Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR043W27124612870.0
Sklu_1881.32542347172e-95
KLLA0F27885g2562416374e-83
Kwal_33.146072612246158e-80
YNL156C2992635841e-74
CAGL0J05918g3232955122e-63
YHR133C2912493814e-44
Scas_697.14*2942413031e-32
Scas_654.19*2021981202e-07
Kwal_14.1443117038740.27
Scas_530.5909149700.75
CAGL0E06336g25457680.97
AAR098W40380671.5
YNL169C (PSD1)500125671.6
KLLA0C17534g100597662.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR043W
         (266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH] co...   500   0.0  
Sklu_1881.3 YNL156C, Contig c1881 3706-4470                           280   2e-95
KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces...   249   4e-83
Kwal_33.14607                                                         241   8e-80
YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protei...   229   1e-74
CAGL0J05918g complement(558615..559586) similar to sp|P53898 Sac...   201   2e-63
YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein...   151   4e-44
Scas_697.14*                                                          121   1e-32
Scas_654.19*                                                           51   2e-07
Kwal_14.1443                                                           33   0.27 
Scas_530.5                                                             32   0.75 
CAGL0E06336g 636975..637739 similar to sp|P36057 Saccharomyces c...    31   0.97 
AAR098W [284] [Homologous to ScYPR118W - SH] complement(518095.....    30   1.5  
YNL169C (PSD1) [4427] chr14 complement(316169..317671) Phosphati...    30   1.6  
KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomy...    30   2.4  

>AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH]
           complement(511018..511833) [816 bp, 271 aa]
          Length = 271

 Score =  500 bits (1287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MSKKKHEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAK 60
           MSKKKHEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAK
Sbjct: 1   MSKKKHEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAK 60

Query: 61  KSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDF 120
           KSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDF
Sbjct: 61  KSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDF 120

Query: 121 TSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSI 180
           TSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSI
Sbjct: 121 TSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSI 180

Query: 181 NAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEE 240
           NAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEE
Sbjct: 181 NAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEE 240

Query: 241 ITDFSQ 246
           ITDFSQ
Sbjct: 241 ITDFSQ 246

>Sklu_1881.3 YNL156C, Contig c1881 3706-4470
          Length = 254

 Score =  280 bits (717), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 181/234 (77%), Gaps = 7/234 (2%)

Query: 13  RAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGS 72
           R   K G+ +  + S +S++ LTKPQLFG+YDEEIV+SED EIYEEAKKSAG++      
Sbjct: 3   RKKSKAGNEL--SNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKL----TP 56

Query: 73  VGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLC 132
            G   R R+  QK +HL+ S ++LG++GIAYH+LSRNLHDN  LH +  S+PL+LGV+L 
Sbjct: 57  AGVMER-RSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLS 115

Query: 133 QQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSINAMLGVSFGIRR 192
           Q+LSFGM+PTWA Y++EGILFGSLLP VD+ R       + S V+R+INAMLGV FGIR+
Sbjct: 116 QKLSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFGIRK 175

Query: 193 VEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDFSQ 246
           +EWSSSLQASGAWFLL+ ILW+FFDG+ S+ L+G A+G  T +TCY+++T++SQ
Sbjct: 176 IEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQ 229

>KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces
           cerevisiae YNL156c, start by similarity
          Length = 256

 Score =  249 bits (637), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 129/241 (53%), Positives = 170/241 (70%), Gaps = 14/241 (5%)

Query: 8   EECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKK-SAGRM 66
           E      G K GS       ++S ++LTKP L+G+YD ++++SED+EIYEE KK S+G+ 
Sbjct: 3   ESASNSTGSKYGS-------SESSNLLTKPALYGLYDADVLKSEDSEIYEEVKKASSGKE 55

