Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR041C25725213240.0
Sklu_1881.12592566512e-85
KLLA0D10978g2702675723e-73
Kwal_33.146032572575548e-71
Scas_654.182722685436e-69
CAGL0J05962g2932845394e-68
YNL155W2742654924e-61
AGR296W9823680.32
KLLA0F16214g11823641.3
CAGL0M08822g78777671.4
AFR542W310133661.6
Kwal_55.2166811423622.1
YOR052C15025632.4
KLLA0E20691g145282653.2
CAGL0D06094g15839623.4
Scas_698.4412325605.3
CAGL0L10186g17325607.0
AFR499C25035607.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR041C
         (252 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [...   514   0.0  
Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement         255   2e-85
KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces c...   224   3e-73
Kwal_33.14603                                                         218   8e-71
Scas_654.18                                                           213   6e-69
CAGL0J05962g complement(562367..563248) similar to sp|P53899 Sac...   212   4e-68
YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicte...   194   4e-61
AGR296W [4607] [Homologous to ScYOR052C - SH] complement(1289161...    31   0.32 
KLLA0F16214g complement(1503855..1504211) some similarities with...    29   1.3  
CAGL0M08822g 880145..882508 highly similar to tr|Q12137 Saccharo...    30   1.4  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   1.6  
Kwal_55.21668                                                          28   2.1  
YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protei...    29   2.4  
KLLA0E20691g complement(1830746..1835104) similar to sp|P38181 S...    30   3.2  
CAGL0D06094g 577169..577645 similar to sp|P46973 Saccharomyces c...    28   3.4  
Scas_698.44                                                            28   5.3  
CAGL0L10186g complement(1094808..1095329) some similarities with...    28   7.0  
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    28   7.7  

>AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [774
           bp, 257 aa]
          Length = 257

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 245/252 (97%)

Query: 1   MPERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPAX 60
           MPERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPA 
Sbjct: 1   MPERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPAS 60

Query: 61  XXXXXXQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKDRLVQRNSTNALDKLKR 120
                 QAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKDRLVQRNSTNALDKLKR
Sbjct: 61  RSRSSSQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKDRLVQRNSTNALDKLKR 120

Query: 121 FFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESNPKEHDIF 180
           FFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESNPKEHDIF
Sbjct: 121 FFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESNPKEHDIF 180

Query: 181 INRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRVNGNIE 240
           INRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRVNGNIE
Sbjct: 181 INRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRVNGNIE 240

Query: 241 EGDALYLIRGND 252
           EGDALYLIRGND
Sbjct: 241 EGDALYLIRGND 252

>Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement
          Length = 259

 Score =  255 bits (651), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 130/256 (50%), Positives = 171/256 (66%), Gaps = 12/256 (4%)

Query: 3   ERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPAXXX 62
           +RETGML+VG HC YCRQIDFLPFHCT CN DFCS HR +E+HHC  LL     T     
Sbjct: 5   KRETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQ-EKTKQNAC 63

Query: 63  XXXXQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKDRLVQRNSTNALDKLKRFF 122
                  GE   YF+ALLP+K+ +R+KQ  +E  +  TSIKD LV+  + +AL+KLK+FF
Sbjct: 64  NLGRNGNGE---YFQALLPEKSNIRLKQ-NNESHSNSTSIKDHLVKNKNKSALEKLKKFF 119

Query: 123 AK----YSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESN--PKE 176
           +K    +S  + +   S SNK I ++K+KRTAKGD KIP  NR+Y+W Y + + N  P +
Sbjct: 120 SKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVYLVADENDKPTK 179

Query: 177 HDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRVN 236
           H+IFIN+ WP+GRVLDY++  +DVKNVN    A + EKL+LYK    +   +LDPS RV 
Sbjct: 180 HEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPASPL-LLDPSCRVA 238

Query: 237 GNIEEGDALYLIRGND 252
             + +GD LYL+RG D
Sbjct: 239 NTLHDGDTLYLVRGED 254

>KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces
           cerevisiae YNL155w singleton, start by similarity
          Length = 270

 Score =  224 bits (572), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 164/267 (61%), Gaps = 22/267 (8%)

Query: 4   RETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKAL-------LAPGAA 56
           +E GMLDVG HC +CRQ DFLPFHC+ CN DFC+ HR +E HHC++L        +   +
Sbjct: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62

Query: 57  TPAXXXXXXXQAKGEREVYFKALLPDKAAVRVK---QETSEKPAQGTSIKDRLVQRNSTN 113
            PA         K     +F++LLP +A  R+K   QE + KP    ++K +L    +++
Sbjct: 63  IPAAAAAAVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVD-NLKSKLFNSKTSS 121

