Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR184C21821410201e-143
KLLA0C11649g2382285323e-68
Sklu_879.22332075313e-68
YER163C2322044559e-57
Scas_576.42372054351e-53
CAGL0L11748g2362074299e-53
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR184C
         (214 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211) ...   397   e-143
KLLA0C11649g complement(1005591..1006307) similar to sp|P32656 S...   209   3e-68
Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement           209   3e-68
YER163C (YER163C) [1591] chr5 complement(503079..503777) Member ...   179   9e-57
Scas_576.4                                                            172   1e-53
CAGL0L11748g complement(1252608..1253318) similar to sp|P32656 S...   169   9e-53

>AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211)
           [657 bp, 218 aa]
          Length = 218

 Score =  397 bits (1020), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 200/214 (93%)

Query: 1   MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV 60
           MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV
Sbjct: 1   MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV 60

Query: 61  PAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVHLVAPPQPPHELRDALDAL 120
           PAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVHLVAPPQPPHELRDALDAL
Sbjct: 61  PAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVHLVAPPQPPHELRDALDAL 120

Query: 121 PCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNHGPSGPNYEYLKLLHSALH 180
           PCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNHGPSGPNYEYLKLLHSALH
Sbjct: 121 PCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNHGPSGPNYEYLKLLHSALH 180

Query: 181 SIAETFGARXXXXXXXXXXXXXXAVDRLRAQACA 214
           SIAETFGAR              AVDRLRAQACA
Sbjct: 181 SIAETFGARLCELEDHYLDELLEAVDRLRAQACA 214

>KLLA0C11649g complement(1005591..1006307) similar to sp|P32656
           Saccharomyces cerevisiae YER163c singleton, start by
           similarity
          Length = 238

 Score =  209 bits (532), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 104/228 (45%), Positives = 134/228 (58%), Gaps = 24/228 (10%)

Query: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLVP----- 61
           G WVVGYGSLIYKPPPH+  +V G+V+GF+RRFWQSS DHRGTP+ PGRVATL+P     
Sbjct: 7   GIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSIDHRGTPDSPGRVATLIPFDGIT 66

Query: 62  -------------------AADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVH 102
                                D +LL VAY+IP  H   VT +LDVRE++GY    + +H
Sbjct: 67  NNAEFEKDLRTWNSKVVAKQDDLKLLAVAYYIPPEHAQFVTEHLDVREKNGYTAHRIFIH 126

Query: 103 LVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNH 162
           L  P   P EL+  L  LP    +G  ++ S++YIG  D   F+GPE++  TA VI+HN 
Sbjct: 127 LQPPKSEPLELQALLHKLPVHETTGKHILDSLVYIGTSDNEAFIGPEDINVTAKVISHNL 186

Query: 163 GPSGPNYEYLKLLHSALHSIAETFGARXXXXXXXXXXXXXXAVDRLRA 210
           GPSGPNYEYLKLLH +L  +A+  G                  ++LR+
Sbjct: 187 GPSGPNYEYLKLLHDSLTEMADELGQSLEEIEDSYLDSLLKQTEQLRS 234

>Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement
          Length = 233

 Score =  209 bits (531), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 133/207 (64%), Gaps = 24/207 (11%)

Query: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV------ 60
           G WV+GYGSLIYKPPPHY  R+ G+++GF+RRFWQSSSDHRGTP+ PGRVATL+      
Sbjct: 6   GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIAYDDIV 65

Query: 61  ------------------PAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVH 102
                              A D  +  VAY+IP  +   VT YL+VREQDGY    V +H
Sbjct: 66  KHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVHCVEIH 125

Query: 103 LVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNH 162
           L        ELRD+L  LP   ++   V++S++YIG  D  +FVGPE+++ TA++IA +H
Sbjct: 126 LETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASIIADSH 185

Query: 163 GPSGPNYEYLKLLHSALHSIAETFGAR 189
           GPSGPNYEYLKLLH +L  +A + G +
Sbjct: 186 GPSGPNYEYLKLLHDSLTEVACSLGHK 212

>YER163C (YER163C) [1591] chr5 complement(503079..503777) Member of
           the ChaC-like protein family, has moderate similarity to
           uncharacterized C. albicans Orf6.7p [699 bp, 232 aa]
          Length = 232

 Score =  179 bits (455), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 117/204 (57%), Gaps = 25/204 (12%)

Query: 1   MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV 60
           M   + G WV+GYGSLIYKPP HY+ R+  ++HGF RRFWQSS+DHRGTP  PGRVATL+
Sbjct: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60

Query: 61  PAADA-------------------------RLLVVAYFIPAAHVAAVTAYLDVREQDGYL 95
           P  D                            + V Y+IP  H   V  YL+VREQ+GY 
Sbjct: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120

Query: 96  PQTVPVHLVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTA 155
              V VHL    +   EL +AL+ LP  + SG  V+ + +YIG  D   FVGPE +  TA
Sbjct: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180

Query: 156 AVIAHNHGPSGPNYEYLKLLHSAL 179
            VIA +HGPSG NYEYL  L  AL
Sbjct: 181 KVIAVSHGPSGSNYEYLAKLEQAL 204

>Scas_576.4
          Length = 237

 Score =  172 bits (435), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 114/205 (55%), Gaps = 26/205 (12%)

Query: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLVP----- 61
           G WV+GYGSLIYKPPPHY  R+   ++GF RRFWQSS DHRGTP+ PGRV TL+P     
Sbjct: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70

Query: 62  ---------------------AADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVP 100
                                A D   L V Y+IP      V  YLDVREQ+GY    V 
Sbjct: 71  SRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEVE 130

Query: 101 VHLVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAH 160
           VHL    +    L+  L  LP  + +   ++++ +YIG      FVGPE +  TA VI+ 
Sbjct: 131 VHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIST 190

Query: 161 NHGPSGPNYEYLKLLHSALHSIAET 185
           + GPSGPN EYLKLLH ++  +++ 
Sbjct: 191 SRGPSGPNIEYLKLLHDSIEFMSDN 215

>CAGL0L11748g complement(1252608..1253318) similar to sp|P32656
           Saccharomyces cerevisiae YER163c, start by similarity
          Length = 236

 Score =  169 bits (429), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 116/207 (56%), Gaps = 30/207 (14%)

Query: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLVPA---- 62
           G WV+GYGSLIYKPPPHY+ R+  V++GF RRFWQSS DHRGTP+ PGRV TL+P     
Sbjct: 7   GIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLIPHDEIM 66

Query: 63  ------------------------ADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQT 98
                                    D   + V Y+IPA     V  YLDVREQ+GY    
Sbjct: 67  KTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQNGYTLHE 126

Query: 99  VPVHL--VAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAA 156
           V VHL          EL  A+  LP    +G  V+ + +YIG      FVGPE +++TA+
Sbjct: 127 VEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPETIEQTAS 186

Query: 157 VIAHNHGPSGPNYEYLKLLHSALHSIA 183
           VIA N GPSG N++YL++L  ++ S+ 
Sbjct: 187 VIATNVGPSGTNFDYLRMLCESMASMK 213

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,665,091
Number of extensions: 258673
Number of successful extensions: 499
Number of sequences better than 10.0: 7
Number of HSP's gapped: 494
Number of HSP's successfully gapped: 7
Length of query: 214
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 117
Effective length of database: 13,238,163
Effective search space: 1548865071
Effective search space used: 1548865071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)