Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFR040W54751720650.0
YNL154C (YCK2)54633216150.0
Scas_654.1752334216060.0
Kwal_33.1459650033316020.0
KLLA0D11044g53634116030.0
CAGL0G06138g53933715960.0
YHR135C (YCK1)53833215790.0
Scas_697.1252933615520.0
CAGL0J05940g48636315240.0
Scas_627.447533711141e-148
YER123W (YCK3)52435911111e-147
ADL053C47134511031e-146
Kwal_47.1731442136110771e-143
Sklu_2359.348836710791e-142
KLLA0E13563g47334810741e-142
CAGL0K02299g53836210701e-140
KLLA0D03168g5052648091e-102
AFL091W4782648041e-101
Scas_720.244732648011e-101
CAGL0H03553g4952648011e-101
Sklu_1892.34742647971e-100
YPL204W (HRR25)4942647971e-100
Kwal_56.240644752647951e-100
Scas_690.124882656572e-79
YDR490C (PKH1)7662721801e-13
KLLA0C08525g15512371731e-12
Sklu_2437.1610712541651e-11
AFR335C10332511613e-11
Scas_618.84272121575e-11
AER264C14832231561e-10
Kwal_56.226939842601552e-10
AAR009W4532261532e-10
Kwal_26.735514462771542e-10
Scas_502.211162601533e-10
CAGL0I07513g10762951523e-10
KLLA0C12485g9252331514e-10
KLLA0E03487g6472301506e-10
Kwal_23.632515422331507e-10
YJL095W (BCK1)14782761498e-10
Scas_660.209572311481e-09
CAGL0L03520g14472251471e-09
KLLA0F16467g3401591432e-09
Sklu_2429.54322311442e-09
AFL101C3672141423e-09
Sklu_2436.147842391443e-09
YPL203W (TPK2)3802331414e-09
KLLA0B02332g3612241404e-09
CAGL0G04609g9652371435e-09
Kwal_33.138463752281405e-09
YOL100W (PKH2)10812701425e-09
CAGL0K08514g14892751435e-09
Kwal_56.240593532331395e-09
YDR466W (PKH3)8982411416e-09
Kwal_0.964272311398e-09
AEL284C4792391398e-09
CAGL0K03399g7032301409e-09
Sklu_2232.23741591362e-08
Kwal_26.76356912291372e-08
Scas_711.2515152741372e-08
AFL090W3462291342e-08
YFR014C (CMK1)4461791353e-08
YOL016C (CMK2)4472301343e-08
KLLA0B12716g7162301354e-08
YHR205W (SCH9)8241351344e-08
Kwal_47.183076212271344e-08
KLLA0F13552g12672461345e-08
ABL028W7222341336e-08
CAGL0F09075g7462341336e-08
KLLA0D03190g3722281317e-08
Sklu_2430.57332301329e-08
CAGL0F04741g4421711309e-08
ADR204W3391591299e-08
Kwal_26.778812672171329e-08
YOR061W (CKA2)3391591281e-07
CAGL0G02035g3391591272e-07
YPL153C (RAD53)8212301292e-07
YCR073C (SSK22)13312281292e-07
AFR377C7262331292e-07
CAGL0M08910g6121791282e-07
KLLA0F14190g13382221292e-07
CAGL0K06479g9912491282e-07
YHR102W (KIC1)10802221282e-07
Scas_703.57491351273e-07
CAGL0L11550g10722361283e-07
Kwal_47.167617441351273e-07
Scas_613.55172351263e-07
CAGL0M08404g4622281264e-07
Scas_689.25*4092141254e-07
ADL389W7112351264e-07
CAGL0L07326g5062381255e-07
AFR092W14232221265e-07
KLLA0F01507g4721201245e-07
YKL101W (HSL1)15182471256e-07
YKL166C (TPK3)3982521236e-07
AFL188C4722331236e-07
CAGL0G09020g3612291227e-07
KLLA0B03586g7341351247e-07
YJL164C (TPK1)3972341228e-07
Scas_721.1246842331238e-07
Scas_660.286232221239e-07
CAGL0K07458g7041411231e-06
YGL158W (RCK1)5122481221e-06
CAGL0B04301g5421601211e-06
YJL141C (YAK1)8071781212e-06
Kwal_33.139846491761212e-06
Scas_690.133542331192e-06
CAGL0I05896g7781781212e-06
Scas_648.173401661192e-06
YDR477W (SNF1)6331601202e-06
ABL034W14252231203e-06
YMR104C (YPK2)6771231193e-06
Scas_717.696742301193e-06
YPL209C (IPL1)3671451183e-06
YKL126W (YPK1)6801321193e-06
Scas_700.546982281193e-06
KLLA0F23155g4272321183e-06
KLLA0D08415g7741391183e-06
KLLA0B07205g4552471183e-06
Kwal_47.182335981591183e-06
Kwal_56.240913811171164e-06
ACR249C6431781175e-06
Scas_616.1014612811175e-06
CAGL0K10604g4462101165e-06
AEL230W6081591165e-06
Scas_720.9416832521175e-06
AFR076W8201951166e-06
YOR233W (KIN4)8002211166e-06
CAGL0M02233g7672691167e-06
KLLA0F24618g5561351157e-06
YBR028C5251491158e-06
Scas_698.373471581138e-06
CAGL0E05720g3582141131e-05
Sklu_2392.68081551151e-05
Kwal_26.87967961371141e-05
Scas_651.183712281131e-05
KLLA0E01584g4152411131e-05
Kwal_33.144347591381141e-05
KLLA0A03806g6021591131e-05
Kwal_14.12734152581121e-05
YNL161W (CBK1)7561551131e-05
KLLA0E14828g3101851111e-05
ACR142W8371531132e-05
YPL141C8652761132e-05
ACR218W15691651122e-05
KLLA0A05819g7041781112e-05
AFR035W7191551112e-05
CAGL0J06072g7731551113e-05
Kwal_55.217093401631093e-05
Kwal_33.145547141551103e-05
YLR113W (HOG1)4351821084e-05
Scas_580.610152281104e-05
ABL143C7252211094e-05
ACL191C3651591084e-05
KLLA0F20053g4442241084e-05
ADL283W3061671074e-05
Kwal_26.87034441541084e-05
ABL011C7012631094e-05
YNR031C (SSK2)15792631095e-05
Scas_673.20*7582131095e-05
YKL048C (ELM1)6403161095e-05
Scas_651.37931761095e-05
AEL115C3861191075e-05
YGR052W3692221075e-05
Scas_627.73491101076e-05
CAGL0C05005g10762171086e-05
KLLA0F09020g9282011086e-05
Sklu_2385.24342241067e-05
Scas_713.384321821067e-05
YMR139W (RIM11)3701611068e-05
Kwal_26.87098292261078e-05
KLLA0F11143g8132321078e-05
Kwal_27.98044731751068e-05
Scas_654.127371551078e-05
AEL083W5361471069e-05
Sklu_2104.12992081041e-04
Sklu_2323.34001061051e-04
YNL183C (NPR1)7901381061e-04
YNL020C (ARK1)6381291061e-04
CAGL0I09504g5282361051e-04
Kwal_14.115915211551061e-04
Scas_718.725501671051e-04
CAGL0J03872g6612291051e-04
YDL214C (PRR2)6991281051e-04
CAGL0L06820g3661611041e-04
KLLA0F01276g5192311041e-04
Kwal_23.35904992381041e-04
Scas_655.28001381051e-04
YBR274W (CHK1)5271091041e-04
ADR058C2952061022e-04
Scas_593.14d4951541042e-04
YOR231W (MKK1)5081321042e-04
ADL315C4342461032e-04
CAGL0M08316g9642001042e-04
Scas_707.315981541042e-04
KLLA0D07810g7181561032e-04
YGL179C (TOS3)5602411032e-04
Kwal_55.215458652291032e-04
AEL173W5311621032e-04
KLLA0C17160g8312611032e-04
CAGL0K12562g16821851042e-04
KLLA0A06776g8001801033e-04
Kwal_27.11919209206993e-04
CAGL0H10318g3071571013e-04
Scas_623.113781621013e-04
ADR379C4921261013e-04
YKL171W9282241023e-04
Scas_649.306481701023e-04
Scas_201.1*2741171003e-04
Sklu_1843.34861271013e-04
KLLA0E21780g10162251023e-04
CAGL0F03245g10362501024e-04
Sklu_2361.38842441014e-04
YDL101C (DUN1)5132381014e-04
CAGL0K04301g3552311004e-04
Scas_711.15727721014e-04
YOR351C (MEK1)497981004e-04
Kwal_23.52908191141005e-04
Scas_689.229011741005e-04
CAGL0F00649g5142731005e-04
Scas_707.349051601005e-04
YFL033C (RIM15)17701781005e-04
ACR133C8512261006e-04
Scas_613.13*312180986e-04
CAGL0M02299g893230996e-04
YDR122W (KIN1)1064121996e-04
Kwal_56.22788515153997e-04
AGR048C453224988e-04
ACR117W524132988e-04
KLLA0F22297g699135988e-04
YPL031C (PHO85)305220979e-04
ACL054W972175989e-04
AEL205W793114980.001
CAGL0J11308g728138980.001
YNL298W (CLA4)842114980.001
Kwal_27.11542791136980.001
Scas_721.132584291980.001
Scas_693.17104948980.001
CAGL0M11748g447182970.001
Kwal_55.20326750260970.001
Scas_721.46296206960.001
YPL140C (MKK2)506127970.001
CAGL0K01815g504171960.001
CAGL0L06006g942181970.001
CAGL0M03729g86197970.001
Scas_640.14*728121970.001
CAGL0J03828g467221960.001
KLLA0D13266g1152174970.001
KLLA0F02838g755100960.001
KLLA0B09790g295206950.001
Kwal_26.727664671960.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR040W
         (537 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   800   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   626   0.0  
Scas_654.17                                                           623   0.0  
Kwal_33.14596                                                         621   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   622   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   619   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   612   0.0  
Scas_697.12                                                           602   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   591   0.0  
Scas_627.4                                                            433   e-148
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   432   e-147
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   429   e-146
Kwal_47.17314                                                         419   e-143
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        420   e-142
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   418   e-142
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   416   e-140
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   316   e-102
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   314   e-101
Scas_720.24                                                           313   e-101
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   313   e-101
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           311   e-100
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   311   e-100
Kwal_56.24064                                                         310   e-100
Scas_690.12                                                           257   2e-79
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    74   1e-13
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    71   1e-12
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      68   1e-11
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    67   3e-11
Scas_618.8                                                             65   5e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    65   1e-10
Kwal_56.22693                                                          64   2e-10
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    64   2e-10
Kwal_26.7355                                                           64   2e-10
Scas_502.2                                                             64   3e-10
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    63   3e-10
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    63   4e-10
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    62   6e-10
Kwal_23.6325                                                           62   7e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    62   8e-10
Scas_660.20                                                            62   1e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    61   1e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    60   2e-09
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        60   2e-09
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    59   3e-09
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         60   3e-09
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    59   4e-09
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    59   4e-09
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    60   5e-09
Kwal_33.13846                                                          59   5e-09
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    59   5e-09
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    60   5e-09
Kwal_56.24059                                                          58   5e-09
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    59   6e-09
Kwal_0.96                                                              58   8e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    58   8e-09
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    59   9e-09
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         57   2e-08
Kwal_26.7635                                                           57   2e-08
Scas_711.25                                                            57   2e-08
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    56   2e-08
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    57   3e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    56   3e-08
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    57   4e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    56   4e-08
Kwal_47.18307                                                          56   4e-08
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    56   5e-08
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    56   6e-08
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    56   6e-08
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    55   7e-08
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           55   9e-08
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    55   9e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    54   9e-08
Kwal_26.7788                                                           55   9e-08
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    54   1e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    54   2e-07
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    54   2e-07
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    54   2e-07
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    54   2e-07
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    54   2e-07
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    54   2e-07
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    54   2e-07
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    54   2e-07
Scas_703.5                                                             54   3e-07
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    54   3e-07
Kwal_47.16761                                                          54   3e-07
Scas_613.5                                                             53   3e-07
CAGL0M08404g complement(836791..838179) some similarities with s...    53   4e-07
Scas_689.25*                                                           53   4e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    53   4e-07
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    53   5e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    53   5e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    52   5e-07
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    53   6e-07
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    52   6e-07
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    52   6e-07
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    52   7e-07
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    52   7e-07
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    52   8e-07
Scas_721.124                                                           52   8e-07
Scas_660.28                                                            52   9e-07
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    52   1e-06
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    52   1e-06
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    51   1e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    51   2e-06
Kwal_33.13984                                                          51   2e-06
Scas_690.13                                                            50   2e-06
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    51   2e-06
Scas_648.17                                                            50   2e-06
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    51   2e-06
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    51   3e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    50   3e-06
Scas_717.69                                                            50   3e-06
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    50   3e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    50   3e-06
Scas_700.54                                                            50   3e-06
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    50   3e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    50   3e-06
KLLA0B07205g complement(624606..625973) some similarities with s...    50   3e-06
Kwal_47.18233                                                          50   3e-06
Kwal_56.24091                                                          49   4e-06
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    50   5e-06
Scas_616.10                                                            50   5e-06
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    49   5e-06
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    49   5e-06
Scas_720.94                                                            50   5e-06
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    49   6e-06
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    49   6e-06
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    49   7e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    49   7e-06
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    49   8e-06
Scas_698.37                                                            48   8e-06
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    48   1e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       49   1e-05
Kwal_26.8796                                                           49   1e-05
Scas_651.18                                                            48   1e-05
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    48   1e-05
Kwal_33.14434                                                          49   1e-05
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    48   1e-05
Kwal_14.1273                                                           48   1e-05
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    48   1e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    47   1e-05
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    48   2e-05
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    48   2e-05
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    48   2e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    47   2e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    47   2e-05
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    47   3e-05
Kwal_55.21709                                                          47   3e-05
Kwal_33.14554                                                          47   3e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    46   4e-05
Scas_580.6                                                             47   4e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    47   4e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    46   4e-05
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    46   4e-05
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    46   4e-05
Kwal_26.8703                                                           46   4e-05
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    47   4e-05
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    47   5e-05
Scas_673.20*                                                           47   5e-05
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    47   5e-05
Scas_651.3                                                             47   5e-05
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    46   5e-05
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    46   5e-05
Scas_627.7                                                             46   6e-05
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    46   6e-05
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    46   6e-05
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         45   7e-05
Scas_713.38                                                            45   7e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    45   8e-05
Kwal_26.8709                                                           46   8e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    46   8e-05
Kwal_27.9804                                                           45   8e-05
Scas_654.12                                                            46   8e-05
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    45   9e-05
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             45   1e-04
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            45   1e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    45   1e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    45   1e-04
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    45   1e-04
Kwal_14.1159                                                           45   1e-04
Scas_718.72                                                            45   1e-04
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    45   1e-04
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    45   1e-04
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    45   1e-04
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    45   1e-04
Kwal_23.3590                                                           45   1e-04
Scas_655.2                                                             45   1e-04
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    45   1e-04
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    44   2e-04
Scas_593.14d                                                           45   2e-04
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    45   2e-04
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    44   2e-04
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    45   2e-04
Scas_707.3                                                             45   2e-04
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    44   2e-04
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    44   2e-04
Kwal_55.21545                                                          44   2e-04
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    44   2e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    44   2e-04
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    45   2e-04
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    44   3e-04
Kwal_27.11919                                                          43   3e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    44   3e-04
Scas_623.11                                                            44   3e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    44   3e-04
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    44   3e-04
Scas_649.30                                                            44   3e-04
