Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR042C2242207741e-105
Sklu_1881.22561274865e-61
Scas_697.132571274657e-58
Kwal_33.146052411274525e-56
YHR134W (WSS1)2691274483e-55
KLLA0F27863g2431344352e-53
CAGL0G06116g2991264228e-51
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR042C
         (220 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH] (510151..51...   302   e-105
Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement        191   5e-61
Scas_697.13                                                           183   7e-58
Kwal_33.14605                                                         178   5e-56
YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in ...   177   3e-55
KLLA0F27863g complement(2579510..2580241) some similarities with...   172   2e-53
CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces c...   167   8e-51

>AFR042C [3234] [Homologous to ScYHR134W (WSS1) - SH]
           (510151..510825) [675 bp, 224 aa]
          Length = 224

 Score =  302 bits (774), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 162/220 (73%), Positives = 162/220 (73%)

Query: 1   MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERR 60
           MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERR
Sbjct: 1   MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERR 60

Query: 61  LLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVG 120
           LLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVG
Sbjct: 61  LLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVG 120

Query: 121 RQWVLDQRGIVDSFXXXXXXXXXXXXXXXXXXXXXXXXSXXXXXXXXXXXXXXXXXXXXX 180
           RQWVLDQRGIVDSF                        S                     
Sbjct: 121 RQWVLDQRGIVDSFLGRGRRLGGRGRRLEGRGRRLGGRSAGVAARELAGLAAARRMAAIA 180

Query: 181 XXXXXXXXXXXXXPSRDGDLDVVVIDEEPCVVRTPVVIDL 220
                        PSRDGDLDVVVIDEEPCVVRTPVVIDL
Sbjct: 181 ATAQCCGQGGGTAPSRDGDLDVVVIDEEPCVVRTPVVIDL 220

>Sklu_1881.2 YHR134W, Contig c1881 2666-3436 reverse complement
          Length = 256

 Score =  191 bits (486), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 105/127 (82%)

Query: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67
           NPHI   A LQ KP K+ AL +L+DIA RVSYLMRE  F+VG+L EFYPR++RLLG+NVN
Sbjct: 7   NPHIGRIASLQGKPNKDDALALLEDIAHRVSYLMRENKFKVGELVEFYPRDKRLLGMNVN 66

Query: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127
            GA+I+LRLR P DE QFL+RE+IL  MLHELTHN+FGPHDA+F RKLD+L G QWV++Q
Sbjct: 67  GGAKIMLRLRHPNDESQFLARESILGTMLHELTHNLFGPHDAKFYRKLDDLSGTQWVIEQ 126

Query: 128 RGIVDSF 134
           RG+ DSF
Sbjct: 127 RGLFDSF 133

>Scas_697.13
          Length = 257

 Score =  183 bits (465), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 103/127 (81%)

Query: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67
           NPHI + AVLQ KP  E AL++LQDI ++VSYLM+EE F+V  L EFYP+++RLLG+NVN
Sbjct: 4   NPHITKVAVLQRKPNNEYALQILQDITKQVSYLMKEEKFKVQTLVEFYPKDKRLLGMNVN 63

Query: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127
            G +I+LRLR PGDE QFL+RE IL  MLHELTHN+FGPHD RF  KLD+L  RQWV++Q
Sbjct: 64  AGQKIMLRLRTPGDEFQFLNREAILGTMLHELTHNLFGPHDRRFYEKLDQLSARQWVIEQ 123

Query: 128 RGIVDSF 134
           +G+ D+F
Sbjct: 124 QGLFDTF 130

>Kwal_33.14605
          Length = 241

 Score =  178 bits (452), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 103/127 (81%)

Query: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67
           N HI + AV+Q KP ++ ALE+L+DIA RVSYLMRE  F+VGQL EFYP+ +RLLG+NVN
Sbjct: 6   NEHIDKVAVMQKKPNRDYALEILKDIAHRVSYLMREYKFKVGQLVEFYPKNKRLLGMNVN 65

Query: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127
           +GA+I+LRLR+P +E+ FLSRE +L  MLHELTHNV+GPH+A F +KLDEL  R WV+ Q
Sbjct: 66  RGAKIMLRLRDPFNEEVFLSREAVLGTMLHELTHNVYGPHNALFYKKLDELTARAWVIKQ 125

Query: 128 RGIVDSF 134
           +G+ D F
Sbjct: 126 QGLFDGF 132

>YHR134W (WSS1) [2421] chr8 (371750..372559) Protein involved in
           sensitivity to UV irradiation, has low similarity to
           uncharacterized C. albicans Orf6.4302p [810 bp, 269 aa]
          Length = 269

 Score =  177 bits (448), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 101/127 (79%)

Query: 8   NPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVN 67
           NPHI + AVLQ KP KE AL ++++IA +VSYLM+E  F+V  L EFYPR++RLLG+NVN
Sbjct: 26  NPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVN 85

Query: 68  QGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQ 127
            G++I+LRLR   DE QFL  E I+  MLHELTHN+FGPHD +F  KLDEL+GRQWV++Q
Sbjct: 86  HGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQ 145

Query: 128 RGIVDSF 134
           RG+ D+F
Sbjct: 146 RGLYDTF 152

>KLLA0F27863g complement(2579510..2580241) some similarities with
           sp|P38838 Saccharomyces cerevisiae YHR134w WSS1
           singleton, hypothetical start
          Length = 243

 Score =  172 bits (435), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 100/134 (74%)

Query: 1   MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERR 60
           M  P + NPH+   AVLQ KPGK  AL +L+ +A  VSYLM+EE F+V QL EFYPR R 
Sbjct: 1   MVPPIQKNPHVGSIAVLQTKPGKNDALNILKRVAHNVSYLMKEERFKVRQLVEFYPRNRS 60

Query: 61  LLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVG 120
           LLG+NVN+G +I+LRLR+P DE +FL  E+I+  MLHELTHN+ GPHD +F  KLD+L G
Sbjct: 61  LLGMNVNKGMKIMLRLRDPLDEYKFLPIESIMGTMLHELTHNLHGPHDRKFYEKLDQLSG 120

Query: 121 RQWVLDQRGIVDSF 134
           RQW ++Q G+ DSF
Sbjct: 121 RQWTIEQMGLYDSF 134

>CAGL0G06116g 584454..585353 similar to sp|P38838 Saccharomyces
           cerevisiae YHR134w WSS1, start by similarity
          Length = 299

 Score =  167 bits (422), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 96/126 (76%)

Query: 9   PHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEGFRVGQLAEFYPRERRLLGLNVNQ 68
           PHI   AVLQ KPGKE AL++L+DIA  VS LMRE  F+VG L EFYPR+R LLG+NVN 
Sbjct: 4   PHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVGTLVEFYPRDRSLLGMNVNH 63

Query: 69  GARILLRLREPGDEQQFLSRETILAVMLHELTHNVFGPHDARFRRKLDELVGRQWVLDQR 128
           G +I+LRLR+P DE +FL  E+++  MLHELTHN+ GPHD +F  KLDEL GRQW + Q 
Sbjct: 64  GQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPHDQKFYSKLDELSGRQWCIQQL 123

Query: 129 GIVDSF 134
           G+ D+F
Sbjct: 124 GLKDNF 129

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.142    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,013,379
Number of extensions: 161131
Number of successful extensions: 414
Number of sequences better than 10.0: 7
Number of HSP's gapped: 414
Number of HSP's successfully gapped: 8
Length of query: 220
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 122
Effective length of database: 13,203,545
Effective search space: 1610832490
Effective search space used: 1610832490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)