Query: 114 ---ALDKLKRFFAK----YSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWC 166
              A+DKL+ FFAK    + SK+     S++NK+IQV K+KRTAKGDD IP  NR+Y WC
Sbjct: 122 SRVAIDKLRHFFAKNGKLFESKKSTTKFSSANKLIQVTKMKRTAKGDDSIPVANRIYAWC 181

Query: 167 YYIDESN---PKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKE 223
           Y + +S+   P  +++FIN+ WP+GR LD L+  ++VKN N+     + EKL+LYK    
Sbjct: 182 YVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDAS 241

Query: 224 NEWKMLDPSGRVNGNIEEGDALYLIRG 250
            +  +L  S RVN  I+EGD LYL+RG
Sbjct: 242 TQ-HLLPSSARVNATIQEGDTLYLVRG 267

>Kwal_33.14603
          Length = 257

 Score =  218 bits (554), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 159/257 (61%), Gaps = 14/257 (5%)

Query: 5   ETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALL--APGAATPAXXX 62
           ETGMLDVG HC +CRQ+DFLPFHC  C  DFC  HR+QEAH C  +L  +  A       
Sbjct: 2   ETGMLDVGTHCTFCRQLDFLPFHCKFCEGDFCGSHRSQEAHRCPKILKESSAAGNTTKSG 61

Query: 63  XXXXQAKGEREVYFKALLPDKAAVRVKQETSEKP--AQG--TSIKDRLVQRNSTNALDKL 118
                + GE   YF  LLP+KA +RVKQ   E P  A+G  +S++ RL    + +AL+KL
Sbjct: 62  EPVRNSNGE---YFSTLLPEKAHIRVKQAV-EAPSVAKGNNSSVRSRLEASGNRSALEKL 117

Query: 119 KRFFAKYSSKRKNMNLSA--SNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESNPK- 175
           K FF + S  +      A  +N++I+VAK+K+TAKGD KIP  NRVY++C+ ++  +   
Sbjct: 118 KSFFGRRSGSKAGSLTKARPANRIIEVAKLKKTAKGDPKIPVVNRVYVFCFSVEAQDENV 177

Query: 176 EHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKENEWKMLDPSGRV 235
           +H++FIN+ WP+GR LDY++  + V+NVN    +   E+L+LY   K      LD + R+
Sbjct: 178 KHELFINKVWPVGRALDYIASQLAVRNVNNHVQSSDKERLFLYCD-KNGTPSNLDTASRI 236

Query: 236 NGNIEEGDALYLIRGND 252
              I++GD LYL+RG D
Sbjct: 237 ANIIKDGDTLYLVRGED 253

>Scas_654.18
          Length = 272

 Score =  213 bits (543), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 165/268 (61%), Gaps = 25/268 (9%)

Query: 4   RETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAATPAXXXX 63
           RETGMLDVG HC +CR++DFLPFHC+ C+ DFCS HR +E+H+C++L       P+    
Sbjct: 8   RETGMLDVGTHCAFCRELDFLPFHCSGCDKDFCSNHRLRESHYCESLQQRQEEKPSSTSH 67

Query: 64  XXXQAKGEREVYFKALLPDKAAVRVKQETSE-------KPAQGTSIKDRLVQRNSTNALD 116
                 G +  +FK+LLP+K  +RV    +        +  +G +I+  L    + +AL 
Sbjct: 68  VKVADNGGK--FFKSLLPEKGYIRVNNVPNNSNNNTVPRKTEGRTIRSTL----NNSALT 121

Query: 117 KLKRFFAKYSSKR---KNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYIDESN 173
           KLK FF K  +K+   + M +   NK++++  +K+ AKGD KIP  NR+YIWCY ++  N
Sbjct: 122 KLKHFFQKNHNKQNKLQRMKIFKPNKIVELNNLKKLAKGDSKIPLSNRIYIWCYCVENGN 181

Query: 174 PKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYK----RVKENE---- 225
             +  +FIN+ WPLGRVLDYL+  ++VKN+N S  A + EKLYLYK    + K NE    
Sbjct: 182 DNKSAVFINKIWPLGRVLDYLAKQLNVKNINNSFKATTKEKLYLYKEEIVKAKTNESDEV 241

Query: 226 -WKMLDPSGRVNGNIEEGDALYLIRGND 252
            + M++ SGR +  +++ D +YL+RG +
Sbjct: 242 NFHMVNLSGRASEELKDLDVIYLVRGEE 269

>CAGL0J05962g complement(562367..563248) similar to sp|P53899
           Saccharomyces cerevisiae YNL155w, hypothetical start
          Length = 293

 Score =  212 bits (539), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 169/284 (59%), Gaps = 46/284 (16%)

