Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR049W71770328290.0
Scas_697.176941933912e-39
KLLA0E23056g8181933843e-38
YHR131C8401943792e-37
Kwal_33.146297192013663e-36
CAGL0G06182g6811933592e-35
YNL144C7401893311e-31
Scas_654.225802052657e-24
CAGL0J05830g6072401614e-11
KLLA0A08206g230168820.064
YDL164C (CDC9)755115721.4
ACR060W668169693.0
ADR126C69173684.6
Sklu_2342.669271684.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR049W
         (703 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...  1094   0.0  
Scas_697.17                                                           155   2e-39
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   152   3e-38
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   150   2e-37
Kwal_33.14629                                                         145   3e-36
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   142   2e-35
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   132   1e-31
Scas_654.22                                                           106   7e-24
CAGL0J05830g complement(552107..553930) some similarities with s...    67   4e-11
KLLA0A08206g 730940..731632 no similarity, hypothetical start          36   0.064
YDL164C (CDC9) [707] chr4 complement(164988..167255) DNA ligase,...    32   1.4  
ACR060W [1108] [Homologous to ScYJL041W (NSP1) - SH] complement(...    31   3.0  
ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C (...    31   4.6  
Sklu_2342.6 YGR266W, Contig c2342 8964-11042 reverse complement        31   4.9  

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/703 (79%), Positives = 561/703 (79%)

Query: 1   MSQPEVYARLYEARGLGFKEAALPXXXXXXXXXXXXXXXYDSRSHGSLPQSGEVESGELH 60
           MSQPEVYARLYEARGLGFKEAALP               YDSRSHGSLPQSGEVESGELH
Sbjct: 1   MSQPEVYARLYEARGLGFKEAALPSSVSTSSVDGVTTLSYDSRSHGSLPQSGEVESGELH 60

Query: 61  ADVLAVLXXXXXXXXXXXXVNPNXXXXXXXXXXXXTNELPAYAPAVHELALVSVKQEWAS 120
           ADVLAVL            VNPN            TNELPAYAPAVHELALVSVKQEWAS
Sbjct: 61  ADVLAVLQPQPARPPPYYAVNPNRRIRYPIYEREETNELPAYAPAVHELALVSVKQEWAS 120

Query: 121 PYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSFGQV 180
           PYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSFGQV
Sbjct: 121 PYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSFGQV 180

Query: 181 KAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDYTKR 240
           KAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDYTKR
Sbjct: 181 KAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDYTKR 240

Query: 241 SFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXXXXXDLDHRKMPAYXXXXXXXXXXXX 300
           SFVLRLRCETEQFLVCFGTVDM                DLDHRKMPAY            
Sbjct: 241 SFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAYRTVPRRRRRRTR 300

Query: 301 XXXXXXXXXNTALLFSNKLSRRGTVLGLISPSVDRRTLLKYDQPAMGAGGFSNAFIAMAT 360
                    NTALLFSNKLSRRGTVLGLISPSVDRRTLLKYDQPAMGAGGFSNAFIAMAT
Sbjct: 301 HKRTDNRGRNTALLFSNKLSRRGTVLGLISPSVDRRTLLKYDQPAMGAGGFSNAFIAMAT 360

Query: 361 RAPENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGL 420
           RAPENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGL
Sbjct: 361 RAPENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGL 420

Query: 421 NSSVAESLLGPSASLGARGSEALRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSS 480
           NSSVAESLLGPSASLGARGSEALRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSS
Sbjct: 421 NSSVAESLLGPSASLGARGSEALRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSS 480

Query: 481 SLESHRQPTPNRSLGSVCEQSRSPTPSGIEHSPVESEEFDFVETGASSESELLPSDHLET 540
           SLESHRQPTPNRSLGSVCEQSRSPTPSGIEHSPVESEEFDFVETGASSESELLPSDHLET
Sbjct: 481 SLESHRQPTPNRSLGSVCEQSRSPTPSGIEHSPVESEEFDFVETGASSESELLPSDHLET 540

