Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR044C1261244592e-60
Kwal_33.146121291203101e-37
Sklu_1881.41301283051e-36
KLLA0F27907g1501052303e-25
CAGL0G06094g1381292094e-22
Scas_697.15142941833e-18
YHR132W-A1311081799e-18
YNL157W168881541e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR044C
         (124 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   181   2e-60
Kwal_33.14612                                                         124   1e-37
Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      122   1e-36
KLLA0F27907g complement(2581760..2582212) some similarities with...    93   3e-25
CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...    85   4e-22
Scas_697.15                                                            75   3e-18
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...    74   9e-18
YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...    64   1e-13

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
           (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  181 bits (459), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 96/124 (77%)

Query: 1   MSKSPSPTNSTLADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYA 60
           MSKSPSPTNSTLADTGDVDLSALTPQE                FKHKLHERKYFDSGDYA
Sbjct: 1   MSKSPSPTNSTLADTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSGDYA 60

Query: 61  LSKAGVKSEDLGSAAVGSSHLPVTNPSGLXXXXXXXXXXXXAGGLDSQNLNRQSSISSGP 120
           LSKAGVKSEDLGSAAVGSSHLPVTNPSGL            AGGLDSQNLNRQSSISSGP
Sbjct: 61  LSKAGVKSEDLGSAAVGSSHLPVTNPSGLRESIIRRRMSSSAGGLDSQNLNRQSSISSGP 120

Query: 121 PRSP 124
           PRSP
Sbjct: 121 PRSP 124

>Kwal_33.14612
          Length = 129

 Score =  124 bits (310), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/120 (55%), Positives = 78/120 (65%), Gaps = 1/120 (0%)

Query: 6   SPTNSTLADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYALSKAG 65
           SPT+S++     VD S +TPQE                FKHKL ERKYFDSGDYAL+KAG
Sbjct: 8   SPTSSSVNLNEKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYALNKAG 67

Query: 66  VKSEDLGSAAVGSSHLPVTNPSGLXXXXXXXXXXXXAGGLDSQNLNRQSSISSG-PPRSP 124
           VKS+DL S ++G+SHLPVTNPSGL            AGG+D+Q L RQ SISSG PPRSP
Sbjct: 68  VKSDDLQSDSIGNSHLPVTNPSGLRESIIKRRLSSSAGGMDAQELRRQGSISSGPPPRSP 127

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  122 bits (305), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 79/128 (61%), Gaps = 4/128 (3%)

Query: 1   MSKSPSPTNSTLADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYA 60
           M+   SPT+S +     VD S LTPQE                FKHKL ERKYFDSGDYA
Sbjct: 1   MNNDISPTSSNIDLKNPVDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYA 60

Query: 61  LSKAGVKSEDLGSAAVGSSHLPVTNPSGLXXXXXXXXXXXXAGGLD---SQNLNRQSSIS 117
           LSKAGVKS+DL S ++GSSHLPVTNPSGL            AG +D   SQ LNRQ SIS
Sbjct: 61  LSKAGVKSDDLQSDSIGSSHLPVTNPSGLRESIIRRRMSSSAGSVDAAASQQLNRQGSIS 120

Query: 118 SG-PPRSP 124
           SG PPRSP
Sbjct: 121 SGPPPRSP 128

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score = 93.2 bits (230), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 12  LADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYALSKAGVKSEDL 71
           +A+  +VDLS L+PQE                F+HKL ERKYFDSGDYAL +AGVKS+DL
Sbjct: 31  VANPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDL 90

Query: 72  GSAAVGSSHLPVTNPSGLXXXXXXXXXXXXAGG---LDSQNLNRQ 113
            S+ V +++LP+TNPSGL            A G   +D+Q LNRQ
Sbjct: 91  QSSPVANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRLNRQ 135

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score = 85.1 bits (209), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 70/129 (54%), Gaps = 12/129 (9%)

Query: 4   SPSPTNSTL------ADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSG 57
           S SPTNS L       D   VD+S L+ QE                FKH++  RKYFDSG
Sbjct: 12  SISPTNSELELDKHGVDKNGVDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSG 71

Query: 58  DYALSKAGV-KSEDLGSAAVGSSHLPVTNPSGLXXXXXXXXXXXXAGGLDSQNLNRQSSI 116
           DYAL KAGV +S+D+      S++LPVTNPSGL            AG     +++RQ SI
Sbjct: 72  DYALKKAGVIRSDDVIDENNSSNNLPVTNPSGLRESIIRRRMSSSAG----DHVSRQDSI 127

Query: 117 SSG-PPRSP 124
           SSG PPRSP
Sbjct: 128 SSGPPPRSP 136

>Scas_697.15
          Length = 142

 Score = 75.1 bits (183), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 53/94 (56%), Gaps = 10/94 (10%)

Query: 6   SPTNS-----TLADTGD-----VDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFD 55
           SPT S      LA T D     VDLS LTPQE                 KHK+ ERKYFD
Sbjct: 7   SPTTSRVDLKNLAHTKDKDGNMVDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQERKYFD 66

Query: 56  SGDYALSKAGVKSEDLGSAAVGSSHLPVTNPSGL 89
           SGDYAL KAGV  +D   ++  S+++PVTNPSGL
Sbjct: 67  SGDYALRKAGVIKKDDVMSSNSSNNMPVTNPSGL 100

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
           cAMP-regulated phosphoprotein or endosulfine conserved
           region containing family, has high similarity to
           uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score = 73.6 bits (179), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 59/108 (54%), Gaps = 4/108 (3%)

Query: 18  VDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYALSKAGVKSEDLGSAAVG 77
           VDLS L+PQE                 +HK+ +R+YFDSGDYAL KAGV   D       
Sbjct: 25  VDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYFDSGDYALKKAGVIKSDDVIVNNS 84

Query: 78  SSHLPVTNPSGLXXXXXXXXXXXXAGGLDSQNLNRQSSISSG-PPRSP 124
           S++LPVTNPSGL            +G     +++RQ SISSG PPRSP
Sbjct: 85  SNNLPVTNPSGLRESIIRRRMSSSSG---GDSISRQGSISSGPPPRSP 129

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
          similarity to Yhr132w-ap and with weak similarity to
          human ENSA alpha-endosulfine and human ARPP-19
          cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score = 63.9 bits (154), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 2  SKSPSPTNSTLADTGDVDLSALTPQEXXXXXXXXXXXXXXXXFKHKLHERKYFDSGDYAL 61
          S +P  T     ++G +D S  +P E                FKH + +RKYFDSGDYAL
Sbjct: 10 SSNPDLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYAL 69

Query: 62 SKAGVKSEDLGSAAVGSSHLPVTNPSGL 89
           KAG+++ D      G ++LP+TNPS L
Sbjct: 70 QKAGIQNND--PINYGKNNLPLTNPSKL 95

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.124    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,224,578
Number of extensions: 91517
Number of successful extensions: 104
Number of sequences better than 10.0: 10
Number of HSP's gapped: 91
Number of HSP's successfully gapped: 10
Length of query: 124
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 35
Effective length of database: 13,515,107
Effective search space: 473028745
Effective search space used: 473028745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 55 (25.8 bits)