Query: 3   ERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALL-------APGA 55
           E+ETGMLDVG HCQYCRQ+DFLPFHC LC+ DFCS HR++E+HHCK LL         GA
Sbjct: 18  EKETGMLDVGTHCQYCRQLDFLPFHCKLCDGDFCSEHRSKESHHCKWLLDHPEELENNGA 77

Query: 56  ATPAXXXXXXXQAKGEREVYFKALLPDKAAVRVKQ-------------------ETSEKP 96
            +P         +K     +F++LLP+KA +RVK                     T  KP
Sbjct: 78  RSPP------SSSKSNGGKFFQSLLPEKAHIRVKSPSPSSTTSQSPVKLGSSGVTTKNKP 131

Query: 97  AQGTSIKDRLVQRNSTNALDKLKRFFAKYSS--KRKNMNLSASNKVIQVAKIKRTAKGDD 154
           ++ T I+  L    +  AL+KL  FF +  S  K K    ++SN++++++ +K+TAKGD 
Sbjct: 132 SETTKIRSTL----NPAALNKLLNFFKRTKSDPKTKKKVSTSSNRLVELSTLKKTAKGDS 187

Query: 155 KIPHPNRVYIWCYYI---DESNP----KEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSA 207
           KIP  NR+YI+C  I   DE++      +  ++IN+ WP+GR LDYLS  + V NVN + 
Sbjct: 188 KIPVQNRIYIYCQVILGEDETSDTLGLTKVPLYINKIWPVGRALDYLSQQLHVTNVNGNV 247

Query: 208 HAGSGEKLYLYK-RVKENEWKMLDPSGRVNGNIEEGDALYLIRG 250
               GEKL+LYK   K NE+  ++ SGRVN  +++ D LYL+RG
Sbjct: 248 DTTKGEKLFLYKYDEKLNEYVGIETSGRVNVLVKDLDTLYLVRG 291

>YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicted
           to have structural similarity to disulfide
           oxidoreductases [825 bp, 274 aa]
          Length = 274

 Score =  194 bits (492), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 111/265 (41%), Positives = 161/265 (60%), Gaps = 18/265 (6%)

Query: 3   ERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKALLAPGAA--TPAX 60
           E+ETGMLDVGKHC YCRQ+DFLPFHC+ CN DFCS HR +E HHC+ LL       T   
Sbjct: 6   EKETGMLDVGKHCAYCRQLDFLPFHCSFCNEDFCSNHRLKEDHHCRWLLEHEEVHKTEKS 65

Query: 61  XXXXXXQAKGEREVYFKALLPDKAAVRVKQ--ETSEKPAQGTSIKDRLVQRNSTNALDKL 118
                  +    E YFK+LLP++A+VR+++  ET E P +G++        NS   LDK+
Sbjct: 66  PSKSRDGSSSNDEAYFKSLLPERASVRIQRVSETRE-PLRGSNTAKVSSTLNS-KTLDKI 123

Query: 119 KRFFAKYSSKRKNMNL-----SASNKVIQVAKIKRTAKGDDKIPHPNRVYIWCYYI--DE 171
            +FF +   ++ N        S+SNK+IQ+A +K+ AKGD KIP  NR+YIWCY +  DE
Sbjct: 124 FKFFQRNEKRKSNNKSKKNFGSSSNKIIQLANLKKIAKGDPKIPMQNRIYIWCYLVDGDE 183

Query: 172 SNPKEHD----IFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGE-KLYLYKRVKENEW 226
           ++  + D    ++IN+ WP+GR +DYLS  ++VK+  L+  + + + +L   K  K+  +
Sbjct: 184 TDIAKEDTRMPLYINKMWPVGRAMDYLSIQLNVKSSTLTNSSSNDKFQLCKLKEGKQVSF 243

Query: 227 KMLDPSGRVNGNIEEGDALYLIRGN 251
             +  S RV   I++ D LYL+  N
Sbjct: 244 YNIGASLRVTNEIKDLDTLYLVHNN 268

>AGR296W [4607] [Homologous to ScYOR052C - SH]
          complement(1289161..1289457) [297 bp, 98 aa]
          Length = 98

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 28 CTLCNSDFCSVHRTQEAHHCKAL 50
          C  C+  FCS HR  E H C+ L
Sbjct: 49 CQFCDGQFCSRHRLMENHTCRGL 71

>KLLA0F16214g complement(1503855..1504211) some similarities with
          sgd|S0005578 Saccharomyces cerevisiae YOR052c,
          hypothetical start
          Length = 118

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 28 CTLCNSDFCSVHRTQEAHHCKAL 50
          C  C+  FCS HR  E H C+ L
Sbjct: 69 CNFCDGHFCSKHRLLENHQCQGL 91