Query: 541 SIYEDEGIYHSXXXXXXXXXXXXXXXGAGSXXXXXXXXXXXXRSRALDMEFRQRAHSAAS 600
           SIYEDEGIYHS               GAGS            RSRALDMEFRQRAHSAAS
Sbjct: 541 SIYEDEGIYHSDDDDDDDDDDDDDDDGAGSAAADTATQDYAARSRALDMEFRQRAHSAAS 600

Query: 601 SLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVVXXXXXXXXX 660
           SLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVV         
Sbjct: 601 SLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVVSPSAGPGSS 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRAARFMKAYIVG 703
                                         TRAARFMKAYIVG
Sbjct: 661 SSGFPFDLGLGSKRLGSRRSLKRGSQSLSGTRAARFMKAYIVG 703

>Scas_697.17
          Length = 694

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/193 (41%), Positives = 117/193 (60%), Gaps = 12/193 (6%)

Query: 97  NELP-AYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGL 155
           NELP +Y PAV EL +VS+K EW SPY+ +  R+W+ L+ME+NSTQLNFYH+DE L   +
Sbjct: 125 NELPPSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHI 184

Query: 156 RGRAADSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHL 215
           R  + DS+     ++  S+ SFG           R   + +   Q+ +  R +R+ + +L
Sbjct: 185 RNYSNDSSSSSP-SKQRSTFSFG----------NRTTYEFNKNDQEQIAFRIKRNKKLYL 233

Query: 216 CAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXX 275
             ++LYKSYSLQ+A FG+P+DY K+++VLRLRCE+EQFL+ F  VD              
Sbjct: 234 SNDKLYKSYSLQFAKFGLPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGIS 293

Query: 276 XXXDLDHRKMPAY 288
              DL+ R +P Y
Sbjct: 294 VALDLELRALPDY 306

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 591 FRQRAHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           +R+R  S  S++S  PY  S    KW PP+K + RR+++R+S+RCI P  ++  W+  +V
Sbjct: 558 YRRRTSSLISTMSSVPY--SSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIV 615

Query: 651 V 651
           V
Sbjct: 616 V 616

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  152 bits (384), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 110/193 (56%), Gaps = 7/193 (3%)

Query: 97  NELPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLR 156
           N LP Y+PAV  + ++S+KQEW +PYE + SR+W+  +ME+NSTQLNFYH+ E L   ++
Sbjct: 159 NVLPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIK 218

Query: 157 GRAADSTLGVACAQAVSSLSFGQVKAGTLLAL-GRDERQLSPAHQQHVCARAQRDPERHL 215
                 T         + L+  +     L +L  +   Q + + QQ +    Q + +++L
Sbjct: 219 NYYGGPT------NFPNDLNSSKQSTRFLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYL 272

Query: 216 CAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXX 275
             + L+KS+SLQY  FG+P DYTK++FVLRLRCE +QFL+ F  VD              
Sbjct: 273 SNDMLFKSFSLQYGKFGIPTDYTKKTFVLRLRCELQQFLINFAHVDDMIDWSVSLSIGID 332

Query: 276 XXXDLDHRKMPAY 288
              DL +R+MP Y
Sbjct: 333 VSLDLAYREMPTY 345

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 59/133 (44%), Gaps = 34/133 (25%)

Query: 522 VETGASSESELLPSDHLET---SIYEDEGIYHSXXXXXXXXXXXXXXXGAGSXXXXXXXX 578
            ET ASS    LP+ H  +   SIY +EGI+H                            
Sbjct: 648 TETAASSNE--LPTRHARSAASSIYHEEGIFHDSDDDYIYVPTEI--------------- 690

Query: 579 XXXXRSRALDMEFRQRAHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRP 638
                        R+R  S  S+LS  PYG      KW PP KE TRRR++RDS+RCI+P
Sbjct: 691 ------------HRRRTSSITSNLSNTPYG--GDEMKWNPPRKEITRRRYIRDSLRCIKP 736