Query: 67  LDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLV 126
           L++    G   R + +    +++  + V+L I+GIAYH+LS+NLHDN  LH DFTSRPL+
Sbjct: 56  LEN----GIVQRAK-KIPSSVNVALAWVVLSIAGIAYHELSKNLHDNHELHNDFTSRPLL 110

Query: 127 LGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDY-WRRISVGKVNLSGVLRSINAMLG 185
           LG  + Q LSFG LP W  YA+EGILFGS++P V++           +S VLRS NAMLG
Sbjct: 111 LGATIAQSLSFGYLPPWTFYAIEGILFGSIVPFVNWILGTFDRQPTTISSVLRSTNAMLG 170

Query: 186 VSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDFS 245
           VSFGIRR+EWSSSLQASGAWFLL+ ILWLFFD SF++   G A+GLVT VTCY++ITD +
Sbjct: 171 VSFGIRRIEWSSSLQASGAWFLLNIILWLFFDSSFTMLASGLAIGLVTCVTCYQDITDSA 230

Query: 246 Q 246
           Q
Sbjct: 231 Q 231

>Kwal_33.14607
          Length = 261

 Score =  241 bits (615), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 162/224 (72%), Gaps = 5/224 (2%)

Query: 25  AASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGSVGARSRVRTRS- 83
           + S +S+S LT+PQL+GIYD +I  SED E YE+AKKS G+  D+   V  +S+ R RS 
Sbjct: 14  STSNESISNLTRPQLYGIYDADITHSEDAEAYEQAKKSVGKFPDE---VLNKSKHRHRSW 70

Query: 84  -QKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPT 142
            QK  HL+ SL +LG++GI+Y++LS+ LHDN  LH +F SRPL LGV++C+ LSFG++P 
Sbjct: 71  FQKGTHLLFSLCVLGVAGISYNELSKQLHDNHELHAEFASRPLALGVEICRTLSFGVVPG 130

Query: 143 WAGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSINAMLGVSFGIRRVEWSSSLQAS 202
           W  YA+EG+LFG+ LP +D      +     +  LRS +AMLGV+FGIR+++WSSSLQAS
Sbjct: 131 WMAYALEGVLFGAFLPLLDTLWGGPMKTTTFTSFLRSTHAMLGVAFGIRKIQWSSSLQAS 190

Query: 203 GAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDFSQ 246
           GAWFLL+ +LWLFFDG+ S  L    +G + +VT Y ++T+FSQ
Sbjct: 191 GAWFLLNIVLWLFFDGTPSTLLGCLGIGTIASVTSYRDVTEFSQ 234

>YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protein
           of unknown function, has moderate similarity to
           uncharacterized S. cerevisiae Yhr133p [900 bp, 299 aa]
          Length = 299

 Score =  229 bits (584), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 120/263 (45%), Positives = 164/263 (62%), Gaps = 43/263 (16%)

Query: 27  STDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAG---------RMLDDMGSVGAR- 76
           ST+S+  LTKPQL+ +YD+++V SED EIYEE K+S           + +D    +  + 
Sbjct: 12  STESICSLTKPQLYSLYDDDVVRSEDNEIYEELKRSVSIDSTKYSRDQTIDSTFYLAHKV 71

Query: 77  ----------------------------SRVRTRSQKYMHLVSSLVILGISGIAYHQLSR 108
                                       SR R   Q  +H + +++IL +SG AYH+LSR
Sbjct: 72  GGSLPRNTVSSNNLERILSASSIHENFPSRTRQTRQNILHYLQAVLILSLSGFAYHELSR 131

Query: 109 NLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISV 168
           NLHDN LLH DF SRPL+LGVKLC  LS G+LP W GY VEG+LFGS++P +D   +  V
Sbjct: 132 NLHDNHLLHPDFASRPLLLGVKLCNWLSNGVLPNWLGYGVEGLLFGSVVPILDNIFQTEV 191