Scas_201.1*                                                            43   3e-04
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         44   3e-04
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    44   3e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    44   4e-04
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            44   4e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    44   4e-04
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    43   4e-04
Scas_711.15                                                            44   4e-04
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    43   4e-04
Kwal_23.5290                                                           43   5e-04
Scas_689.22                                                            43   5e-04
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    43   5e-04
Scas_707.34                                                            43   5e-04
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    43   5e-04
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    43   6e-04
Scas_613.13*                                                           42   6e-04
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    43   6e-04
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    43   6e-04
Kwal_56.22788                                                          43   7e-04
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    42   8e-04
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    42   8e-04
KLLA0F22297g complement(2083448..2085547) some similarities with...    42   8e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    42   9e-04
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    42   9e-04
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    42   0.001
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    42   0.001
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    42   0.001
Kwal_27.11542                                                          42   0.001
Scas_721.132                                                           42   0.001
Scas_693.17                                                            42   0.001
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    42   0.001
Kwal_55.20326                                                          42   0.001
Scas_721.46                                                            42   0.001
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    42   0.001
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    42   0.001
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    42   0.001
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    42   0.001
Scas_640.14*                                                           42   0.001
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    42   0.001
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    42   0.001
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    42   0.001
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    41   0.001
Kwal_26.7276                                                           42   0.001
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    42   0.002
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      41   0.002
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    42   0.002
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    42   0.002
Kwal_17.2687                                                           41   0.002
Kwal_55.22001                                                          41   0.002
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    40   0.002
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    41   0.002
Kwal_56.23841                                                          41   0.002
Scas_640.16                                                            41   0.002
CAGL0M10153g complement(1010688..1013291) some similarities with...    41   0.002
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    41   0.002
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    41   0.002
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         41   0.002
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    41   0.002
Scas_598.6                                                             41   0.003
Scas_675.2                                                             40   0.003
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    41   0.003
Scas_700.28                                                            41   0.003
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    40   0.003
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        40   0.003
Scas_671.16                                                            40   0.003
Scas_635.1                                                             40   0.003
Scas_683.12                                                            40   0.003
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    40   0.003
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    40   0.003
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    40   0.004
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           40   0.004
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    40   0.004
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    40   0.004
Kwal_14.1249                                                           40   0.004
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    40   0.004
Scas_667.18                                                            40   0.004
Scas_713.21                                                            40   0.004
Scas_653.25                                                            40   0.004
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    40   0.004
Kwal_47.17252                                                          40   0.005
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         40   0.005
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    39   0.005
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    40   0.005
CAGL0K01661g complement(146952..148400) some similarities with t...    40   0.005
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    40   0.006
Kwal_26.7861                                                           40   0.006
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    40   0.006
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    39   0.006
Kwal_0.155                                                             40   0.006
Kwal_14.1416                                                           39   0.006
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    40   0.006
Kwal_14.2497                                                           39   0.006
Scas_584.11                                                            40   0.006
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    39   0.007
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    39   0.007
Scas_700.35                                                            39   0.007
Scas_668.22                                                            40   0.007
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    40   0.007
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    39   0.007
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    39   0.008
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    39   0.008
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    39   0.009
Kwal_33.13112                                                          39   0.009
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    39   0.009
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    39   0.010
Kwal_27.10581                                                          39   0.010
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          39   0.010
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    39   0.011
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    39   0.011
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    39   0.011
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    39   0.011
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    39   0.011
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    39   0.011
Scas_568.9*                                                            38   0.011
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    39   0.012
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    39   0.012
Scas_544.6                                                             39   0.012
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    39   0.013
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    39   0.013
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         39   0.013
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    39   0.014
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    39   0.014
Scas_619.5*                                                            39   0.014
Kwal_33.14192                                                          39   0.014
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    38   0.014
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          38   0.015
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    39   0.015
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    39   0.016
Scas_336.1                                                             38   0.016
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    38   0.016
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    38   0.016
Scas_720.103                                                           38   0.016
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    38   0.017
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    38   0.017
Kwal_23.6458                                                           38   0.017
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         38   0.018
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    38   0.018
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    38   0.018
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    38   0.019
Scas_477.5                                                             38   0.020
Kwal_56.23717                                                          38   0.020
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    37   0.020
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    38   0.020
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    38   0.021
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    38   0.021
Scas_705.23                                                            38   0.021
Scas_584.8                                                             38   0.022
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    37   0.022
Scas_700.34                                                            38   0.022
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    38   0.022
Scas_677.18                                                            38   0.023
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    38   0.023
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    38   0.023
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    37   0.023
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    37   0.023
Kwal_56.24584                                                          37   0.024
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    38   0.025
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    38   0.025
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    38   0.025
Scas_493.2                                                             38   0.025
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    38   0.026
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    38   0.027
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    37   0.029
KLLA0C03938g complement(358851..360632) some similarities with s...    37   0.030
Kwal_27.11777                                                          37   0.031
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    37   0.032
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    37   0.032
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       37   0.033
Scas_715.34                                                            37   0.034
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    37   0.034
Kwal_55.20189                                                          37   0.036
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    37   0.037
Kwal_47.17868                                                          37   0.037
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    37   0.039
Kwal_23.5668                                                           37   0.040
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            37   0.043
Kwal_33.14167                                                          37   0.044
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    37   0.044
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    37   0.044
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    37   0.045
Kwal_47.17345                                                          37   0.046
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            37   0.047
KLLA0D12100g complement(1031728..1033161) some similarities with...    37   0.048
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    37   0.049
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    36   0.051
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    37   0.051
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    37   0.052
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    37   0.054
Scas_713.7                                                             37   0.059
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    36   0.062
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    37   0.065
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    36   0.065
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    37   0.065
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    36   0.070
Scas_703.47                                                            36   0.072
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    36   0.073
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    36   0.073
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    36   0.073
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    36   0.075
Scas_568.13                                                            36   0.079
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    36   0.080
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    36   0.083
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    36   0.084
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         36   0.084
Scas_710.28                                                            35   0.087
Scas_721.61                                                            36   0.090
Scas_707.36                                                            36   0.092
Kwal_26.7682                                                           36   0.092
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    36   0.097
KLLA0C16577g complement(1451181..1452695) some similarities with...    36   0.099
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    36   0.10 
Kwal_23.4276                                                           35   0.11 
Kwal_55.21900                                                          35   0.11 
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    35   0.12 
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             35   0.12 
Scas_629.16                                                            35   0.12 
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    35   0.12 
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    35   0.12 
Kwal_56.22476                                                          35   0.13 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    35   0.14 
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    35   0.14 
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    35   0.14 
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    35   0.14 
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    35   0.15 
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    35   0.15 
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    35   0.15 
Kwal_33.13222                                                          33   0.16 
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    35   0.17 
Scas_602.11                                                            35   0.17 
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    35   0.17 
Scas_564.7                                                             35   0.18 
KLLA0E11979g complement(1060048..1061892) some similarities with...    35   0.19 
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    35   0.20 
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    35   0.20 
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    35   0.21 
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    35   0.21 
Kwal_47.17263                                                          35   0.21 
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    35   0.21 
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    35   0.23 
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          35   0.23 
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    35   0.23 
KLLA0D09328g complement(788565..791705) some similarities with s...    35   0.23 
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    34   0.23 
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    34   0.23 
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    34   0.24 
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    34   0.24 
Kwal_23.5576                                                           34   0.25 
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    34   0.29 
Scas_689.24                                                            34   0.30 
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    34   0.30 
Scas_716.33                                                            34   0.31 
Kwal_23.3992                                                           34   0.33 
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    34   0.33 
Sklu_1883.2 YKL171W, Contig c1883 1300-4338                            34   0.34 
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    34   0.35 
AER348C [2849] [Homologous to ScYMR216C (SKY1) - SH] (1275897..1...    34   0.36 
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    34   0.36 
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    34   0.36 
Scas_683.6                                                             33   0.38 
Scas_678.24                                                            34   0.39 
Scas_707.7                                                             33   0.45 
Scas_653.33                                                            33   0.45 
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    33   0.47 
CAGL0M08360g complement(833220..835520) some similarities with s...    33   0.49 
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    33   0.52 
Kwal_14.2554                                                           33   0.53 
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    33   0.54 
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    33   0.56 
Scas_688.14                                                            33   0.56 
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    33   0.57 
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            33   0.59 
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    33   0.59 
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    33   0.61 
Scas_692.24                                                            33   0.64 
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    33   0.67 
Kwal_27.11803                                                          32   0.73 
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    33   0.73 
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          33   0.74 
Kwal_23.3471                                                           32   0.76 
Scas_704.50                                                            33   0.76 
Sklu_2341.5 YGR262C, Contig c2341 5913-6704 reverse complement         32   0.80 
Scas_695.33                                                            33   0.88 
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    33   0.90 
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         32   0.91 
Kwal_47.18098                                                          32   0.95 
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    32   0.97 
Scas_633.29                                                            32   1.0  
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    32   1.0  
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    32   1.1  
Kwal_27.10004                                                          32   1.1  
YJL057C (YJL057C) [2854] chr10 complement(328034..330037) Probab...    32   1.1  
Scas_685.24                                                            32   1.1  
Sklu_2419.10 , Contig c2419 14439-16135                                32   1.2  

