Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR242C82380840540.0
Kwal_47.1917383662115100.0
KLLA0A01221g87262615010.0
YGL227W (VID30)95864612711e-161
CAGL0I04114g91062111841e-149
Scas_712.239734269211e-110
ADL279W49361780.35
Scas_669.1058561780.39
KLLA0D10065g46663770.46
Sklu_2101.356873770.46
CAGL0F07799g58066760.67
KLLA0B12760g54283750.78
Kwal_23.348850261731.2
YMR171C55061721.5
KLLA0D01958g112872722.2
Kwal_26.899746638676.1
Scas_721.2128459658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR242C
         (808 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...  1566   0.0  
Kwal_47.19173                                                         586   0.0  
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...   582   0.0  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...   494   e-161
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...   460   e-149
Scas_712.23                                                           359   e-110
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....    35   0.35 
Scas_669.10                                                            35   0.39 
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...    34   0.46 
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            34   0.46 
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...    34   0.67 
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...    33   0.78 
Kwal_23.3488                                                           33   1.2  
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...    32   1.5  
KLLA0D01958g complement(167629..171015) similar to sp|Q01846 Sac...    32   2.2  
Kwal_26.8997                                                           30   6.1  
Scas_721.21                                                            30   8.4  

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 1566 bits (4054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/808 (93%), Positives = 759/808 (93%)

Query: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIPNYTENGET 60
           MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQH          RRVIPNYTENGET
Sbjct: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHKKLFNKLKLKRRVIPNYTENGET 60

Query: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHNDRLAGGDR 120
           ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHNDRLAGGDR
Sbjct: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHNDRLAGGDR 120

Query: 121 LLREGEATGGTAGRDEDVAMXXXXXXXXXXXXXXXXXXXXXLPSDSDESALVVQPTQSVE 180
           LLREGEATGGTAGRDEDVAM                     LPSDSDESALVVQPTQSVE
Sbjct: 121 LLREGEATGGTAGRDEDVAMEERGEDYDEEDADDYEQSSDALPSDSDESALVVQPTQSVE 180

Query: 181 PDHGAELDGGADVEAFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLV 240
           PDHGAELDGGADVEAFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLV
Sbjct: 181 PDHGAELDGGADVEAFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLV 240

Query: 241 STDGFTNLRPNPNWQLYSGYDNSPIVNNRLRTSVNNQKQQWASTWANACINHKKVAIFYY 300
           STDGFTNLRPNPNWQLYSGYDNSPIVNNRLRTSVNNQKQQWASTWANACINHKKVAIFYY
Sbjct: 241 STDGFTNLRPNPNWQLYSGYDNSPIVNNRLRTSVNNQKQQWASTWANACINHKKVAIFYY 300

Query: 301 EIKVLSVTSAQSGQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILR 360
           EIKVLSVTSAQSGQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILR
Sbjct: 301 EIKVLSVTSAQSGQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILR 360

Query: 361 GPFEGSRPTSQQSSTGKDVYIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIF 420
           GPFEGSRPTSQQSSTGKDVYIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIF
Sbjct: 361 GPFEGSRPTSQQSSTGKDVYIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIF 420

Query: 421 FTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHN 480
           FTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHN
Sbjct: 421 FTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHN 480

Query: 481 IFTAIXXXXXXXXXXXXXXXXXXNAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQE 540
           IFTAI                  NAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQE
Sbjct: 481 IFTAISGGEESDFGFEDDDESEENAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQE 540

Query: 541 SHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKG 600
           SHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKG
Sbjct: 541 SHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKG 600

Query: 601 FLKDLQKDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDS 660
           FLKDLQKDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDS
Sbjct: 601 FLKDLQKDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDS 660

Query: 661 KFPGLLTKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEKLSQELRQK 720
           KFPGLLTKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEKLSQELRQK
Sbjct: 661 KFPGLLTKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEKLSQELRQK 720

Query: 721 FKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLEN 780
           FKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLEN
Sbjct: 721 FKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLEN 780

Query: 781 MISYTRAMVNTLMEYGDQPGSSNSDSQE 808
           MISYTRAMVNTLMEYGDQPGSSNSDSQE
Sbjct: 781 MISYTRAMVNTLMEYGDQPGSSNSDSQE 808

>Kwal_47.19173
          Length = 836

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/621 (47%), Positives = 422/621 (67%), Gaps = 35/621 (5%)