Query: 639 LCDDDTWLGALVV 651
           L  D++W+  + +
Sbjct: 737 LGFDESWVNKIAL 749

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  150 bits (379), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/194 (41%), Positives = 110/194 (56%), Gaps = 5/194 (2%)

Query: 100 PAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRA 159
           P YAPAV+EL L+S+K E  SPYE + +RSWR  ++E+NSTQLNFYH+DE L + +R  +
Sbjct: 114 PLYAPAVYELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYS 173

Query: 160 ADSTLGVACAQAVSSLSF----GQVKAGTLLAL-GRDERQLSPAHQQHVCARAQRDPERH 214
           +  T      +  S L       Q     L  L  R   +   A Q+ +  R +RD  R+
Sbjct: 174 SGETKSEKEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRY 233

Query: 215 LCAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXX 274
           L  E LYKS++LQ A FG+P DYTK+SFVLR+ CE+EQFL+ F  +D             
Sbjct: 234 LTDEALYKSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGI 293

Query: 275 XXXXDLDHRKMPAY 288
               DL+ R+ P Y
Sbjct: 294 SVSLDLEVREYPDY 307

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 595 AHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           A S  S  S  PYG      KW P +KE +RRR++RDS++CI+P  D +  LG ++
Sbjct: 675 ASSTLSCFSNIPYGTD--DIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVI 728

>Kwal_33.14629
          Length = 719

 Score =  145 bits (366), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 110/201 (54%), Gaps = 23/201 (11%)

Query: 99  LPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLR-- 156
           LP Y+PAV  + +VS+K EW  PY  + SRSW+  +ME+NSTQLNFY +D  L RG++  
Sbjct: 110 LPGYSPAVEAITVVSMKLEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNY 169

Query: 157 --------GRAADSTLGVACAQAV-SSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARA 207
                   G   D +L      ++ SSLS             ++  Q + A Q+ +  + 
Sbjct: 170 CNGKSHFGGEHLDPSLEYESHHSIFSSLS------------SKNTYQFNKADQECISKKI 217

Query: 208 QRDPERHLCAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXX 267
             +  ++L   +L++SYSLQ+A +G+P DY +++FVLR+RCETEQF++ F  VD      
Sbjct: 218 SNNKSKYLTDNKLFRSYSLQFAKYGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWN 277

Query: 268 XXXXXXXXXXXDLDHRKMPAY 288
                      DLD R++P Y
Sbjct: 278 MYLSIGIGVSLDLDFRELPTY 298

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 27/112 (24%)

Query: 540 TSIYEDEGIYHSXXXXXXXXXXXXXXXGAGSXXXXXXXXXXXXRSRALDMEFRQRAHSAA 599
           TSIY++EGI+H                                R+ A    FR+RA S  
Sbjct: 566 TSIYQEEGIFHDSEDDYYYVVD---------------------RNDA----FRRRASSVT 600

Query: 600 SSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVV 651
           S+LS  PYG      KW PP KE +RRR++RDS+RCI+PL D++ WLG +++
Sbjct: 601 SNLSSTPYGSG--DVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLI 650

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 108/193 (55%), Gaps = 5/193 (2%)

Query: 96  TNELPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGL 155
           T + PAY P V+ +A+VSVK EW SP+EP+ +RSWRT +ME+NSTQ+NFY ++    R +
Sbjct: 88  TEKPPAYHPTVYNVAIVSVKLEWLSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLV 147

Query: 156 RGRAADSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHL 215
           +     +   +       SL+ G +  G       ++   +  H + + A+ +R+  ++L
Sbjct: 148 K-----NYYNLKYDDGAKSLAKGILSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYL 202

Query: 216 CAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXX 275
              RLY+S++LQYA  G+P DY K +  LRLRCE EQFLV F  VD              
Sbjct: 203 SDARLYRSFTLQYARMGIPTDYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGIS 262

Query: 276 XXXDLDHRKMPAY 288
              DLD R++P Y
Sbjct: 263 VALDLDCRQLPNY 275

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 27/36 (75%)