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/517 (79%), Positives = 410/517 (79%)

Query: 21  NTKMNXXXXXXXXXXXXXXHTFSQQAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSF 80
           NTKMN              HTFSQQAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSF
Sbjct: 21  NTKMNAASAAQQQASLSQSHTFSQQAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSF 80

Query: 81  GVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNIL 140
           GVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNIL
Sbjct: 81  GVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNIL 140

Query: 141 VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPD 200
           VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPD
Sbjct: 141 VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPD 200

Query: 201 QPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA 260
           QPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA
Sbjct: 201 QPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA 260

Query: 261 LGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320
           LGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL
Sbjct: 261 LGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320

Query: 321 GFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNPP 380
           GFEETPDYDGYRK                  WMKLNGGRGWDLTINKKPNLHGYGHPNPP
Sbjct: 321 GFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKLNGGRGWDLTINKKPNLHGYGHPNPP 380

Query: 381 NEKGRRHRSKYXXXXXXXXXXXXXDPRYGSSQLQLQQRLDPTSYEXXXXXXXXXXXXXXX 440
           NEKGRRHRSKY             DPRYGSSQLQLQQRLDPTSYE               
Sbjct: 381 NEKGRRHRSKYPQPSAPQQMSSPQDPRYGSSQLQLQQRLDPTSYEAYQQQTQQRYAQQQL 440

Query: 441 XXXHHQPRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPSHSSQ 500
              HHQPRL                                            FPSHSSQ
Sbjct: 441 KLQHHQPRLNYQAQPLQQSSQQPQAQQQNQQTQNQQTQQQQTQYRTQQQAQYPFPSHSSQ 500

Query: 501 PGMHQKQGLLQGQNGSVTAGTTTANGKQQDVGSVSSG 537
           PGMHQKQGLLQGQNGSVTAGTTTANGKQQDVGSVSSG
Sbjct: 501 PGMHQKQGLLQGQNGSVTAGTTTANGKQQDVGSVSSG 537

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/332 (89%), Positives = 306/332 (92%)

Query: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKI 118
           RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEYRTYKI
Sbjct: 66  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKI 125

Query: 119 LAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178
           LAGT G+PQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED
Sbjct: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           LHAHDLIYRDIKPDNFLIGRP QPDANKVHLIDFGMAK YRDPKTKQHIPYREKKSLSGT
Sbjct: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTN 298
           ARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTN 305

Query: 299 VYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGG 358
           VYDL+QGLP+QFGRYLEIVRNL FEETPDY+GYR                   WMKLNGG
Sbjct: 306 VYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGG 365

Query: 359 RGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK 390
           RGWDL+INKKPNLHGYGHPNPPNEK +RHRSK
Sbjct: 366 RGWDLSINKKPNLHGYGHPNPPNEKSKRHRSK 397

>Scas_654.17
          Length = 523

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/342 (85%), Positives = 306/342 (89%)

Query: 49  AGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ 108
           A +     S RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQ
Sbjct: 50  ASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ 109

Query: 109 LKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           LKDEYRTYKIL GT GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQV
Sbjct: 110 LKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQV 169

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
           AVQMITLIEDLHAHDLIYRDIKPDNFL+GRP   DANK+HLIDFGMAK YRDPKTKQHIP
Sbjct: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP 229

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 288
           YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE
Sbjct: 230 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 289

Query: 289 KIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXX 348
           KIGEKKR+TNVYDL+QGLP+QFGRYLEIVRNL FEETPDY+GYR                
Sbjct: 290 KIGEKKRTTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADG 349

Query: 349 XXXWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK 390
              WMKLNGGRGWDL INKKPNLHGYGHPNPPNEK +RHR+K
Sbjct: 350 EYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNK 391

>Kwal_33.14596
          Length = 500

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/333 (88%), Positives = 306/333 (91%)

Query: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKI 118
           R+D+TIVGLH++IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81

Query: 119 LAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178
           LAGT+G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED
Sbjct: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           LH HDLIYRDIKPDNFLIGRP  PD NKVHLIDFGMAK YRDPKTKQHIPYREKKSLSGT
Sbjct: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTN 298
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261

Query: 299 VYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGG 358
           VYDL+QGLPVQFGRYLE+VR+L FEETPDY+GYRK                  WMKLNGG
Sbjct: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321

Query: 359 RGWDLTINKKPNLHGYGHPNPPNEKGRRHRSKY 391
           RGWDL INKKPNLHGYGHPNPPN+K RRHRSKY
Sbjct: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSKY 354

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/341 (85%), Positives = 309/341 (90%)

Query: 51  SNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK 110
           S+ S+ S RDD+TIVGLH+KIGKKIGEGSFGVLFEG NMIN VPVAIKFEPRKT+APQLK
Sbjct: 59  SSASSTSTRDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK 118

Query: 111 DEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV 170
           DEYRTYKIL+G+ G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV VA+
Sbjct: 119 DEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI 178

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYR 230
           QMITLIE+LH HDLIYRDIKPDNFLIGRP+QPDAN VHLIDFGMAKLYRDPKTKQHIPYR
Sbjct: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238

Query: 231 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKI
Sbjct: 239 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298

Query: 291 GEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXX 350
           GEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDY+GYRK                 
Sbjct: 299 GEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEY 358

Query: 351 XWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSKY 391
            WMKLNGGRGWDL INKKPNLHGYGHP PPNEK +RHR+K+
Sbjct: 359 DWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKF 399

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/337 (86%), Positives = 307/337 (91%), Gaps = 1/337 (0%)

Query: 54  STVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY 113
           S ++ RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEY
Sbjct: 46  SNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEY 105

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
           RTYKI+AGT  VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMI
Sbjct: 106 RTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMI 165

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233
           TLIEDLHAHDLIYRDIKPDNFLIGRP QPD NK+HLIDFGMAK YRDPKTKQHIPYRE+K
Sbjct: 166 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERK 225

Query: 234 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 293
           SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK
Sbjct: 226 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 285

Query: 294 KRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWM 353
           KR+TNVYDLS G PVQFGRYLEIVR+L FEETPDY GYRK                  WM
Sbjct: 286 KRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWM 345

Query: 354 KLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK 390
           KLNGGRGWDLTINKKPNLHGYGHPNPPN+K RRH++K
Sbjct: 346 KLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNK 381

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/332 (87%), Positives = 301/332 (90%)

Query: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKI 118
           RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQL+DEY+TYKI
Sbjct: 59  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKI 118

Query: 119 LAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178
           L GT  +P AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIED
Sbjct: 119 LNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           LHAHDLIYRDIKPDNFLIGRP QPDAN +HLIDFGMAK YRDPKTKQHIPYREKKSLSGT
Sbjct: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTN 298
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKRSTN
Sbjct: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTN 298

Query: 299 VYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGG 358
           VYDL+QGLPVQFGRYLEIVR+L FEE PDY+GYRK                  WMKLN G
Sbjct: 299 VYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDG 358

Query: 359 RGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK 390
           RGWDL INKKPNLHGYGHPNPPNEK R+HR+K
Sbjct: 359 RGWDLNINKKPNLHGYGHPNPPNEKSRKHRNK 390

>Scas_697.12
          Length = 529

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/336 (84%), Positives = 299/336 (88%)

Query: 54  STVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY 113
           ST +  D++TIVGLH++IGKKIGEGSFGVLFEG NMING PVAIKFEPRKTEAPQLKDEY
Sbjct: 33  STSTHDDNSTIVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEY 92

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
           RTYKILAGT  +P AYYFGQEGLHNILVIDLLGPSLEDLFDWC RRFSVKTVVQVAVQMI
Sbjct: 93  RTYKILAGTPNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMI 152