Query: 194 EAFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQ-SNNSVLVSTDGFTNLRPNP 252
           + ++  +TD   + K + N + +++Y ++GYPLPH W +Q +NN+++VS DG + L+PNP
Sbjct: 228 DQYFSPLTDGVQNAKLQKNYVSTELYKTLGYPLPHSWDSQFNNNNMVVSADGCSQLKPNP 287

Query: 253 NWQLYSGYDNSPIVNNRLRTSVNN--QKQQWASTWANACINHKKVAIFYYEIKVLSVTSA 310
             +      +S +V +    S ++   K ++ ST AN  I+ KK+AIFYYEI++LSVTS+
Sbjct: 288 VLEGLPRRGDS-VVGSGFSVSYSSYSAKFEYVSTKANNFISSKKMAIFYYEIRILSVTSS 346

Query: 311 QSGQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILRGPFEGSRPTS 370
           QSG  C+I +GFKD ++  + +  ++ +D    DP    ++NRQ++N++R   + S  ++
Sbjct: 347 QSGTNCSIKVGFKDVARFQAGSASSSRTDLQRSDP---VSINRQSANMMRAAGDSSSSSN 403

Query: 371 QQSSTG----KDVYIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNGI 426
              S G    K  + Y G DGYI DG+ +K Y K YGR+DVIGCG+NYVDGTIFFTKNG+
Sbjct: 404 SGKSRGDGFDKGSFGYCGQDGYITDGTQYKIYGKQYGRNDVIGCGVNYVDGTIFFTKNGL 463

Query: 427 HLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHNIFTAIX 486
           HLGTAF DV  +DL P+++LKP N +RTNFGL+EEF+FDI+ YQ   K+KAY +I+ ++ 
Sbjct: 464 HLGTAFTDVYDVDLAPFIALKPGNMVRTNFGLHEEFVFDILSYQRMLKSKAYQHIYKSV- 522

Query: 487 XXXXXXXXXXXXXXXXXNAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQESHTDGF 546
                                  D     ND ++    + D+   S+   +     + GF
Sbjct: 523 -----------------------DGHDGCNDFDSNDHDENDEECESSSGSDTTPDKSAGF 559

Query: 547 LLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKGFLKDLQ 606
           +L  D RFSG +LY+P+ +K+NN+S  ++S  CT+NTMINDYLIH GLIDVAKGFLKDLQ
Sbjct: 560 VLQSDDRFSGDKLYRPEVEKLNNLSTDNESFSCTMNTMINDYLIHEGLIDVAKGFLKDLQ 619

Query: 607 KDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDSKFPGLL 666
           KDCIP N+++ +R VIRH+ERQI +EE NLK+RQDIR  I +GDI RCI +ID  +PGL 
Sbjct: 620 KDCIPGNDKDLSRMVIRHNERQIIKEENNLKVRQDIRRFINEGDITRCITFIDDLYPGLF 679

Query: 667 TKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEKLSQELRQKFKAHFG 726
            K+++L FE KVAEYLL  +  +  +ID +L KG +++ EF+Y+ ++ Q+ +Q F+ H  
Sbjct: 680 EKNIDLLFELKVAEYLLVFVNFKSHSIDDILLKGQKLTAEFVYDSQVPQDYKQGFQNHLS 739

Query: 727 DISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLENMISYTR 786
           DISAL+AYDNPL EC ++LA  LTP+YLQDRLFQLVN+ +L FL+KKSESSLENM+SYTR
Sbjct: 740 DISALLAYDNPLTECSEDLAELLTPAYLQDRLFQLVNSRVLSFLEKKSESSLENMVSYTR 799

Query: 787 AMVNTLMEYGDQPGSSNSDSQ 807
            M++ LMEYG+     ++DS+
Sbjct: 800 GMIDALMEYGESSSLVHNDSE 820

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (64%), Gaps = 3/113 (2%)

Query: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIPNYTENGET 60
           MS +MD +D  YV+ALFP YLLEQP+ +ELWK+Y  +           + + N  E+G  
Sbjct: 1   MSHYMDRVDRAYVRALFPAYLLEQPIGHELWKIYLHNRKLFHKLKNKGQNVANVKESG-- 58

Query: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHND 113
            + +  ++L+YATRK IWEKL  +GVLG IP+ +  D+YL+QVY YFY   +D
Sbjct: 59  -IPKHKSELSYATRKEIWEKLMSMGVLGTIPFTAVEDDYLMQVYHYFYPDLDD 110