Query: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           KW+PP K  +RRR+V+DS+RCI+   +  +W+G +V
Sbjct: 564 KWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVV 599

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  132 bits (331), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 97/189 (51%)

Query: 100 PAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRA 159
           P+Y P+V    +VS+K E  SP+E A SR W   ++++NSTQ+NFY +D+ L R ++   
Sbjct: 129 PSYTPSVEHYTVVSMKMEKLSPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYR 188

Query: 160 ADSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAER 219
                  +     +S      ++       +   Q     ++ +C    RD  + L  ER
Sbjct: 189 GGDMFDHSHHSKTASDRHHSARSLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDER 248

Query: 220 LYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXXXXXD 279
           L+KSYSLQ A  G+P+DY+ R FVLR+RCE +QFLV F  VD                 D
Sbjct: 249 LFKSYSLQCAKVGLPIDYSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLD 308

Query: 280 LDHRKMPAY 288
           L+ R+MP Y
Sbjct: 309 LELREMPTY 317

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 27/36 (75%)

Query: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           KW P  +  +R+R+++DS+RCI+PL +D  W+G ++
Sbjct: 640 KWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKII 675

>Scas_654.22
          Length = 580

 Score =  106 bits (265), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 95/205 (46%), Gaps = 34/205 (16%)

Query: 100 PAYAPAVHELALVSVKQEWASPYEPA--VSRSWRTLLMELNSTQLNFYHVDEGLLRGLRG 157
           P+Y+PAV E+ LVS+K EW SP  P    ++ W+ +LME+NSTQLNFY VD         
Sbjct: 131 PSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVD--------- 181

Query: 158 RAADSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQ------LSPAHQQHVCARAQRDP 211
                    A  Q+    + G  K  TL  +  +  +       + +  + +C   +R+ 
Sbjct: 182 ---------ALLQSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNK 232

Query: 212 ERHLCAERLYKSYSLQYATFGVPMDYTKRS--------FVLRLRCETEQFLVCFGTVDMX 263
            ++L    L KSYSLQ+   G P D + ++          LRLRCE +QFL+ F  +D  
Sbjct: 233 SKYLHDANLVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSL 292

Query: 264 XXXXXXXXXXXXXXXDLDHRKMPAY 288
                          DL  R++P Y
Sbjct: 293 IMSAVHIDMGISVSLDLQIRELPTY 317

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 28/36 (77%)

Query: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           KW P  K+++RRR+VRDS+RCI+ + ++  W+G +V
Sbjct: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVV 518

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 92/240 (38%), Gaps = 54/240 (22%)

Query: 98  ELPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRG 157
           ELP Y+PAV +      K EW SP + +    W  +++ +NSTQLN Y     L R  + 
Sbjct: 39  ELPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLY-----LPRCPKS 93

Query: 158 RAADSTLGVACAQ----AVSSLS--FGQVKAGTLLALGRDERQLSPA---------HQQH 202
           R A  +L    A+     V  LS  F + K   L A    +   +PA          Q  
Sbjct: 94  RPASKSLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDA 153

Query: 203 VCARAQRDPE---------RHLCAERL-----------YKSYSLQYATFGVPMDYTKRS- 241
           + AR +R  +            C+E             +KSYSLQ A  G+P   +++  
Sbjct: 154 LGARKKRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKV 213

Query: 242 -------------FVLRLRCETEQFLVCFGTVDMXXXXXXXXXXXXXXXXDLDHRKMPAY 288
                          LRLR E +QFLV F  +D                 DL  R+ P Y
Sbjct: 214 YIDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNY 273

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALV 650
           KW P  KE TR+R++R S+RCIRPL  D  W G  +
Sbjct: 538 KWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETI 573

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 36.2 bits (82), Expect = 0.064,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 69/168 (41%), Gaps = 31/168 (18%)

Query: 99  LPAYAPAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGR 158
           LP Y P++    L+  + E         S  W    +E+NSTQL        L+R L   
Sbjct: 39  LPPYTPSLQISFLLQTQFEH--------SHRWTPHCVEINSTQL--------LIRPLI-H 81