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233
           TLIEDLHA+DLIYRDIKPDNFLIGRP QPD N +HLIDFGMAK YRDPKTKQHIPYREKK
Sbjct: 153 TLIEDLHANDLIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKK 212

Query: 234 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 293
           SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEK
Sbjct: 213 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEK 272

Query: 294 KRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWM 353
           KR+TNVYDL+QGLPVQF RYLE+VRNL FEETPDY GYR+                  WM
Sbjct: 273 KRTTNVYDLAQGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWM 332

Query: 354 KLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRS 389
           KLNGG+GWDL INKKPNLHGYGHP PPNEK RRHR+
Sbjct: 333 KLNGGKGWDLNINKKPNLHGYGHPTPPNEKSRRHRT 368

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/363 (78%), Positives = 306/363 (84%), Gaps = 14/363 (3%)

Query: 63  TIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGT 122
           TI GLH++IGKKIGEGSFGVLFEGTN+ING+PVA+KFEPRKTEAPQLKDEYRTYKILAGT
Sbjct: 35  TIAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGT 94

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            GVPQAYYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVVQVAVQMITLIEDLHAH
Sbjct: 95  PGVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAH 154

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           DLIYRDIKPDNFL+GRP QPD N +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 155 DLIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 214

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKR+T+VYDL
Sbjct: 215 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDL 274

Query: 303 SQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGGRGWD 362
           + G PVQF RYLEIVRNLGF+ETPDY+GYRK                  WM+LNGGRGWD
Sbjct: 275 ANGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD 334

Query: 363 LTINKKPNLHGYGHPNPPNEKGRRHRSKYXXXXXXXXXXXXXDPRYGSSQLQLQQRLDPT 422
           LTINKKPNLHGYGHPNPP +K  R+R+               D  +G         LDPT
Sbjct: 335 LTINKKPNLHGYGHPNPPGDKSHRNRN------AAKGGNHANDANHGG--------LDPT 380

Query: 423 SYE 425
           SYE
Sbjct: 381 SYE 383

>Scas_627.4
          Length = 475

 Score =  433 bits (1114), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/337 (60%), Positives = 247/337 (73%), Gaps = 18/337 (5%)

Query: 64  IVGLHFKIGKKIGEGSFGVLFEGTNMINGV---PVAIKFEPRKTEAPQLKDEYRTYKILA 120
           IVG+H+ +G KIGEGSFGV+FEG N++      PVAIKFEPR ++APQL+DE+R+YKIL 
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 121 GTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             +G+P  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 181 AHDLIYRDIKPDNFLIGRPDQ-------------PDANKVHLIDFGMAKLYRDPKTKQHI 227
            HDLIYRDIKPDNFLI +  +              D N ++L+DFGMAK +RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 228 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 287
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 288 EKIGEKKRSTNVYDL--SQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXXXXXXXXXXX 345
           EKIG  K+  N  DL  +  +P QF  YL+  R+L FE+ PDYD                
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 346 XXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNPPNE 382
                 WM LN G+GWD+ INK+ NLHGYG+PNP N+
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQ 346

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  432 bits (1111), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 207/359 (57%), Positives = 248/359 (69%), Gaps = 35/359 (9%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGV-----------------PVAIK 98
           +S R    IVG+H+ +G KIGEGSFGV+FEG N+++                   PVAIK
Sbjct: 1   MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIK 60

Query: 99  FEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR 158
           FEPR ++APQL+DE+R Y+IL G  G+P AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR
Sbjct: 61  FEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGR 120

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR----------------PDQP 202
           +FSVKT   VA QMI  +  +H HDLIYRDIKPDNFLI +                    
Sbjct: 121 KFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNN 180

Query: 203 DANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALG 262
           D N ++++DFGMAK YRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LG
Sbjct: 181 DPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG 240

Query: 263 HVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYD--LSQGLPVQFGRYLEIVRNL 320
           HVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  D  L+  +P QF  YL+  R+L
Sbjct: 241 HVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSL 300

Query: 321 GFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNP 379
            F+E PDYD                      WM LNGG+GW++ IN++ NLHGYG+PNP
Sbjct: 301 KFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  429 bits (1103), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 247/345 (71%), Gaps = 22/345 (6%)

Query: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMING-----VPVAIKFEPRKTEAPQLKDEY 113
           R    +VG+H+ +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+++APQL+DE+
Sbjct: 4   RGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEF 63

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
           R Y+IL G  G+P+AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI
Sbjct: 64  RAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMI 123

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQP----------------DANKVHLIDFGMAKL 217
             +  +H  DLIYRDIKPDNFLI    +                 DAN ++++DFGMAK 
Sbjct: 124 ERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQ 183

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 277
           YRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQG
Sbjct: 184 YRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQG 243

Query: 278 LKAPNNKQKYEKIGEKKRSTNVYDL-SQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXX 336
           LKAPNNK KYEKIG  K+     +L S+ +PVQF  YL+  R+L F+E PDYD       
Sbjct: 244 LKAPNNKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMD 303

Query: 337 XXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNPPN 381
                          WM LN   GW++ +NK+ NLHGYG+P+P N
Sbjct: 304 SVMHDLNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRN 348

>Kwal_47.17314
          Length = 421

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 206/361 (57%), Positives = 249/361 (68%), Gaps = 26/361 (7%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMIN--GVPVAIKFEPRKTEAPQLKDEY 113
           +SGR    IVG+H+ +G KIGEGSFGV+FEG N++N    PVAIKFEPR+TEAPQL+DE+
Sbjct: 1   MSGRTQH-IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEF 59

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
           R YKIL G  G+P+A+YFGQEG+HN+L+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI
Sbjct: 60  RAYKILNGLEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMI 119

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQP----------------DANKVHLIDFGMAKL 217
             ++ +H  DLIYRDIKPDNFLI    +                 + N V+++DFGMAK 
Sbjct: 120 RRVQSIHQRDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQ 179

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 277
           YRDPKTKQHIPY+E+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQG
Sbjct: 180 YRDPKTKQHIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQG 239

Query: 278 LKAPNNKQKYEKIGEKKRSTNVYD-LSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXXX 336
           LK  N K KYEKIG  K+     D L + +P QF  YL   R+L FEE PDYD       
Sbjct: 240 LKVANTKLKYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMT 299

Query: 337 XXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEKG------RRHRSK 390
                          W+ LN G+GW++ +N++ NLHGYG+P P   +       R HR  
Sbjct: 300 QALQERGYEEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAARKSAPRAHRDS 359

Query: 391 Y 391
           Y
Sbjct: 360 Y 360

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  420 bits (1079), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/367 (56%), Positives = 251/367 (68%), Gaps = 37/367 (10%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMI-------------------NGV-PV 95
           +S R    +VG+H+ +G KIGEGSFGV+FEG N++                   N V PV
Sbjct: 1   MSKRGSQHVVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPV 60

Query: 96  AIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDW 155
           AIKFEPR+++APQL+DE+R Y+IL G +G+P AYYFGQEG+HN+L+IDLLGPSLEDLF+W
Sbjct: 61  AIKFEPRRSDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEW 120

Query: 156 CGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR----------------P 199
           CG RFSVKT   VA QMI  +  +H  DLIYRDIKPDNFLI                   
Sbjct: 121 CGHRFSVKTTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSS 180

Query: 200 DQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 259
              D N ++++DFGMAK YRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 181 SNGDPNLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 240

Query: 260 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG-EKKRSTNVYDLSQGLPVQFGRYLEIVR 318
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+R +    LS G+P QF  YL+  R
Sbjct: 241 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCR 300

Query: 319 NLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPN 378
           NL F+E PDYD                      WM LN G+GW++ +N++ NLHGYG+P 
Sbjct: 301 NLKFDEDPDYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPT 360

Query: 379 PPNEKGR 385
           P ++K +
Sbjct: 361 PRDQKAK 367

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  418 bits (1074), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 245/348 (70%), Gaps = 20/348 (5%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMING---VPVAIKFEPRKTEAPQLKDE 112
           +S R    +VG+H+ +G KIGEGSFG++FEG N++NG    PVAIKFEPR++++PQL+DE
Sbjct: 1   MSKRSSQHVVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDE 60

Query: 113 YRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 172
           +R Y+IL    G+P AYYF QEG+HNIL+IDLLGPSLEDLF+WC R+FSVKT   +A QM
Sbjct: 61  FRAYRILNDVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQM 120

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQP----------------DANKVHLIDFGMAK 216
           I  +  +H HDLIYRDIKPDNFLI    +                 DAN ++++DFGMAK
Sbjct: 121 IDRVRSIHEHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAK 180

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
            +RDP TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQ
Sbjct: 181 QFRDPNTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQ 240

Query: 277 GLKAPNNKQKYEKIGEKKRSTNVYD-LSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKXX 335
           GLKA NNK KYEKIG  K+     D L+  +P QF  YL   R+L F++ PDYD      
Sbjct: 241 GLKALNNKAKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLM 300

Query: 336 XXXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEK 383
                           WM LNGG+GW++ +NK+ NLHGYG+P P N K
Sbjct: 301 TQIMQENGYEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/362 (55%), Positives = 243/362 (67%), Gaps = 46/362 (12%)

Query: 64  IVGLHFKIGKKIGEGSFGVLFEGTNMIN---------------------------GVPVA 96
           +VG+H+ +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 97  IKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 156
           IKFEPR ++APQL+DE+R Y+IL G+ G+P AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQP-------------- 202
           GR+FS+KT   +A QMI  +  +H HDLIYRDIKPDNFLI    +               
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 203 ---DANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 259
              D N ++++DFGMAK YRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 260 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYD--LSQGLPVQFGRYLEIV 317
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  LS  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 318 RNLGFEETPDYDGYRKXXXXXXXXXXXXXXXXXXWMKLNGGRGWDLTINKKPNLHGYGHP 377
           R+L F+E PDYD                      WM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 378 NP 379
            P
Sbjct: 377 QP 378

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  316 bits (809), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/264 (56%), Positives = 196/264 (74%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD ++  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK    V  L Q
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQLCQ 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDY 266

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 197/264 (74%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K +RD +T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQLCV 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPIEFVEYMRYCRNLRFDERPDY 266

>Scas_720.24
          Length = 473

 Score =  313 bits (801), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 194/264 (73%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+F+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGTGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPIEFADYMNYCRNLKFDERPDY 266

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  313 bits (801), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 194/264 (73%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPLEFSEYMNYCRNLKFDERPDY 266

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 193/264 (73%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYASL 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQLCA 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDY 266

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 194/264 (73%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  F+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R Y+ L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C RRFS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   KQKY++I EKK + +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCS 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   +NL F+E PDY
Sbjct: 243 GLPLEFQEYMAYCKNLKFDEKPDY 266