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/626 (49%), Positives = 423/626 (67%), Gaps = 51/626 (8%)

Query: 195 AFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNW 254
            +YP   +SKH+ + K NP+  ++Y ++GYPLPH W  QS+NS+L+S DG   LR NPNW
Sbjct: 246 VYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPNW 305

Query: 255 QLYSGYDN-SPIVNNRLRTSVNNQK-QQWASTWANACINHKKVAIFYYEIKVLSVTSAQS 312
              S Y   SPI+N+RLR ++N++K QQWA+TWAN  +NH K AIFY+EI+VLSVTS+Q+
Sbjct: 306 HALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQA 365

Query: 313 GQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILRGPFEGSR----- 367
           G+  ++ +GFK+W+K+     + +TS+  + + G  SA + +  N+LR   +G+R     
Sbjct: 366 GRNSHVLVGFKNWAKIND---KLSTSEQDTTESG--SAPSSENFNMLRNVLDGNRNVLNS 420

Query: 368 PTSQQSSTGKDV--YIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNG 425
           P+S   +   DV  Y Y+G DG   D S  + YS+P+G DD++GCG+N+++G+IFFTKNG
Sbjct: 421 PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG 480

Query: 426 IHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHNIFTAI 485
           I LG AF+D   +DLVP+VS+K  NS+RTNFGL EEFLFDI  YQ  WK K Y +IF A+
Sbjct: 481 IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV 540

Query: 486 XXXXXXXXXXXXXXXXXXNAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQE----- 540
                             ++G +L +D   N+    +G   D+IN+ TLE   QE     
Sbjct: 541 DY----------------DSGLNLVSDESDNEDLGKLG---DEIND-TLEPEFQEVASEE 580

Query: 541 ----------SHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLI 590
                        DGFLL+ D RFSG +L+KP   K+NNI+  +DSIPC LN+MINDYLI
Sbjct: 581 NDLATDGFEDDQPDGFLLTRDRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLI 640

Query: 591 HHGLIDVAKGFLKDLQKDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGD 650
           H G IDVAKGFLKDLQ+DCIPNN++ER R VIRH+ERQI +EE+NL++RQ IR  I DG+
Sbjct: 641 HEGYIDVAKGFLKDLQRDCIPNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGE 700

Query: 651 IPRCIKYIDSKFPGLLTKHVELAFEFKVAEYLLAIMKL--EQVTIDYVLQKGLEISNEFI 708
           I +C+ YI+ +FPGLL K++EL FE K A+YLL + +   E   ID +L KG +IS +F+
Sbjct: 701 ILKCMNYIEQQFPGLLEKYLELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFL 760

Query: 709 YNEKLSQELRQKFKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILM 768
            N  +S + R+ FKA F +IS LMAY NP  EC  + + +LTP+YLQ+RLFQ +N+ IL 
Sbjct: 761 QNRAISDDTREIFKAKFDEISPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQ 820

Query: 769 FLKKKSESSLENMISYTRAMVNTLME 794
           +L KKS+SSLE+MI YTRAMV TLME
Sbjct: 821 YLDKKSQSSLESMIGYTRAMVTTLME 846

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 5   MDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIPNYTE-NGETELY 63
           MD IDH+Y+ ++FP YLL+QP+ ++LWKLY+QH            ++    + +G     
Sbjct: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65

Query: 64  RRST--KLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYT 109
              T  +L+ ATRK IWEKLSQLGVLG IPYDS +D+YL+QV+KYFY 
Sbjct: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYA 113

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score =  494 bits (1271), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 288/646 (44%), Positives = 384/646 (59%), Gaps = 55/646 (8%)

Query: 205 HSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNWQLYSGYDN-- 262
           +S  +K N +  D+Y  +GY LP  W  Q NNS+ +S DG T+L+PNP++  Y  Y+   
Sbjct: 304 NSGSKKKNSMIPDIYKILGYFLPSRWQAQPNNSLQLSQDGITHLQPNPDYHSYMTYERSS 363

Query: 263 --SPIVNNRLRTSVNNQ-KQQWASTWANACINHKKVAIFYYEIKVLSVTSAQSGQTCNIN 319
             S    NRLRTS  N  K  +A TWAN  +   K+ IFYYEIKVLSVTS +S +  NI 
Sbjct: 364 ASSASTRNRLRTSFENSGKVDFAVTWANKSLPDNKLTIFYYEIKVLSVTSTESAENSNIV 423