Query: 169 GKV-----NLSGVLRSINAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVF 223
            K      +L+ V+RSINAMLGV+FGIR+++W+SSLQA+GAW LL+ ILWLFFDGS S+ 
Sbjct: 192 VKSSVHHDSLTSVIRSINAMLGVTFGIRKIQWNSSLQAAGAWGLLNIILWLFFDGSISML 251

Query: 224 LLGFAVGLVTAVTCYEEITDFSQ 246
           +    +G+   ++CY++I D SQ
Sbjct: 252 MSCICIGVGCCISCYKDIIDGSQ 274

>CAGL0J05918g complement(558615..559586) similar to sp|P53898
           Saccharomyces cerevisiae YNL156c or sp|P38837
           Saccharomyces cerevisiae YHR133c, hypothetical start
          Length = 323

 Score =  201 bits (512), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 164/295 (55%), Gaps = 64/295 (21%)

Query: 16  GKVGSPIVVAASTDSMSMLTKPQLFGIYDE--------EIVESE----------DTEIY- 56
           G+    +    S++S+S LT PQL+ IYD+        EI E            DT +Y 
Sbjct: 4   GRKKKAVKTVESSESISSLTTPQLYSIYDQDIVKSEDAEIYEELKRSRSKSSSLDTPLYA 63

Query: 57  ---------EEAKKSAGRMLD----------------------------------DMGSV 73
                    +  K +   ++D                                  D    
Sbjct: 64  IDEIIHLKKDNDKVNESPLIDVSEGSHIRPLSQHKKLINETLLTPSMSAGGNLGLDATMA 123

Query: 74  GARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQ 133
              S   T  Q++ + V ++V+L ISG+AYHQLSRNLHDN LLHEDF SRPL+ GV + Q
Sbjct: 124 NTMSFHVTPFQRFTNFVFAIVVLSISGVAYHQLSRNLHDNHLLHEDFASRPLLWGVTIQQ 183

Query: 134 QLSFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKV--NLSGVLRSINAMLGVSFGIR 191
           +LS G+LP W GYA+EGI+FGS++P +D+  ++ +     +LS V+RSINAMLGV+FGIR
Sbjct: 184 KLSCGILPDWFGYALEGIIFGSIIPLMDHITKVKLRPTSYSLSSVIRSINAMLGVTFGIR 243

Query: 192 RVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDFSQ 246
           +++W+SS QA+GAW LL+ ILWLFFDG+ S+F     +GL+   +C+ EITD SQ
Sbjct: 244 KIQWASSGQAAGAWGLLNVILWLFFDGTLSMFSNCSVLGLLCCASCFHEITDVSQ 298

>YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein
           that contains four potential transmembrane segments [876
           bp, 291 aa]
          Length = 291

 Score =  151 bits (381), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 140/249 (56%), Gaps = 16/249 (6%)

Query: 7   EEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRM 66
           +E      G K+GS     AS  +++ LTKP LF  YD++I ++E   +Y++A  S    
Sbjct: 24  KEAALPPLGNKLGS-----ASFTAINTLTKPALFSFYDDDITKNEG-NVYDKALLSNASQ 77

Query: 67  LDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLV 126
           L+ +         R+   K ++ +++  IL I+GI +  +S  L DND L +      L 
Sbjct: 78  LEMVPPSATARHERSLYAKIINTIAAFFILFIAGILFPMISECLFDNDQLAKGDIVSFLK 137

Query: 127 LGVKLCQQL--SFGMLPTWAGYAVEGILFGSLLPAVDYWRRI--------SVGKVNLSGV 176
            G+++  ++     M+P WA +  EG++FGS++P +D + R         SV K  L   
Sbjct: 138 HGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQHQPKTRSSVYKNTLGSF 197

Query: 177 LRSINAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVT 236
           +R  N +LG+ FGIR++EWSSSLQA+GAW LL+ +LWLFFDG+ +VF  G  +G ++A T
Sbjct: 198 IRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIGALSAFT 257