>Kwal_56.24064
          Length = 475

 Score =  310 bits (795), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 193/264 (73%), Gaps = 2/264 (0%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +P   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQLCA 242

Query: 305 GLPVQFGRYLEIVRNLGFEETPDY 328
           GLP++F  Y+   RNL F+E PDY
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDY 266

>Scas_690.12
          Length = 488

 Score =  257 bits (657), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 127/265 (47%), Positives = 181/265 (68%), Gaps = 3/265 (1%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILA-GTS 123
           VG  +++G++IG GSFG ++ G ++I+G  +AIK E  +T  PQL+ E R Y  ++ G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 183
           G+P    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 184 LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 243
            ++RDIKP+NFL+G   +  AN V+LIDFG++K YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTGRR--ANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLS 303
           +NTH G EQSRRDD+E+LG+V  YF +G LPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 304 QGLPVQFGRYLEIVRNLGFEETPDY 328
           +GLP QF  Y+  VR+L +++ PDY
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDY 267

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 123/272 (45%), Gaps = 49/272 (18%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILA-----GTS 123
           FK G+++G+GS+  +   T   +G   A+K   ++    Q K +Y T + LA     GT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 124 GVPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRRFSVKTVVQVAVQMITL 175
           G+ + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLY-RDPK-TKQHIP---- 228
           ++ LH   +I+RDIKP+N L+      D N KV L DFG AK+   +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 288
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 289 KIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320
           K+ + +     Y  + G P       +IV++L
Sbjct: 348 KVMKIQ-----YAFTAGFP-------QIVKDL 367

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 110/237 (46%), Gaps = 31/237 (13%)

Query: 62   TTIVGLHFKIGKK--IGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLKDEY 113
            ++I  L  +  K+  IG GSFG ++   N+  G  +A+K       +  K   P LK+E 
Sbjct: 1250 SSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 114  RTYKILAGTSGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV- 168
            R  +IL   + V    Y+G E +H    NI +    G SL  L +    R   + V QV 
Sbjct: 1310 RVMEILNHPNIVQ---YYGVE-VHRDKVNIFMEFCEGSSLASLLE--HGRIEDEMVTQVY 1363

Query: 169  AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             +Q++  +  LH   +++RDIKP+N L+ R        +  +DFG AKL     +K+   
Sbjct: 1364 TLQLLEGLACLHQSGVVHRDIKPENILLDR-----NGVIKYVDFGAAKLIAKNGSKRISL 1418

Query: 229  YREKKS-----LSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 278
                KS     + GT  YM+  T  G+   +   DD+ +LG V    + G+ PW  L
Sbjct: 1419 DANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 119/254 (46%), Gaps = 36/254 (14%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLKDEYRTYKILAGTS 123
           FK G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + L  + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 124 GVPQAYYFGQE--GLHNILVIDLLGPSLE------DLFDWCGRRFSVKTVVQVAVQMITL 175
           GV + Y+  Q+   L+ +L     G  L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY-RDPKTKQHIPYREKKS 234
           I+ +H + +++RDIKP+N L+      +  KV L DFG AKL  RD K+  ++  ++ +S
Sbjct: 294 IDFIHKNGVVHRDIKPENILLD-----EHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSRS 347

Query: 235 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 294
             GTA Y+S         + + D+ A G + +  + G+ P+   KA N    ++K+ + +
Sbjct: 348 FVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKVQ 404

Query: 295 RSTNVYDLSQGLPV 308
                Y  + G P+
Sbjct: 405 -----YAFTAGFPL 413

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 111/251 (44%), Gaps = 27/251 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTS 123
           FK G+ +G+GS+  +   T + +G   A K   ++    Q K +Y      T + L  +S
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRL-NSS 258

Query: 124 GVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 178
            VP     YF  +   N+  +    P+ +  F    +RF   S +       Q++  I  
Sbjct: 259 RVPGVIKLYFTFQDEANLYFLLEYAPNGD--FLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY-RDPKTKQHIPYREKKSLSG 237
           LH   +I+RD+KP+N L+ +       K+ L DFG AKL  R+ + K +      KS  G
Sbjct: 317 LHKQGIIHRDVKPENILLDK-----TMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVG 371

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRST 297
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+   +   
Sbjct: 372 TAEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKVMRVQ--- 425

Query: 298 NVYDLSQGLPV 308
             Y  + G P+
Sbjct: 426 --YAFTAGFPM 434

>Scas_618.8
          Length = 427

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 106/212 (50%), Gaps = 22/212 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLKDEYRTYKILAGT 122
           ++ GK +G GSFGV+ E T   N   VAIK       E  + +   L DE    K L   
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHHP 86

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 180
           + V    +F  E    I ++  L    E LFD   +  RFS    V++ +Q+++ +E +H
Sbjct: 87  NIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQILSAVEYIH 143

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA- 239
           + D+++RD+KP+N L+   ++ D+  V + DFG+AK   + K  + + ++   SL   A 
Sbjct: 144 SRDIVHRDLKPEN-LLYLTEKEDSELV-IADFGIAK---ELKKGEQLIFKAAGSLGYVAP 198

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRG 271
             ++++ H      +  D+ ++G + +  L G
Sbjct: 199 EVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 104/223 (46%), Gaps = 34/223 (15%)

Query: 75   IGEGSFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLKDEYRTYKILAGTSGVPQA 128
            IG GSFG ++   N+  G  +A   IKF  RKT     P ++DE    ++L   + V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQ-- 1254

Query: 129  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMITLIEDLHAHD 183
             Y+G E +H    NI +    G SL  L      R   + V QV ++QM+  +  LH   
Sbjct: 1255 -YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQMLEGLAYLHESG 1310

Query: 184  LIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTK-----QHIPYREKKSLSG 237
            + +RDIKP+N L+      D N  +  +DFG AK+     +K     QH+   E + + G
Sbjct: 1311 VDHRDIKPENILL------DFNGIIKYVDFGAAKVLASNGSKKLNLEQHM---EGEKMIG 1361

Query: 238  TARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 278
            T  YMS     G    +   DD+ +LG V    + G+ PW  L
Sbjct: 1362 TPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>Kwal_56.22693
          Length = 984

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 118/260 (45%), Gaps = 30/260 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLKDEYRTYKILAGTS 123
           F+ G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + L    
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 124 GVPQAYYFGQE--GLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
           GV + Y+  Q+   L+ +L     G  L  +  +     S +  V  + Q++  I+ LH 
Sbjct: 218 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHH 275

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREK-KSLSGTAR 240
             +++RDIKP+N L+ +       KV L DFG A++    +T Q     E+ KS  GTA 
Sbjct: 276 KGIVHRDIKPENILLDK-----DMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAE 330

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVY 300
           Y+S           + D+ A G + F  + G+ P+   KA N    ++K+ + +     Y
Sbjct: 331 YVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ-----Y 382

Query: 301 DLSQGLPVQFGRYLEIVRNL 320
             + G P+       ++R+L
Sbjct: 383 AFTAGFPL-------VIRDL 395

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 107/226 (47%), Gaps = 18/226 (7%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT----EAPQLKD 111
           V+G+  + +    +  GK +G G+FGV+ +  N      VAIK   ++     E   L D
Sbjct: 43  VTGQPASYVNKADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYD 102

Query: 112 EYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVA 169
           E    + L   + V    +F  E      ++  L    E LFD   ++  F+    V++ 
Sbjct: 103 ELSILQKLDHPNIVKFKDWF--ESREKFYIVTQLATGGE-LFDRILKKGKFTETDAVKIV 159

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPY 229
           VQM+T +E +H+ ++++RD+KP+N L   P   D +++ + DFG+AK      ++  + +
Sbjct: 160 VQMLTAVEYMHSQNVVHRDLKPENVLYLDPS--DESQLVISDFGIAK---QLSSESQLIH 214

Query: 230 REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           R     +G+  Y++          +  D+ +LG + +  L G  P+
Sbjct: 215 RA----AGSMGYVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Kwal_26.7355
          Length = 1446

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 127/277 (45%), Gaps = 41/277 (14%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LKDEYRTYK 117
            G+ IG+GSFG +F G N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 118  ILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 177
             L  T+ V    +  +  ++++ +  + G S+  L    G +F    +  +AVQ++  + 
Sbjct: 1205 DLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLRGLS 1263

Query: 178  DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLI-DFGMAKLYRDPKTKQHIPYREKKSLS 236
             LH+  +++RD+K DN L+      D + +  I DFG++      K   +I      ++ 
Sbjct: 1264 YLHSKKILHRDMKADNLLL------DVDGICKISDFGIS------KKSNNIYSNSDMTMR 1311

Query: 237  GTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 293
            GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+         KIG+ 
Sbjct: 1312 GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV---VAAMFKIGKF 1366

Query: 294  KRSTNVYDLSQGLPVQFGR-YLEIVRNLGFEETPDYD 329
            K +  + + +Q +    G+ +L+    +  E+ P  D
Sbjct: 1367 KSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTAD 1403

>Scas_502.2
          Length = 1116

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 112/260 (43%), Gaps = 30/260 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILA------GT 122
           FK G+ +G+G++  +   T+  +G   A+K   ++    Q K +Y   + LA        
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
           S +   + F  E     L+       L  L    G   + +       Q+I  I+ +H+ 
Sbjct: 234 SIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGS-LNEECCCYYGAQIIDAIKFMHSK 292

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY--RDPKTKQHIPYREKKSLSGTAR 240
            +I+RDIKP+N L+ +       KV + DFG AK+   + P T   +  R  KS  GTA 
Sbjct: 293 GIIHRDIKPENILLDK-----DMKVKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGTAE 346

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVY 300
           Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + +     Y
Sbjct: 347 YVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ-----Y 398

Query: 301 DLSQGLPVQFGRYLEIVRNL 320
             + G P        +VR+L
Sbjct: 399 AFTAGFPT-------VVRDL 411

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 128/295 (43%), Gaps = 48/295 (16%)

Query: 46  AGVAGSNVSTVSGRDDTTIV--GLH-FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR 102
           A +   +V+  +G  +  I+  G+  FK G+ +G+G++  +   T   +G   A+K   +
Sbjct: 156 AQIVKESVNPKTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNK 215

Query: 103 KTEAPQLKDEY-----RTYKILAGTSGVPQAYYFGQE--GLHNILVIDLLGPSLE----- 150
           +    Q K +Y        + L  + G+ + ++  Q+   L+ +L     G  L      
Sbjct: 216 EYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKY 275

Query: 151 -DLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
             L + C R +S         Q+I  I+ LH+  +I+RDIKP+N L+ +       KV +
Sbjct: 276 GSLSEDCTRYYSA--------QIIDGIKYLHSKGIIHRDIKPENILLDK-----DMKVKI 322