Query: 320 IGFKDWSKVASNAGEANTSD--------------------PPSRDPG-EFSALNRQTSN- 357
           IG+K    V +   EA T                        +R P   F+    Q  + 
Sbjct: 424 IGYK---LVENELMEATTKKSVSRSSVAGSSSSLGGSNNMSSNRVPSTSFTMEGTQRRDY 480

Query: 358 ILRGP-------FEGSRPTSQQSSTGKDVYIYNGSDGYI-NDGSLFKSYSKPYGRDDVIG 409
           I  G         +GS    Q+     +V+ Y G DG I N     K Y+KP+GRDDVIG
Sbjct: 481 IYEGGVSAMSLNVDGSINKCQKYGFDLNVFGYCGFDGLITNSTEQSKEYAKPFGRDDVIG 540

Query: 410 CGINYVDGTIFFTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGY 469
           CGIN++DG+IFFTKNGIHLG AF D+  L+ VPYV+L+P NSI+TNFGL E+F+FDI+GY
Sbjct: 541 CGINFIDGSIFFTKNGIHLGNAFTDLNDLEFVPYVALRPGNSIKTNFGLNEDFVFDIIGY 600

Query: 470 QNHWKAKAYHNI-------FTAIXXXXXXXXXXXXXXXXXXNAGDHLDADVQMNDTNAGV 522
           Q+ WK+ AY +I        +                    N   +++ D+   D   G 
Sbjct: 601 QDKWKSLAYEHICRGRQMDVSIEEFDSDESEEDETENGPEENKSTNVNEDLMDIDQEDGA 660

Query: 523 GQDYDDINNSTLERNQQESHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLN 582
             + D     T + N ++ +   FLL  D RF  G+L +PD + INN+S  D S+P TLN
Sbjct: 661 AGNKD-----TKKLNDEKDNNLKFLLGEDNRFIDGKLVRPDVNNINNLSVDDGSLPNTLN 715

Query: 583 TMINDYLIHHGLIDVAKGFLKDLQKDCI-PNNNEERTRSVIRHHERQIKREEENLKIRQD 641
            MINDYLIH GL+DVAKGFLKDLQKD +  N     ++ VIRH+ERQI +EE  +KIRQ+
Sbjct: 716 VMINDYLIHEGLVDVAKGFLKDLQKDAVNVNGQHSESKDVIRHNERQIMKEERMVKIRQE 775

Query: 642 IRLLIKDGDIPRCIKYIDSKFPGLLTKHVELAFEFKVAEYLLAIMK---LEQVTIDYVLQ 698
           +R LI  G I +CI YID++ P LL  ++EL FE K+A YL+ I K    +   I+ ++ 
Sbjct: 776 LRYLINKGQISKCINYIDNEIPDLLKNNLELVFELKLANYLVMIKKSSSKDDDEIENLIL 835

Query: 699 KGLEISNEFIYNEKLSQELRQKFKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRL 758
           KG E+SNEFIY+ K+ Q LR +F     ++SAL+AY NPLVE PKE++ YL+  YLQ+RL
Sbjct: 836 KGQELSNEFIYDTKIPQSLRDRFSGQLSNVSALLAYSNPLVEAPKEISGYLSDEYLQERL 895

Query: 759 FQLVNTTILMFLKKKSESSLENMISYTRAMVNTLMEYGDQPGSSNS 804
           FQ+ N TIL FL K SE +LEN+IS TRAM++TL+EY +  GS+NS
Sbjct: 896 FQVSNNTILTFLHKDSECALENVISNTRAMLSTLLEY-NAFGSTNS 940

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIPNYTENGET 60
           MS +MD++D +++  LFP YLL+QP+AY+LW LY QH            +  N  EN  T
Sbjct: 1   MSEYMDDVDREFINCLFPSYLLQQPVAYDLWILYLQHRKLFHKLKNTNLI--NADEN-PT 57

Query: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHND 113
            +    TKLT  TRK IW KL  LGVLG I +++  D+YL+QVYKYFY   ND
Sbjct: 58  GVGMGRTKLTALTRKEIWSKLMNLGVLGTISFEAVNDDYLIQVYKYFYPDVND 110