>CAGL0M08822g 880145..882508 highly similar to tr|Q12137
           Saccharomyces cerevisiae YDR258c heat shock protein of
           clpb family of ATP-dependent proteases, hypothetical
           start
          Length = 787

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 17/77 (22%)

Query: 158 HPNRVYIWCYYIDESNPKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYL 217
           HP+   I    +DE                G++ D L HH+D +N  +   +  G+ + L
Sbjct: 595 HPDVCKILLQVLDE----------------GKLTDSLGHHVDFRNTIIVMTSNIGQDILL 638

Query: 218 YKRVKENEWKMLDPSGR 234
                ++E K +DPS R
Sbjct: 639 SDTKLDDEGK-IDPSTR 654

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 16/133 (12%)

Query: 34  DFCSVHRTQEAHHCKALLAPGAATPAXXXXXXXQAKGEREVYFKALLPDKAAVRVKQETS 93
            FC+  +T E    KA  APG   P+           E     + +     AV ++Q T+
Sbjct: 127 GFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEG---LRGINKGVNAVAIRQMTN 183

Query: 94  EKPAQGTS--IKD---RLVQRNSTNALDKLKRFFAKYSSKRKNMNLSASNKVIQVAKIKR 148
                G S  ++D   R+  + S   L  +++  A          LSA N+ I+V +++ 
Sbjct: 184 WGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGG----GLSAWNQPIEVIRVEM 239

Query: 149 TAKGDDKIPHPNR 161
            ++ +D    PNR
Sbjct: 240 QSRTND----PNR 248

>Kwal_55.21668
          Length = 114

 Score = 28.5 bits (62), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 12/23 (52%)

Query: 28 CTLCNSDFCSVHRTQEAHHCKAL 50
          C  C   FCS HR  E H C+ L
Sbjct: 65 CQFCQGHFCSRHRLMENHSCQGL 87

>YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protein
           containing an AN1-like zinc finger domain [453 bp, 150
           aa]
          Length = 150

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 12/25 (48%)

Query: 28  CTLCNSDFCSVHRTQEAHHCKALLA 52
           C  C   FCS HR  E H C  L +
Sbjct: 101 CNFCKGHFCSKHRLMENHACNGLTS 125

>KLLA0E20691g complement(1830746..1835104) similar to sp|P38181
            Saccharomyces cerevisiae YBL079w NUP170 nuclear pore
            protein, start by similarity
          Length = 1452

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 21/82 (25%)

Query: 100  TSIKDRLVQRNSTNALDKLKRFFAKYSSKRKNMNLSASNKVIQVAKIKRTAKG----DDK 155
            +S K+ L + N+T+ L+K   F +            AS+ VI+V K  RT++      D 
Sbjct: 1298 SSFKEHLSENNATDELEKSTTFISL-----------ASSTVIRVGKNVRTSEFVFPVVDL 1346

Query: 156  IPHPNRVYIWCYYIDESNPKEH 177
             PH       C  I E+ PKEH
Sbjct: 1347 FPH------ICSLIYENLPKEH 1362

>CAGL0D06094g 577169..577645 similar to sp|P46973 Saccharomyces
          cerevisiae YJR055w HIT1 required for growth at high
          temperature, hypothetical start
          Length = 158

 Score = 28.5 bits (62), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 9  LDVGKHCQYCRQIDFLPFHCTLCNSDFCSV--HRTQEAH 45
          +  GK CQ C++ DF  + C  C   +CS+  ++ +E H
Sbjct: 1  MSSGKECQICKKDDF-KYKCPKCGIKYCSLACYKNEELH 38

>Scas_698.44
          Length = 123

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 28 CTLCNSDFCSVHRTQEAHHCKALLA 52
          C  C   +CS HR  E H C+ L++
Sbjct: 74 CRFCQRQYCSKHRLMENHACEGLVS 98

>CAGL0L10186g complement(1094808..1095329) some similarities with
           tr|Q08422 Saccharomyces cerevisiae YOR052c, hypothetical
           start
          Length = 173

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 28  CTLCNSDFCSVHRTQEAHHCKALLA 52
           C  C   +CS HR  E H C+ L +
Sbjct: 124 CNFCKGHYCSRHRLMENHACEGLTS 148

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 19  RQIDFLPFHCTLCNSDFCSVHRTQEAHH-CKALLA 52
           R +D +PF C LC   + +  RT+  H+ C    A
Sbjct: 149 RDLDSIPFRCVLCRGHYRAPVRTRCGHYFCGGCFA 183

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,268,816
Number of extensions: 341058
Number of successful extensions: 960
Number of sequences better than 10.0: 27
Number of HSP's gapped: 935
Number of HSP's successfully gapped: 27
Length of query: 252
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 153
Effective length of database: 13,168,927
Effective search space: 2014845831
Effective search space used: 2014845831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)