Query: 210 IDFGMAKLYRDPKTKQHIP----YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 265
            DFG AK+       +  P        KS  GTA Y+S           R D+ A G + 
Sbjct: 323 TDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMV 382

Query: 266 FYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320
           F  + G+ P+   KA N    ++K+ + +     Y  + G PV       +VR+L
Sbjct: 383 FQMIAGKPPF---KATNEYLTFQKVMKVQ-----YAFTAGFPV-------VVRDL 422

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 106/233 (45%), Gaps = 23/233 (9%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTS 123
           FK G+ +G+GS+  +   T++ +    A+K   ++    Q K +Y      T + L  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHA 181
           G+   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 182 HDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQHIPY---REKKSLSG 237
             +I+RD+KP+N L+      D + KV L DFG A+L  D  ++  + Y       S  G
Sbjct: 273 KGVIHRDLKPENILL------DVDMKVKLTDFGTARLL-DSTSEDDLKYDLLTRSNSFVG 325

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 326 TAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 99/230 (43%), Gaps = 22/230 (9%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY-----RTYKILA--G 121
           F   +++G GS+  +++  +   G   AIK   +K    + K +Y      T  +LA   
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 122 TSGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             G+ + YY   +  +   V+D   G  L  L    GR F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
              +++RD+KP+N L+         K+ + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLS-----SEGKLMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>Kwal_23.6325
          Length = 1542

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 110/233 (47%), Gaps = 31/233 (13%)

Query: 65   VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLKDEYRTYKI 118
            V + ++  + +G G+FG +F   N+  G  +A   IK + RK+     P +K+E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 119  LAGTSGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 173
            L   + V    Y+G E +H    N+ +    G SL  L +    R   + V Q+ A+QM+
Sbjct: 1305 LNHPNVVQ---YYGVE-VHRDKVNLFMEYCEGGSLAQLLE--HGRIEDEMVTQIYALQML 1358

Query: 174  TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKV-HLIDFGMAKLYRDPKTKQHIPYREK 232
              +  LH   +++RDIKP+N L+      D N V   +DFG A+      TK      E 
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILL------DFNGVIKYVDFGAARSLAANGTKAPNVGAEG 1412

Query: 233  K-----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 278
            K     S+ GT  YMS  +  G ++ +    D+ +LG V    + G+ PW  L
Sbjct: 1413 KADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 123/276 (44%), Gaps = 45/276 (16%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LKDEYRTYK 117
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 118  ILAGTSGVPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 174
             L   + V    Y G E  +NI  + L    G S+  L    GR F    +  +  Q++ 
Sbjct: 1234 DLDHLNIV---QYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLK 1289

Query: 175  LIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKS 234
             +  LH+  +++RD+K DN L+   DQ    K+   DFG+++  +D  +   +  R    
Sbjct: 1290 GLAYLHSKGILHRDMKADNLLL---DQDGICKIS--DFGISRKSKDIYSNSDMTMR---- 1340

Query: 235  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 291
              GT  +M+   ++T  G   S + D+ +LG +      G+ PW  L+         KIG
Sbjct: 1341 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIG 1393

Query: 292  EKKRSTNVYDLSQGLPVQFGR-YLEIVRNLGFEETP 326
            + K +  + + +  L  Q GR +L+    +  E+ P
Sbjct: 1394 KSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>Scas_660.20
          Length = 957

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 104/231 (45%), Gaps = 21/231 (9%)

Query: 69  FKIGKKIGEGSFGVLFEG-----TNMINGVPVAIKFEP-RKTEAPQLKDEYRTYKILAGT 122
           F   +++G GS+  +++      T  I  + V  K    ++++   +  E  T  +LA  
Sbjct: 11  FIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKA 70

Query: 123 --SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
              G+ + YY   +  +   V+D L G  L  L     + FS        VQ++  +E +
Sbjct: 71  HHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFI 129

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 239
           H+  +I+RD+KP+N L+ R       K+ + DFG A          +   +   S  GTA
Sbjct: 130 HSQGVIHRDLKPENVLLDR-----DGKLMITDFGAAYTTTAGNNDAN---KSSSSFVGTA 181

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
            Y+S    L  + S   D+ ALG + F F+ G  P++G    N  + +EKI
Sbjct: 182 EYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKI 229

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 105/225 (46%), Gaps = 33/225 (14%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIK----------FEPRKTEAPQLKDEYRTYKILAG 121
            G+ IG+GSFG ++   N+  G  +A+K           E  K     LK E  T K L  
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDH 1213

Query: 122  TSGVPQAYYFGQE---GLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178
             + V    Y G E    ++++ +  + G S+  L    GR F  K +  +  Q+++ ++ 
Sbjct: 1214 LNIV---QYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLSGLKY 1269

Query: 179  LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
            LH+  +++RD+K DN L+   D+    K+   DFG++K  ++  +   +  R      GT
Sbjct: 1270 LHSKGILHRDMKADNLLL---DEDGICKIS--DFGISKKSKNIYSNSDMTMR------GT 1318

Query: 239  ARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
              +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1319 VFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 83/159 (52%), Gaps = 22/159 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP 126
           ++++ KKIG G +  +F+G +++N +P  IK  +P K     +K  YR  K+L   +G P
Sbjct: 50  NYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGP 104

Query: 127 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   ++++ F      F++        Q++T ++  
Sbjct: 105 NII-----GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYC 159

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           H+  +++RD+KP N +I     P+  K+ LID+G+A+ Y
Sbjct: 160 HSMGIMHRDVKPQNVMI----DPNERKLRLIDWGLAEFY 194

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 107/231 (46%), Gaps = 20/231 (8%)

Query: 53  VSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEA 106
           +  +SG+  + +    +  GK +G GSFGV+ +   +  G  VA+K   +K       + 
Sbjct: 30  IHKLSGQPSSYVNKSDYIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQL 89

Query: 107 PQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKT 164
             L DE    + L   + V    +F  E      ++  L    E LFD   ++  F+   
Sbjct: 90  QMLYDELMILQKLNHPNIVKFKDWF--ESKEKFYIVTQLATGGE-LFDRILQKGKFTEVD 146

Query: 165 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTK 224
            V++ VQ++  +E LH+ ++++RD+KP+N L    D+ D +++ L DFG+AK  ++    
Sbjct: 147 AVKIVVQILKAVEYLHSRNIVHRDLKPENLLY--LDKSDNSQLVLGDFGIAKELKNDGDL 204

Query: 225 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
            H         +G+  Y++          +  D+ ++G + +  L G  P+
Sbjct: 205 IH-------KAAGSMGYVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP- 126
           F+IGK +G+G FG ++   ++ +G   A+K  E +      ++ ++R    +  +   P 
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPN 168

Query: 127 --QAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-QMITLIEDLHAH 182
             Q Y YF  E    +L+  L+   L       GR      V    V QM   ++ +H  
Sbjct: 169 LTQLYGYFHDEKRVYLLMEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHER 226

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           ++++RDIKP+N +IG       N + L DFG + +   PK  +      +K+L GT  Y+
Sbjct: 227 NILHRDIKPENIIIGF-----NNTIKLTDFGWSVI--TPKGSK------RKTLCGTVDYL 273

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
           S      RE + + D+ ALG + +  L G  P++
Sbjct: 274 SPELIRSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 109/239 (45%), Gaps = 28/239 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMI---NGVP---VAIKFEPRKTEAPQLKDEY-----RTYK 117
           F   +++G GS+  +++  +     +G+P    AIK   +K    + K +Y      T  
Sbjct: 10  FIFKEQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHIIRENKVKYVTIEKNTLN 69

Query: 118 ILA--GTSGVPQAYY--FGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQM 172
           +LA     G+ + YY    QE L+   V+D   G  L  L    G  F          Q+
Sbjct: 70  LLAQGNNPGIVKLYYTFHDQENLY--FVLDYAPGGELLHLLQRYGT-FDEVWSKHFMCQL 126

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREK 232
           + ++E +H+  +I+RD+KP+N L+ +       ++ + DFG A +     T       E+
Sbjct: 127 VDVVEYIHSKGVIHRDLKPENVLLSK-----DGRLMVTDFGAASVVTTDGTSSDNSVSER 181

Query: 233 -KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
             S  GTA Y+S    L  +     D+ ALG + + F++G  P++G    N  Q +EKI
Sbjct: 182 AASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTFEKI 237

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 107/233 (45%), Gaps = 28/233 (12%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 122
           F+I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLKLVEHP 128

Query: 123 SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             +     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LHA
Sbjct: 129 FLIRMWGTF-QDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
           H++IYRD+KP+N L+ R        + + DFG A      K  Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDR-----NGHIKITDFGFA------KEVQTVTW----TLCGTPDY 231

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 294
           ++      +  ++  D  +LG + +  L G  P+         + YEKI + K
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGK 281

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 101/224 (45%), Gaps = 41/224 (18%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGT---SG 124
           F+IGK +G+G FG ++   +   G+  A+K  E ++     ++ ++R    + G+     
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 125 VPQAYYFGQEGLHNILVIDLL------------GPSLEDLFDWCGRRFSVKTVVQVAVQM 172
           + Q Y F  +     L+++ +            GP  E L  +               QM
Sbjct: 160 LTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASY------------FVYQM 207

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREK 232
              ++ +H+ ++++RDIKP+N LIG       N + L DFG +    D +        ++
Sbjct: 208 ANALDYMHSKNILHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KR 254

Query: 233 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
           K+L GT  Y+S      RE + + D+ ALG + +  L G  P++
Sbjct: 255 KTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 106/237 (44%), Gaps = 28/237 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPV-AIKFEPRKTEAPQLKDEY-----RTYKILAGT 122
           FK G  +G+GS+  +F  T+  +     A+K   ++    Q K +Y        + L   
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 123 SGVPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV---KTVVQVAVQMITLIED 178
           +GV   ++ F  E   N+  +    P+ +  F    ++F     +  +  + Q+I  I  
Sbjct: 178 TGVINLSFTFQDEA--NLYFLLEYAPNGD--FLSLIKKFGTLNEECTIYYSAQIIDAIGS 233

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQHIPY----REKK 233
           +H+H +I+RDIKP+N L+      D N K+ L DFG AKL +    K   P+        
Sbjct: 234 MHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSS 287

Query: 234 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           S  GTA Y+S           + D+ A G + +  + G+ P+   KA N    ++K+
Sbjct: 288 SFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQKV 341

>Kwal_33.13846
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTS 123
           F I + +G GSFG +    +  NG   A+K   ++T     +     DE R   +++   
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSHPF 124

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            +     F Q+  H  +++D + G  L  L     +RF        A ++   +E LHA 
Sbjct: 125 IIRMWGTF-QDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHAQ 182

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ +        V + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDK-----NGHVKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + F  L G  P+      N  + YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 110/270 (40%), Gaps = 47/270 (17%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILA-------- 120
           FK G  IG+G++  +   T++      A K   ++    Q K +Y + +  A        
Sbjct: 179 FKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSP 238