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score =  460 bits (1184), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 254/621 (40%), Positives = 370/621 (59%), Gaps = 51/621 (8%)

Query: 196 FYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNWQ 255
            YPA+   K+ +K+K N    +VY+ +GY LP  W  + NNS+LVS+DG T LR NPNWQ
Sbjct: 281 LYPALNTQKYMSKKKNNSTTPNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQ 340

Query: 256 LYSGYDNSPI-VNNRLRTSV-NNQKQQWASTWANACINHKKVAIFYYEIKVLSVTSAQSG 313
            +   D   I   NRLR ++ ++QK ++ +T+A+  +++KKVAIFYYE++VL VTS++S 
Sbjct: 341 PFISNDRGDIFARNRLRNALTSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSA 400

Query: 314 QTCNINIGFK---------DWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILRGPFE 364
              NI +G+K         D  K+   A      +  + D  E   L       L G  +
Sbjct: 401 HNSNIVVGYKIANDSDDEIDLEKIDEKALLELVKNFGAGDNNELGGL-ADIGGTLMGRAD 459

Query: 365 GSR----PTSQQSSTGKDVYI-YNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTI 419
            +     P   + +T  + ++ Y G  G I+  S  K YSKPYGRDDVIGCGINYV+G++
Sbjct: 460 STATDPAPGLAKKNTLDETFVGYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSV 519

Query: 420 FFTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYH 479
           FFTKNG+ LG A   + +++ +PY++LK  NS+RTNFGLYEEF+FDI  YQ +WK  AY 
Sbjct: 520 FFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYK 579

Query: 480 NIFTAIXXXXXXXXXXXXXXXXXXNAGDHLDADVQ---MNDTNAGVGQDYDDINNSTLER 536
           NIF A                   +   H   D +   ++++   +  D D+   S L++
Sbjct: 580 NIFKA-------------------SITSHQFPDTKNTLIDESQMEIDDDADESQLSLLQK 620

Query: 537 NQQESHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLID 596
                   G +L  D R S   + KPD   +N ++  D S+   LN MINDYLIH GLID
Sbjct: 621 --------GLILGKDNRISENMVLKPDDLLLNTLNTQDGSMISNLNVMINDYLIHEGLID 672

Query: 597 VAKGFLKDLQKDCIPNNNEERT----RSVIRHHERQIKREEENLKIRQDIRLLIKDGDIP 652
           VAKGFLKDLQK  + N  + +     R +I+H+E QI REE  L+IRQ++R LI   +I 
Sbjct: 673 VAKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIE 732

Query: 653 RCIKYIDSKFPGLLTKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEK 712
           +CI +++ K P LL  +VEL FE +V +YL+ +    ++  + +++ G  +S EF++N  
Sbjct: 733 KCITFLNDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAGQNLSREFVFNNT 792

Query: 713 LSQELRQKFKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKK 772
           + QELR KF+    ++S+L+ Y++PL E P EL+ Y +P YLQDRLFQL N+TIL  +KK
Sbjct: 793 IPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKK 852

Query: 773 KSESSLENMISYTRAMVNTLM 793
            SE +L+N++SY+RAM  TL+
Sbjct: 853 SSECALDNIVSYSRAMSLTLL 873

 Score = 95.1 bits (235), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 70/113 (61%), Gaps = 1/113 (0%)

Query: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIPNYTENGET 60
           M+  +DE+D +++K+LFP YLLEQP+AY+L  +Y ++               +   NG  
Sbjct: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHS-KDEDRNGLL 59

Query: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHND 113
                  KL+Y T+K IW+KL  LGVLG + +D+A DEYLVQ YKYFY+ +N+
Sbjct: 60  TSSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNN 112

>Scas_712.23
          Length = 973

 Score =  359 bits (921), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/426 (42%), Positives = 271/426 (63%), Gaps = 53/426 (12%)

Query: 382 YNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNGIHLGTAFKDVAHLDLV 441
           Y G DG+I  G+  K YS+ +GRDD+IGCGINY+DGTIFFTKNG+ LGTAF +V  L++V
Sbjct: 560 YCGDDGFICVGTESKKYSQMFGRDDIIGCGINYIDGTIFFTKNGVFLGTAFTNVYDLNVV 619

Query: 442 PYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHNIFTAIXXXXXXXXXXXXXXXX 501
           P ++LKP NS+RTNFG+YEEF+FDI  YQN+WK K+ + IF +                 
Sbjct: 620 PSIALKPGNSVRTNFGIYEEFVFDIGNYQNNWKNKSLNKIFKS----------------- 662

