  FRQKYIEFQKTGPF+IGVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           V+LTKLS  QSEYLGIPEEGP
Sbjct: 421 VRLTKLSEVQSEYLGIPEEGP 441

>CAGL0C02189g 222418..223767 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1, start by
           similarity
          Length = 449

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/441 (84%), Positives = 401/441 (90%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PAQNYK+AD+SLAAFGRKEIEL+E+EMPGLMAIRKAY +AQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWTSCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYMWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                T+ VHEKYPEML DCFG+SEETTTGVHHLYRM++EGKLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVND+VTKSKFDNLYGCRESLVDG+KRATDVMLAGKVAVVAG+GDVGKGCAA+LRGMGA
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+VTTM+  AS GQVFVTTTGCRDIIK EHF  MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NA E +NIKPQVDRYLLSSGRHVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFK++D+AFR K++EF+KTGPF++GVHVLPKILDEAVAKFHL+KLG
Sbjct: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           VKLT LS  QSEYLGIP++GP
Sbjct: 421 VKLTTLSDVQSEYLGIPQQGP 441

>Scas_687.21
          Length = 449

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/441 (83%), Positives = 399/441 (90%)

Query: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60
           MS PAQNYKVAD+SLAAFGRKEIEL+EHEMPGLMAIRKAY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKVADISLAAFGRKEIELAEHEMPGLMAIRKAYAGVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAASAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180
           AF                T+LVH+K+PEMLDDCFG+SEETTTGVH+LY+M+KE +LKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHDKHPEMLDDCFGLSEETTTGVHYLYKMVKENRLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240
           INVNDSVTKSKFDNLYGCRESL+DG+KRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300
           RVIVTE+DPINALQAAMEGYQV TM+  ++ GQ+FVTTTGCRDII   HF  MPEDAIVC
Sbjct: 241 RVIVTEVDPINALQAAMEGYQVDTMESASNIGQIFVTTTGCRDIITGAHFANMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDRYLL +GRHVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLPTGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420
           MSCSFSNQVLAQIALFKA+D+AFR+K+IEFQKTGPF +GVHVLPKILDEAVAKFHLDKLG
Sbjct: 361 MSCSFSNQVLAQIALFKADDKAFREKHIEFQKTGPFTVGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSSTQSEYLGIPEEGP 441
           V+LTKLS TQSEYLG+P+EGP
Sbjct: 421 VQLTKLSDTQSEYLGVPQEGP 441

>CAGL0M12837g 1265948..1267348 highly similar to sp|P40510
           Saccharomyces cerevisiae YIL074c SER33
           3-phosphoglycerate dehydrogenase, hypothetical start
          Length = 466

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   V GYG +G   +     MG  V+  +I  I AL  A    QV+T+D+  +    F
Sbjct: 195 GKTLGVVGYGHIGSQLSVLAESMGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD-F 250

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCN 301
           VT     T   ++++    F AM + A V N
Sbjct: 251 VTLHVPETPETKNLLSAPQFAAMKDGAYVIN 281

>Scas_701.20
          Length = 469

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 14/122 (11%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   + GYG +G   +     MG  VI  +I  + AL  +    QV T+D+  +    F
Sbjct: 198 GKTLGIIGYGHIGSQVSVLAEAMGMHVIYYDIVTVMALGTSK---QVPTLDELLNKAD-F 253

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCNIGH---FDIEIDVAWLKANAV--EAVNIK 325
           VT     T   ++++    F AM + A V N+      DI   +  +K N +   A+++ 
Sbjct: 254 VTLHVPETPETKNMLSAPQFAAMKDGAYVINLSRGTVVDIPSLIQAMKVNKIAGAAIDVY 313

Query: 326 PQ 327
           P 
Sbjct: 314 PN 315

>YIL074C (SER33) [2597] chr9 complement(221078..222487)
           3-phosphoglycerate dehydrogenase, catalyzes the first
           step in the synthesis of serine from 3-phosphoglycerate
           [1410 bp, 469 aa]
          Length = 469

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 14/122 (11%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   + GYG +G   +     MG  V+  +I  I AL  A    QV+T+D+  +    F
Sbjct: 198 GKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTAR---QVSTLDELLNKSD-F 253

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCNIGH---FDIEIDVAWLKANAV--EAVNIK 325
           VT     T     ++    F AM + A V N       DI   +  +KAN +   A+++ 
Sbjct: 254 VTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVY 313

Query: 326 PQ 327
           P 
Sbjct: 314 PH 315

>YER081W (SER3) [1513] chr5 (322682..324091) 3-phosphoglycerate
           dehydrogenase, catalyzes the first step in synthesis of
           serine from 3-phosphoglycerate [1410 bp, 469 aa]
          Length = 469

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 14/122 (11%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   + GYG +G   +     MG  V+  +I  I AL  A    QV+T+D+  +    F
Sbjct: 198 GKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTAR---QVSTLDELLNKSD-F 253

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCNIGH---FDIEIDVAWLKANAV--EAVNIK 325
           VT     T     ++    F AM + A V N       DI   +  +KAN +   A+++ 
Sbjct: 254 VTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVY 313

Query: 326 PQ 327
           P 
Sbjct: 314 PH 315

>Kwal_23.5953
          Length = 470

 Score = 32.3 bits (72), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 14/122 (11%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   + GYG +G   +      G  V+  +I  I AL  A    QV+T+D+       F
Sbjct: 199 GKTLGIIGYGHIGAQLSVLAEAFGMHVLYYDIVTIMALGTAK---QVSTLDKLLGESD-F 254