Query: 237 CYEEITDFS 245
           C +  +  S
Sbjct: 258 CSQCFSQLS 266

>Scas_697.14*
          Length = 294

 Score =  121 bits (303), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 127/241 (52%), Gaps = 26/241 (10%)

Query: 22  IVVAASTDSMSMLTKPQLFGIYDEEIVESED---TEIYEEA----KKSAGRMLD------ 68
           I   ASTDS+S LTKP L+ +Y  ++++S +   +++Y++A    ++  G  +D      
Sbjct: 21  IKTMASTDSISTLTKPALYSLYSNDVLKSNEDKTSQLYKQANNRWRRKGGDFMDPSSEDL 80

Query: 69  ---DMGSVGARSRVRTRSQKY---MHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTS 122
              D         V    + Y   +HL  S  IL   GI + +L+ NL DND L++  T+
Sbjct: 81  DELDEDHTDVDMDVEFNGKWYVRLIHLTYSFFILFTCGIVFGELAENLFDNDKLYKGMTA 140

Query: 123 RPLVLGVKLCQQL-SFGMLPTWAGYAVEGILFGSLLPAVDYWRRISVGKVNLS------G 175
             L  GVKL  ++     +  + G+ +EGIL   +L   DY  R +  K+  S       
Sbjct: 141 VILEDGVKLIDKVVPKSSVTNYIGFGIEGILLSLVLRVSDYLIRPNKDKIGQSKKNSFRS 200

Query: 176 VLRSINAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAV 235
           ++R  NA+LG+S G+RR+ W+SSLQ S  W L++ I+WLFFDG+ S+   G    L+  +
Sbjct: 201 IVRISNAILGISLGVRRLPWTSSLQGSMLWLLVNVIVWLFFDGTLSILTSGVIQALLICL 260

Query: 236 T 236
           T
Sbjct: 261 T 261

>Scas_654.19*
          Length = 202

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 45/198 (22%)

Query: 30  SMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGSV------GARSRVRTRS 83
           +  +LT+P LF IYD++I+            +S+G +   +G +      G R     R 
Sbjct: 24  AFQVLTRPTLFSIYDDDII------------RSSGDVDSRIGGIRKRVLRGKRRWKYRRR 71

Query: 84  QKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTW 143
           Q     + +L++L + GIAY++L+  L+ + ++++     PL       + + F  LP W
Sbjct: 72  QGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINK---MSPL-------RFMMFYGLPRW 121

Query: 144 AGYAVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSINAMLGVSFG-------------- 189
             Y++EG+  G L+P +D         V        I       +G              
Sbjct: 122 MNYSLEGVSLGFLVPLLDVLLFKKTVTVEYPETETEIGIGTEFDYGWGFMLAIINIIMGI 181

Query: 190 ---IRRVEWSSSLQASGA 204
              IR++EW S++Q++ A
Sbjct: 182 IYGIRKLEWDSAMQSAEA 199

>Kwal_14.1443
          Length = 1170

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 6   HEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIY 43
           H  E G+RAGG   S   + ++TD +  L+K Q F ++
Sbjct: 874 HTYETGQRAGGPPNSQAEIKSTTDVLRDLSKKQFFKLF 911

>Scas_530.5
          Length = 909

 Score = 31.6 bits (70), Expect = 0.75,   Method: Composition-based stats.
 Identities = 40/149 (26%), Positives = 71/149 (47%), Gaps = 12/149 (8%)

Query: 5   KHEEECGE---RAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKK 61
           K EE+  E   RAG    S I     +D++S  T  +L GI  +++ ESE+ ++    + 
Sbjct: 519 KLEEQVAEEEKRAGSH--SMIQNVVDSDTISE-TAARLTGIPVKKLTESENEKLIHMERD 575