Query: 502 XXNAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQESHTDGFLLSWDTRFSGGQLYK 561
                  LD D    D N             T E NQ+ S    FLL  D R     + K
Sbjct: 663 -------LDYDFDCKDGN-------------TTENNQKAS----FLLGKDDRIDDMNIKK 698

Query: 562 PDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKGFLKDLQKDCIP--------NN 613
           P+  ++N+++  +DSIP TLN MINDYL+H G++D+AK FLKDL+ DCI         N 
Sbjct: 699 PNSIRLNDLNVNNDSIPNTLNVMINDYLLHEGMVDLAKSFLKDLRNDCIEDDIGDNVGNA 758

Query: 614 NEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDSKFPGLLTKHVELA 673
           N    + VI ++++QI++EE  + IRQ+IR L+ + +I  CIK+I+ + PGLL   +EL 
Sbjct: 759 NMNDMKQVIDYNDKQIQKEETLVYIRQEIRRLVLERNIEECIKWINLQLPGLLESDMELL 818

Query: 674 FEFKVAEYLLAIMKLEQV----TIDYVLQKGLEISNEFIYNEKLSQELRQKFKAHFGDIS 729
           FE K+ +YL+ I++  +      I+ +L+ G  + N+F+YNE++   LR+ F+    ++S
Sbjct: 819 FEMKLCQYLITIIESSKTKDDKCINDLLRTGQGLYNQFVYNEQIDGALRESFQFQLNNVS 878

Query: 730 ALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLENMISYTRAMV 789
           +L+AYD+P+ E   +L++Y++  YL+ RLFQ++N+ +L FL K+S+ SLE+M+ YTRAM+
Sbjct: 879 SLLAYDDPINEVTGDLSIYVSNEYLEGRLFQIINSKVLQFLNKRSDCSLEDMVVYTRAML 938

Query: 790 NTLMEY 795
           +T+M Y
Sbjct: 939 STMMNY 944

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 70/126 (55%), Gaps = 18/126 (14%)

Query: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHXXXXXXXXXXRRVIP-NYTENGE 59
           MS + D+ID Q++K+L+P YLL QP+AYEL  LY QH            + P N  ++G 
Sbjct: 1   MSSYSDQIDRQFIKSLYPEYLLHQPIAYELKALYNQHRKLFSKLSESEHLDPSNRPKSGL 60

Query: 60  T-------ELYRRST----------KLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQ 102
           +       E YR  +          KL +  +K IW KL +LGVLG I ++SA D YL+Q
Sbjct: 61  SKGAEHFDETYRNVSIESSNTSGGDKLPFHIKKEIWHKLMELGVLGTISFESANDNYLIQ 120

Query: 103 VYKYFY 108
           VYK FY
Sbjct: 121 VYKLFY 126

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 99/209 (47%), Gaps = 40/209 (19%)

Query: 196 FYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNWQ 255
           FY      +   K K N +  D+Y  IGY LP+ W    NNS+ V++DG  NL PNPN+Q
Sbjct: 286 FYSYSGSHEKPLKLKKNGVAPDIYRIIGYFLPNQWNPPPNNSLSVTSDGVMNLAPNPNYQ 345

Query: 256 LYSGYDNS-------PIVNNRLRTSV-------NNQKQQWASTWANACINHKKVAIFYYE 301
                +++        IV NRLR ++       N  K  + +  AN  I   KV+IFYYE
Sbjct: 346 KTVTEESTTGSGTPASIVRNRLRNTITGNLQSGNRSKSDYLTACANNVIPSSKVSIFYYE 405

Query: 302 IKVLSVTSAQSGQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGE--FSAL-NRQTSNI 358
           I+VL+VTS+ + Q  NI +GFK                PPSR+     F ++ +R TSN 
Sbjct: 406 IRVLTVTSSLNAQNSNIIVGFK--------------YAPPSRESSNSVFDSIPSRPTSN- 450

Query: 359 LRGPFEGSRPTSQQSSTGKDVYIYNGSDG 387
                   R  S  SS   +  +  GS G
Sbjct: 451 --------RTRSDPSSRNNEASVRTGSRG 471

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458
           + DVIG G     GT+FFT+NG  L     G   K      L P V       I  NFG 
Sbjct: 292 KGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGT 351