Query: 121 ------GTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 174
                  T     + YF  E   N   + L+      L + C R +        A Q+I 
Sbjct: 239 SVVRLFSTFQDESSLYFLLEYAPNGDFLSLMK-KYGSLDETCARYY--------AAQIID 289

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYRE--- 231
            I+ LH++ +I+RDIKP+N L+         K+ L DFG AKL          P  +   
Sbjct: 290 AIDYLHSNGIIHRDIKPENILLD-----GEMKIKLTDFGTAKLLNPTNNSVSKPEYDLST 344

Query: 232 -KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
             KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 345 RSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKV 401

Query: 291 GEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320
            + +     Y  + G P+       I+R+L
Sbjct: 402 MKVQ-----YAFTPGFPL-------IIRDL 419

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 113/275 (41%), Gaps = 61/275 (22%)

Query: 45  QAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT 104
           +A    SN +  S R     VG  +K+GK +G+GS G +    N+ NG   AIK  P++T
Sbjct: 70  EAESINSNNTKSSKRKSRDTVG-PWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRT 128

Query: 105 EAPQLKDEY------------------RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLG 146
              +++D+                   R   I  GT      Y   +E    I+++ L+ 
Sbjct: 129 YNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIERE----IVIMKLIS 184

Query: 147 -PSLE----------------------DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHA 181
            P++                       +LFD+   +   S    V    Q+I  +   H+
Sbjct: 185 HPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHS 244

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
            ++ +RD+KP+N L+ + ++     + + DFGMA L         +P +  ++  G+  Y
Sbjct: 245 FNICHRDLKPENLLLDKKNK----VIKIADFGMAAL--------ELPNKLLETSCGSPHY 292

Query: 242 MSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
            S    +G+       D+ + G + F  L G LP+
Sbjct: 293 ASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

>Kwal_56.24059
          Length = 353

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 106/233 (45%), Gaps = 28/233 (12%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 122
           F+I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLKLVDHP 101

Query: 123 SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             +     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH+
Sbjct: 102 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
           HD+IYRD+KP+N L+ R        + + DFG AK   D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDR-----NGHIKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 294
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 106/241 (43%), Gaps = 28/241 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPV-AIKFEPRKTEAPQLKDEY-----RTYKILAGT 122
           F   +++G GS+  +F+  +  +   + AIK   +K    + K +Y      T  +LA  
Sbjct: 11  FIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQK 70

Query: 123 --SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
             +G+ + YY   +  +   V+D   G  L  L    G  F+         Q+I  +E +
Sbjct: 71  HHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGT-FNDIWTRHFTAQLIDALEFI 129

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK------ 233
           H+H +I+RD+KP+N L+ R       ++ + DFG A       +     +          
Sbjct: 130 HSHGIIHRDLKPENVLLDR-----DGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDN 184

Query: 234 ----SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 289
               S  GTA Y+S    L  +     D+ ALG + + F++GQ P++G    N  + +EK
Sbjct: 185 QNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG---ENELKTFEK 241

Query: 290 I 290
           I
Sbjct: 242 I 242

>Kwal_0.96
          Length = 427

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 108/231 (46%), Gaps = 20/231 (8%)

Query: 53  VSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEA 106
           ++ +SG+ ++ +    +  GK +G GSFGV+ +   + +G  VAIK   +K       E 
Sbjct: 30  LNKLSGQPNSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVEL 89

Query: 107 PQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKT 164
             L DE    + L   + V    +F  E      ++  L    E LFD   +  +F+ + 
Sbjct: 90  QMLYDELSILQKLDHPNIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEED 146

Query: 165 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTK 224
            V++  Q++  +E LH+ ++++RD+KP+N L    +  D+  V L DFG+AK  ++    
Sbjct: 147 AVRIVYQILKAVEYLHSRNIVHRDLKPENLLY-LTEAADSQLV-LGDFGIAKELKNDDEL 204

Query: 225 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
            H         +G+  Y++          +  D+ +LG V +  L G  P+
Sbjct: 205 IH-------KAAGSMGYVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 104/239 (43%), Gaps = 36/239 (15%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------LKDEYRTYKILA 120
           +K+G+ I  GSF V+    +   G  VA+K+  +  + P+        + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 121 GTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-----AVQMITL 175
               + Q   F ++    + V++    +  DL+D+  +    +  +++       Q+ + 
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFI-KAIRERPTMRINFHSFLFQLCSA 123

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSL 235
           I   H+ D+ +RDIKP+N L+      D  +V L DFG+++          I    K   
Sbjct: 124 ISYCHSKDVSHRDIKPENVLMD-----DRGQVKLTDFGLSQ----------IGSVSKDYC 168

Query: 236 SGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLK--APNNKQKYEKI 290
            GT +Y++  T L RE   +   D  +LG   F  + G  P++     AP     +++ 
Sbjct: 169 IGTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRF 226

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 97/230 (42%), Gaps = 27/230 (11%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     T  I  +    K +   K+E      E      +    
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 124 GVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 180
            VP  + F  QE L+ +L     G    +LF    R  RF +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
             D+IYRD+KP+N L+          + L DFG+ KL    + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDY-----QGHIALCDFGLCKLNMKDEDKTD-------TFCGTPE 533

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP 126
           +++I  KIG G +  +F G +++N     IK  +P K     +K  YR  KIL   SG P
Sbjct: 85  NYEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGP 139

Query: 127 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   + ++ F      F++  +     Q++  +E  
Sbjct: 140 NVI-----GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYC 194

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 195 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 229

>Kwal_26.7635
          Length = 691

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 98/229 (42%), Gaps = 25/229 (10%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F++ K IG+GSFG + +     TN +  +    K +   K+E      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHA 181
            VP  + F       I++  + G    +LF    R  RFS+        +++  +E LH 
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFING---GELFYHLQREGRFSLSRARLYTAELLCALETLHN 474

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
            D+IYRD+KP+N L+          + L DFG+ KL    + K +       +  GT  Y
Sbjct: 475 LDVIYRDLKPENILLDH-----QGHIALCDFGLCKLNMKGQDKTN-------TFCGTPEY 522

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           ++    LG+  S+  D   LG + +  + G  P+     P   + Y+KI
Sbjct: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>Scas_711.25
          Length = 1515

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 122/274 (44%), Gaps = 43/274 (15%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LKDEYRTYK 117
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 118  ILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 177
             L   + V    +  ++ ++++ +  + G S+  L    GR F    +  +  Q++  + 
Sbjct: 1273 DLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLA 1331

Query: 178  DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 237
             LH+  +++RD+K DN L+   DQ    K+   DFG+++  +D  +   +  R      G
Sbjct: 1332 YLHSRGILHRDMKADNLLL---DQDGVCKIS--DFGISRKSKDIYSNSDMTMR------G 1380

Query: 238  TARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 294
            T  +M+   ++T  G   S + D+ +LG +      G+ PW   +         KIG+ K
Sbjct: 1381 TVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNYEV---VAAMFKIGKSK 1435

Query: 295  RSTNVYDLSQGLPVQFGR-YLEIVRNLGFEETPD 327
             +  +   +  L  Q GR +L+      FE  PD
Sbjct: 1436 SAPPIPPDTLPLISQNGRDFLDAC----FEIDPD 1465

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 122
           F+I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVL-KKQQVIRMKQIEHTNDERRMLKVVEHP 94

Query: 123 SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             +     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LHA
Sbjct: 95  FLIRMWGTF-QDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
           H++IYRD+KP+N L+ R        + + DFG AK   D  T          +L GT  Y
Sbjct: 153 HNIIYRDLKPENILLDR-----NGHIKITDFGFAKEV-DTVT---------WTLCGTPDY 197

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           ++      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 198 IAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKI 243

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 89/179 (49%), Gaps = 16/179 (8%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLKDEYRTYKILAGT 122
           +  GK +G G+FGV+ +  N   G  VA+K       +  K +   L DE    + L   
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 180
           + V    +F  E      +I  L    E LFD   ++  F+ +  V++ V++++ ++ +H
Sbjct: 97  NIVAFKDWF--ESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMH 153

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 239
           + ++++RD+KP+N L    D+ D + + + DFG+AK     K+ + + Y+   SL   A
Sbjct: 154 SQNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 109/230 (47%), Gaps = 18/230 (7%)

Query: 53  VSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT---EAPQL 109
           ++ +SG+ ++ +   ++  G+ +G GSFGV+ +   +     VAIK   +K       QL
Sbjct: 31  INKLSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQL 90

Query: 110 KDEYRTYKILAGTSGVPQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTV 165
           +  Y    IL   S  P    F    E      ++  L    E LFD    R  F+    
Sbjct: 91  QMLYEELSILQKLSH-PNIVSFKDWFESKDKFYIVTQLATGGE-LFDRILSRGKFTEVDA 148

Query: 166 VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQ 225
           V++ VQ++  +E +H+ ++++RD+KP+N L    D+ + + + + DFG+AK     K ++
Sbjct: 149 VEIIVQILGAVEYMHSKNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEE 203

Query: 226 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
            + Y+     +G+  Y++          +  D+ ++G + +  L G  P+
Sbjct: 204 DLIYKA----AGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPF 249

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 96/230 (41%), Gaps = 27/230 (11%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     TN I  +    K +   K+E      E      +    
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441

Query: 124 GVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 180
            VP  + F   E L+ +L     G    +LF    R  RF +        +++  +E LH
Sbjct: 442 IVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEALH 497

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
             D+IYRD+KP+N L+          + L DFG+ KL    + K         +  GT  
Sbjct: 498 DFDIIYRDLKPENILLDY-----QGHIALCDFGLCKLNMKDQEKT-------TTFCGTPE 545

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKL 217
           RFS         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 562

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 276
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 563 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 610

Query: 277 GLKAPNNKQKYEKIG 291
              A NN++ Y+KI 
Sbjct: 611 PFFAENNQKMYQKIA 625

>Kwal_47.18307
          Length = 621

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 105/227 (46%), Gaps = 23/227 (10%)

Query: 74  KIGEGSFGVLFEGTNMIN-GVPVAIKFEPRKTEAPQLKDEYRTYK-----ILA--GTSGV 125
           ++G+GS+  ++      N G   AIK   +K    + K +Y T +     +LA  G  G+
Sbjct: 15  RLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLAKGGHLGI 74

Query: 126 PQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 183
            + +  +   E L+ +L   + G  L  L    GR  +      +  Q++  ++ +H+  
Sbjct: 75  VKLFCTFHDIENLYFVLEY-VSGGELLALIQRLGR-LTEDLSRHITAQLVDTVDYMHSKG 132

Query: 184 LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RD+KP+N L+ +       +V + DFG A    D K +     +   S  GTA Y+S
Sbjct: 133 VIHRDLKPENVLLSQ-----EGRVVITDFGAACTAADRKFENT---KRTASFVGTAEYVS 184