Query: 62  SAGRMLDDMGSVGARSRVRTRSQKYM---HLVSSLVILGISGIAYHQLSRNLHDNDLLHE 118
            + +++  MG++ A S     S+  +      +S + LG+SG    +L++ +       E
Sbjct: 576 LSSQVVGQMGAIKAVSNAVRLSRSGLANPRQPASFLFLGLSGSGKTELAKKIAGFLFNDE 635

Query: 119 DFTSRPLVLGVKLCQQLSFG-MLPTWAGY 146
           D   R  V   +L ++ S   +L T AGY
Sbjct: 636 DMMIR--VDCSELSEKYSVSKLLGTTAGY 662

>CAGL0E06336g 636975..637739 similar to sp|P36057 Saccharomyces
           cerevisiae YKL154w SRP102, start by similarity
          Length = 254

 Score = 30.8 bits (68), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 17  KVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGSV 73
           K+  PI +  + +     T  Q   I  +E +E+E T I+E  KKS G +  D+G V
Sbjct: 150 KIREPIDILIACNKNESFTARQPLKI--KEALENEITRIFERKKKSLGNIERDIGDV 204

>AAR098W [284] [Homologous to ScYPR118W - SH]
           complement(518095..519306) [1212 bp, 403 aa]
          Length = 403

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 16/80 (20%)

Query: 171 VNLSGVLRSINAMLGVS-----FGIRRVEWSSSL-----------QASGAWFLLDGILWL 214
           VNLS  LR +  +L  +     F  R  +++  L             +GA FLLD ++  
Sbjct: 110 VNLSHALRDVERLLDSATSLSQFRDRMYDYACELLDMDVANNVRMGDNGARFLLDALIAE 169

Query: 215 FFDGSFSVFLLGFAVGLVTA 234
            FDGSF+V  +     L TA
Sbjct: 170 GFDGSFAVLTICNTGSLATA 189

>YNL169C (PSD1) [4427] chr14 complement(316169..317671)
           Phosphatidylserine decarboxylase, mitochondrial isozyme,
           converts phosphatidyl-L-serine to
           phosphatidylethanolamine [1503 bp, 500 aa]
          Length = 500

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 27/125 (21%)

Query: 53  TEIYEEAKKSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRN--- 109
           T ++ + ++S+G ++D   +  A S  +  S K++ L S  ++LG   +    +SRN   
Sbjct: 46  TRLFVQQRRSSGEIVDRAKAAAANSGRKQVSMKWVVLTSFTIVLGTILL----VSRNDST 101

Query: 110 -----------------LHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTWA---GYAVE 149
                            + +N+ L   +++ PL    +L  Q++   LP W    GY + 
Sbjct: 102 EEDATEGKKGRRTRKIKIFNNNWLFFCYSTLPLNAMSRLWGQVNSLTLPIWVRPWGYRLY 161

Query: 150 GILFG 154
             LFG
Sbjct: 162 SFLFG 166

>KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomyces
           cerevisiae YLL031c GPI13 protein involved in
           glycosylphosphatidylinositol biosynthesis, start by
           similarity
          Length = 1005

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 15/97 (15%)

Query: 93  LVILGISGIAYHQLSRNLH-----DNDLLHEDF-TSRPLVLGVKLCQQLSFGMLPTWAGY 146
           +VI  IS +++  + + LH     DN L    F TS  ++LGV          +P +  Y
Sbjct: 481 VVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGV---------FIPIFDRY 531

Query: 147 AVEGILFGSLLPAVDYWRRISVGKVNLSGVLRSINAM 183
           +V+ +    +    DYW RI+   + L  +L + N+ 
Sbjct: 532 SVQWLCLRLVEELSDYWSRIATLFITLHALLFTSNSF 568

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,593,270
Number of extensions: 296735
Number of successful extensions: 817
Number of sequences better than 10.0: 19
Number of HSP's gapped: 801
Number of HSP's successfully gapped: 21
Length of query: 266
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 166
Effective length of database: 13,134,309
Effective search space: 2180295294
Effective search space used: 2180295294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)