Query: 459 Y 459
           Y
Sbjct: 352 Y 352

>Scas_669.10
          Length = 585

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 5/61 (8%)

Query: 404 RDDVIGCGINYVDGTIFFTKNGIH-----LGTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458
           R D+IG G     GT FFT+NG       +G   K      L P V       +  NFG 
Sbjct: 325 RGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGT 384

Query: 459 Y 459
           Y
Sbjct: 385 Y 385

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 26/63 (41%), Gaps = 5/63 (7%)

Query: 402 YGRDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNF 456
           + + DVIG G     GTIFFT NG  L     G   K      L P V       I  NF
Sbjct: 281 FEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNF 340

Query: 457 GLY 459
           G Y
Sbjct: 341 GTY 343

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 9/73 (12%)

Query: 392 GSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSL 446
            S+F  Y K     D+IG G     GT+FFT+NG  L     G   K      L P V  
Sbjct: 340 ASIFPRYQK----GDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGA 395

Query: 447 KPANSIRTNFGLY 459
                +  NFG Y
Sbjct: 396 NVPCKVHVNFGSY 408

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 6/66 (9%)

Query: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458
           + D+IG G     GT+FFT+NG  +     G   K      L P V       I  NFG 
Sbjct: 326 KGDIIGIGYRTRSGTVFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGS 385

Query: 459 YEEFLF 464
           Y  F+F
Sbjct: 386 Y-GFVF 390

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 16/83 (19%)

Query: 406 DVIGCGINYVDGTIFFTKNGIHLGTAFKDVAH---LDLVPYVSLKPANSIRTNF----GL 458
           DV+G G  Y  GTIF T NG  +     DV H   +DL  +V L   N+  T      GL
Sbjct: 289 DVVGFGYRYSSGTIFITHNGKKM----MDVTHKVGIDL--FVGLGAMNAAYTRTYTKDGL 342

Query: 459 YEEFLFDIVGYQNHW-KAKAYHN 480
           +E+   D V ++  W + +A++N
Sbjct: 343 FED--PDNVSFRQKWSELQAFNN 363

>Kwal_23.3488
          Length = 502

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458
           + DVIG G     GT+FFT+NG  L     G   K      + P V       +  NFG 
Sbjct: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGT 358

Query: 459 Y 459
           Y
Sbjct: 359 Y 359

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458
           + D++G G     GT+FFT+NG  L     G   +      L P +       I  NFG 
Sbjct: 313 KGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGT 372

Query: 459 Y 459
           Y
Sbjct: 373 Y 373

>KLLA0D01958g complement(167629..171015) similar to sp|Q01846
           Saccharomyces cerevisiae YML104c MDM1 intermediate
           filament protein singleton, start by similarity
          Length = 1128

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%)

Query: 567 INNISGTDDSIPCTLNTMINDYLIHHGLIDVAKGFLKDLQKDCIPNNNEERTRSVIRHHE 626
           + N+ GTDD   C L  +     +    I   K ++  LQ  C+PN  E  ++S  + H 
Sbjct: 308 VTNVHGTDDDYECFLKQLSCLTEVSQLNILKVKLWIDALQIRCVPNEGEVSSKSFQKKHA 367

Query: 627 RQIKREEENLKI 638
              KR E  L +
Sbjct: 368 LFNKRIELALNL 379

>Kwal_26.8997
          Length = 466

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 64  RRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLV 101
           R S  ++Y  R ++W+  +  G LG+  YDSA D Y  
Sbjct: 47  RISKTVSYKPRALLWDSRTGNGSLGMHQYDSADDFYFA 84

>Scas_721.21
          Length = 284

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 645 LIKDGDIPRCIKYIDSKFPGLLTKHVELAFEFKVAEYLLAIMKLEQVT-------IDYV 696
           L+K  ++P+ +       PG   +H++L + F   + L+ I K  ++T       IDY+
Sbjct: 167 LLKFNEVPKIVSVQPMMIPGRPLEHIQLVYRFNTRQRLIKIDKCTEMTDTVERDVIDYI 225

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,565,396
Number of extensions: 1265375
Number of successful extensions: 3615
Number of sequences better than 10.0: 24
Number of HSP's gapped: 3702
Number of HSP's successfully gapped: 31
Length of query: 808
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 698
Effective length of database: 12,788,129
Effective search space: 8926114042
Effective search space used: 8926114042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)