Query: 159 AADSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLS---PAHQQHV--CARA----QR 209
           + D  L       +  L + Q KA +   L  D+   S   P  + H+  C       ++
Sbjct: 82  SHDEKLINKWYSKLDELEYKQYKATSNHQLCHDQLVQSTQVPNQRDHIVLCTAKGLYLEK 141

Query: 210 DPERHLCA--ERLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLV 255
           D   +L        K YSLQ    G+  D ++    LR+RCE EQFL+
Sbjct: 142 DKSLNLIQWNRDPIKKYSLQDCRIGLNTDMSR---CLRIRCEREQFLL 186

>YDL164C (CDC9) [707] chr4 complement(164988..167255) DNA ligase,
           functions in DNA replication and repair in both the
           nucleus and mitochondrion [2268 bp, 755 aa]
          Length = 755

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 383 GELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEA 442
           GE+  G  +   TMF  K  + GEV ++    + T+G +S + +  L        +G EA
Sbjct: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEA 299

Query: 443 ----------LRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSSSLESHRQ 487
                     LR  L+E+ V  S S +LL   E R  + +  +  D   LES +Q
Sbjct: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMD--VLESAQQ 352

>ACR060W [1108] [Homologous to ScYJL041W (NSP1) - SH]
           complement(463771..463771,463861..465866) [2007 bp, 668
           aa]
          Length = 668

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 63/169 (37%), Gaps = 25/169 (14%)

Query: 340 KYDQPAMGAGGFSNAFIAMATRAPENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWS 399
           K D PA  A  F    I     APE ++     A S G S+ +GE               
Sbjct: 210 KKDSPAKSASPFG---ITPPAAAPEQKKADSTPAFSFGSSTTSGE--------------- 251

Query: 400 KKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEALRCRLSERCVYQSASSS 459
               + +   + ++  +   +N  V E    P+ S G   S+ ++   + +  +    S 
Sbjct: 252 ----QNKTTNAPSLFGNAAPVN--VKEEAPKPAFSFGNASSQPVKKETTPKNAFSFGESK 305

Query: 460 LLQVSEQRAAAHE-DQMGSDSSSLESHRQPTPNRSLGSVCEQSRSPTPS 507
           +    E  A+      MGS  ++ +S   P P  S G+  +   +P PS
Sbjct: 306 VTATKEGDASKPTLSFMGSTKTNTQSEDAPKPAFSFGASAKTGETPKPS 354

>ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C
           (STB2) - SH] (929234..931309) [2076 bp, 691 aa]
          Length = 691

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 96  TNELPAYAPAVHELALV-SVKQEWASPYEPAVSRSWR-TLLMELNSTQLNFYHVDEGLLR 153
           T + P+  P    ++LV  V  EW+ P+EPAV R  R TL +E  + Q   Y  DE L  
Sbjct: 484 TPQPPSNRPRSASMSLVEDVFNEWSMPFEPAVVRLARDTLKVEALAAQKQPY--DEDLAA 541

Query: 154 GLRGRAADSTLGV 166
            L  R  D T  V
Sbjct: 542 VLEKRIDDLTAAV 554

>Sklu_2342.6 YGR266W, Contig c2342 8964-11042 reverse complement
          Length = 692

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 364 ENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGLNSS 423
           +++ + CDDA+      ++GEL  G   RL  + +SK   RG +    T  S      S 
Sbjct: 17  QSKVVNCDDASITSPVGSSGELICGPLLRLIGVDYSKNEYRGSMMIVSTNAS------SP 70

Query: 424 VAESLLGPSAS 434
           V + L GPS+S
Sbjct: 71  VVKYLTGPSSS 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,396,449
Number of extensions: 555955
Number of successful extensions: 1920
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1782
Number of HSP's successfully gapped: 79
Length of query: 703
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 594
Effective length of database: 12,822,747
Effective search space: 7616711718
Effective search space used: 7616711718
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)