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCNIGH---FDIEIDVAWLKANAV--EAVNIK 325
           VT     T   ++++    F AM + + V N       DI   V  +KA  +   A+++ 
Sbjct: 255 VTCHVPETEDTKNLLSAPQFAAMKDGSYVLNASRGTVIDIPALVQAIKAGKIAGTALDVY 314

Query: 326 PQ 327
           P 
Sbjct: 315 PH 316

>YKL060C (FBA1) [3199] chr11 complement(326053..327132)
           Fructose-bisphosphate aldolase II, catalyzes cleavage or
           condensation of fructose-1,6-bisphosphate into
           dihydroxyacetonephosphate and glyceraldehyde-3-phosphate
           at the sixth step in glycolysis [1080 bp, 359 aa]
          Length = 359

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 164 VHHLYRMLKEGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAG 223
           VH+L+   KE K  +PAINV  S T      L   R+S    + + ++    G  A  AG
Sbjct: 19  VHNLFTYAKEHKFAIPAINVTSSST--AVAALEAARDSKSPIILQTSN----GGAAYFAG 72

Query: 224 YGDVGKGCAAALRG 237
            G   +G  A+++G
Sbjct: 73  KGISNEGQNASIKG 86

>Sklu_2438.2 YER081W, Contig c2438 2568-3980
          Length = 470

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 214 LAGKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQ 273
           + GK   + GYG +G   +      G  V+  +I  I AL  A    QV+T+D+  +   
Sbjct: 197 IRGKTLGIIGYGHIGAQLSVLAEAFGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD 253

Query: 274 VFVT-----TTGCRDIIKKEHFLAMPEDAIVCN 301
            FV+     T   ++++    F AM + + V N
Sbjct: 254 -FVSCHVPATPETKNLLSAPQFAAMKDGSYVIN 285

>YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member of
           the subtilase family of serine proteases, has moderate
           similarity to S. pombe Isp6p, which is a putative
           subtilase-type proteinase involved in sexual
           differentiation [1476 bp, 491 aa]
          Length = 491

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 272 GQVFVTTTGCRDIIKKEHFLAMPEDA-IVCNIGHFDIEIDVAWLKANAVEAVNI-KPQVD 329
           G VFV   G  ++   + + A P  A  V  +G FD  ID     +N    VNI  P V+
Sbjct: 290 GIVFVAAAGNFNL---DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVE 346

Query: 330 RYLLSS-GRHVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDEAFRQKYI 388
              LS    +  L+  G  ++    TG ++ ++S     +++AQ   + +    F ++ +
Sbjct: 347 IESLSHLNYNDTLILSGTSMSTPIVTGVAAILLSKGIEPEMIAQEIEYLSTRNVFHRRTL 406

Query: 389 EFQKTGPFDIGVHVLPKI----LDEAVAKFHLDKLGVKLTKLSST 429
            F+ + P  I  + + K+     DE   + +++ +  +L + ++T
Sbjct: 407 FFKPSTPNQILYNGVDKLDDPYDDETFPRLNIEAIAKELEEYNAT 451

>YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R,
           3R)-2,3-butanediol dehydrogenase with similarity to
           alcohol/sorbitol dehydrogenases, member of the
           zinc-containing alcohol dehydrogenase family [1149 bp,
           382 aa]
          Length = 382

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 17/94 (18%)

Query: 155 GVSEETTTGVHHLYRMLKEGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDVML 214
           G +E+     HH+  + KE  L V A+    SVT              + G K+      
Sbjct: 145 GFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVK---------ISGFKK------ 189

Query: 215 AGKVAVVAGYGDVGKGCAAALRGMGA-RVIVTEI 247
            G  A+V G G +G      L+GMGA +++V+EI
Sbjct: 190 -GSSALVLGAGPIGLCTILVLKGMGASKIVVSEI 222

>KLLA0C09306g complement(810584..811996) highly similar to sp|P40054
           Saccharomyces cerevisiae YER081w SER3 3-phosphoglycerate
           dehydrogenase, start by similarity
          Length = 470

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVF 275
           GK   + GYG +G   +     +G  V+  +I  I +L  A    QV+T+++  +    F
Sbjct: 199 GKTLGIIGYGHIGSQLSVLAEALGMNVLYYDIVTIMSLGTAK---QVSTLNELLNNSD-F 254

Query: 276 VT-----TTGCRDIIKKEHFLAMPEDAIVCN 301
           VT     T   ++++    F AM + + V N
Sbjct: 255 VTCHVPATPETKNLLSGPQFAAMKDGSYVIN 285

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 9/49 (18%)

Query: 316 ANAVEAVNIK--PQVDRYLLSSG-------RHVILLADGRLVNLGCATG 355
           A+ VEAV+I   P V RY   +G       RH+ LLA G ++  GC  G
Sbjct: 26  ASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVG 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,446,427
Number of extensions: 470457
Number of successful extensions: 991
Number of sequences better than 10.0: 21
Number of HSP's gapped: 998
Number of HSP's successfully gapped: 21
Length of query: 441
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 336
Effective length of database: 12,961,219
Effective search space: 4354969584
Effective search space used: 4354969584
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)