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
               L  +     D+ ALG + +   +G+ P++G    N  Q +EKI
Sbjct: 185 PELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTFEKI 228

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 30/246 (12%)

Query: 41  TFSQQAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFE 100
           T S  A V  +  S    RD    VG  +K+GK +G+GS G +    NM  G   AIK  
Sbjct: 49  TASSNANVNNTKTSKRRNRD---TVG-PWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIV 104

Query: 101 PRK-TEAPQLKD-------EYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDL 152
           P+K  ++ Q+K        E    K+++    V   Y   +      LV++ +     +L
Sbjct: 105 PKKFVKSNQIKQLPYGIEREIIIMKLISH-PNVMGLYEVWENKSELYLVLEYVEGG--EL 161

Query: 153 FDWCGR--RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLI 210
           FD+     +      +    Q++  +   H  ++ +RD+KP+N L+ +  +     + + 
Sbjct: 162 FDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKR----SIKIA 217

Query: 211 DFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFL 269
           DFGMA L    K  +        +  G+  Y S    LGR+      D+ + G + F  L
Sbjct: 218 DFGMAALETSDKLLE--------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALL 269

Query: 270 RGQLPW 275
            G LP+
Sbjct: 270 TGHLPF 275

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 98/234 (41%), Gaps = 35/234 (14%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     TN I  +    K +   K+E      E      +    
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448

Query: 124 GVPQAYYF-GQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITLI 176
            VP  + F   E L+ +L   + G  L      E  FD    RF          +++  +
Sbjct: 449 IVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGRFDLSRARF-------YTAELLCAL 500

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 236
           E LH+ ++IYRD+KP+N L+          + L DFG+ KL    + K +       +  
Sbjct: 501 ETLHSLNVIYRDLKPENILLDY-----QGHIALCDFGLCKLNMKDQDKTN-------TFC 548

Query: 237 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           GT  Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 101/234 (43%), Gaps = 31/234 (13%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT--EAPQLKDEYRTYKILAGTSGVP 126
           F++ + +G+G+FG +++          A+K   +K   +  ++        IL  TS   
Sbjct: 340 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKA 399

Query: 127 QAYYFG-----QEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 179
             +  G     Q      LV D +  S  +LF    R  RF+         +++  +E L
Sbjct: 400 SPFIVGLKFSFQTPTDLYLVTDYM--SGGELFWHLQREGRFTEDRAKFYIAELVLALEHL 457

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           H +D++YRD+KP+N L+      DAN  + L DFG++K     +T          +  GT
Sbjct: 458 HDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFCGT 502

Query: 239 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 291
             Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 503 TEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFYAEDNQKMYQKIA 553

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKTEAPQLKDEYRTYKILAGTS 123
           F+I + +G GSFG +    ++ NG   AIK        R  +     DE R  K++    
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEHPF 121

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            +     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+H
Sbjct: 122 LIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ R        + + DFG AK                 +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDR-----NGHIKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 98/230 (42%), Gaps = 27/230 (11%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     TN I  +    K +   K+E      E      +    
Sbjct: 400 FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 459

Query: 124 GVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 180
            VP  + F   E L+ +L     G    +LF    +  RF +        +++  +E LH
Sbjct: 460 IVPLKFSFQSPEKLYLVLAFINGG----ELFYHLQKEGRFDLSRARFYTAELLCALETLH 515

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
           + ++IYRD+KP+N L+          + L DFG+ KL    + K +       +  GT  
Sbjct: 516 SLNVIYRDLKPENILLDY-----QGHIALCDFGLCKLNMQDQDKTN-------TFCGTPE 563

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 564 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 88/171 (51%), Gaps = 9/171 (5%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEAPQL 109
           ++G+ ++ +   ++  GK +G G+FGV+ +         VA+K   +K       +   L
Sbjct: 32  LNGQPESYVSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQML 91

Query: 110 KDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVA 169
            DE    ++L   + V    +F  +    I+    +G  L D     G+ F+ +  V + 
Sbjct: 92  YDELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK-FTERDAVSIT 150

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
           +Q+++ ++ +H+ ++++RD+KP+N L    D+ D +++ + DFG+AK  +D
Sbjct: 151 MQILSAVDYMHSKNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD 199

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 78/159 (49%), Gaps = 22/159 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP 126
           +++I  KIG G +  +F G +++N  P  IK  +P K     +K  YR  KIL   +G P
Sbjct: 49  NYEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 127 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   ++++ F      F++        Q++  ++  
Sbjct: 104 NII-----GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYC 158

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>Kwal_26.7788
          Length = 1267

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 97/217 (44%), Gaps = 26/217 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ-------LKDEYRTYKILAG 121
           +K+GK +G+GS G +    NM  G   AIK  P KT++ +       ++ E    K+++ 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVP-KTKSSRTGSLPYGIEREIIIMKLISH 116

Query: 122 TSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 179
              V   Y   +  L   LV++ +     +LFD+     R   K  +    Q+I      
Sbjct: 117 P-NVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 239
           H  ++ +RD+KP+N L+ + ++    ++ + DFGMA L    K  +        +  G+ 
Sbjct: 174 HGFNICHRDLKPENLLLDKKNK----RIKIADFGMAALQTSNKLLE--------TSCGSP 221

Query: 240 RYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
            Y S    +G+       D+ + G + F  L G LP+
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP 126
           +++I  KIG G +  +F G  ++N     IK  +P K     +K  YR  KIL   +G P
Sbjct: 49  NYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 127 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 179
                   GL++I+      +  L+   ++++ F      F +  +     Q++  ++  
Sbjct: 104 NVV-----GLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYC 158

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVP 126
           +++I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL   +G P
Sbjct: 49  NYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 127 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   +++  F      F+++ +     Q++  ++  
Sbjct: 104 NVI-----GLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYC 158

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMI----DPAQKKLRLIDWGLAEFY 193

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 106/230 (46%), Gaps = 17/230 (7%)

Query: 71  IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTS--GVPQA 128
           I + +G+G+F  + +      G   A+K   ++     +    R  ++L   +   + + 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 129 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIY 186
             F ++     +V++ +     DL D+     +V      +++ Q++T I+ +H+  + +
Sbjct: 260 KGFYEDTESYYMVMEFVSGG--DLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 187 RDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQ----HIPYREKKSLSGTARYM 242
           RD+KPDN LI   +Q D   V + DFG+AK+  +    +     + Y   + + G    +
Sbjct: 318 RDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSV 374

Query: 243 SINTHLGR-EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 291
           S + +  R E S   DM ++G + +  L G LP+ G       Q Y++IG
Sbjct: 375 SPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 99/228 (43%), Gaps = 36/228 (15%)

Query: 75   IGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLKDEYRTYKILAGTSGVPQA 128
            IG G+FG ++   N+ NG  +A+K          K   P +K+E    ++L   + V   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQ-- 1097

Query: 129  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMITLIEDLHAHD 183
             Y+G E +H    NI +    G SL  L D    R   + V QV   +++  +  LH   
Sbjct: 1098 -YYGVE-VHRDKVNIFMEYCEGGSLASLLD--HGRIEDEMVTQVYTFELLEGLAYLHQSG 1153

Query: 184  LIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQH---------IPYREKK 233
            +++RDIKP+N L+      D N  +  +DFG A+     +T+           +  +   
Sbjct: 1154 VVHRDIKPENILL------DFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLN 1207

Query: 234  SLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGQLPWQGL 278
             + GT  YM+  T  G     +   DD+ ALG V      G+ PW  L
Sbjct: 1208 EMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 103/233 (44%), Gaps = 24/233 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK-----TEAPQLKDEYRTYKIL--AG 121
           F   +++G GS+  ++      +    AIK   ++      +   +  E  T  +L  A 
Sbjct: 10  FLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQAN 69

Query: 122 TSGVPQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
             G+ + YY    QE L+ ++ +   G  L+ L     R FS         Q++  +E +
Sbjct: 70  HPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRR--QRVFSEAWARHYMCQLVDTVEYI 127

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY--RDPKTKQHIPYREKKSLSG 237
           H+  +I+RD+KP+N L+ +       ++ + DFG A      D  +    P     S  G
Sbjct: 128 HSMGVIHRDLKPENVLLDK-----EGRLMIADFGAAYTVGQSDAGSDGDKP---ATSFVG 179

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           TA Y+S    L  +     D+ ALG + + FL+G  P++G    N  + +E+I
Sbjct: 180 TAEYVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQ---NEMETFEQI 229

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 90/179 (50%), Gaps = 18/179 (10%)

Query: 50  GSNVST-VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP- 107
           GS VS  VS   D + VG +++I K +GEGSFG +    ++  G  VA+K   +K  A  
Sbjct: 20  GSYVSNKVSSLADGSRVG-NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKS 78

Query: 108 ----QLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FS 161
               +++ E  +Y  L     + + Y   +     I+VI+  G    +LFD+  +R   S
Sbjct: 79  DMQGRIEREI-SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMS 134

Query: 162 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
            +   +   Q+I+ +E  H H +++RD+KP+N L+      +   V + DFG++ +  D
Sbjct: 135 EQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEA----PQLKDEYRTYKILAG 121
            G+ IG+GSFG ++   N+  G  +A+K      F  +   A      LK E  T K L  
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 122  TSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             + V    +  + G++++ +  + G S+  L    GR F  + +  +  Q++  +  LH+
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 182  HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
              +++RD+K DN L+   D     K+   DFG++      +   +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLL---DNDGVCKIS--DFGIS------RKSNNIYSNSDMTMRGTVFW 1208

Query: 242  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
            M+   ++T  G   S + D+ +LG V      G+ PW   + 
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 108/249 (43%), Gaps = 35/249 (14%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGV-PVAIKFEPRKTEAPQLKDEY-----RTYKILA- 120
            F   +++G GS+  +++  +  +   P AIK   ++    + K +Y      T  +LA 
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 121 -GTSGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 178
               G+ + YY   +  +   V+D   G  L  L    G  F+       A Q++  +E 
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGT-FTDSWAKHFAAQLVDTLEF 128

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQH--------IP-- 228
           +HA  +I+RD+KP+N L+ +        + + DFG A    +   K +        IP  
Sbjct: 129 MHARGVIHRDLKPENVLLSK-----EGILMITDFGAAATQNNFSDKDNTRSNANEGIPKD 183

Query: 229 -------YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 281
                    E  S  GTA Y+S    L  + S   D+ ALG + + F++G  P++G    
Sbjct: 184 DVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG---E 240

Query: 282 NNKQKYEKI 290
           N  + +EKI
Sbjct: 241 NELKTFEKI 249

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 100/222 (45%), Gaps = 21/222 (9%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAG--- 121
           V   FK  + IG G FGV+++G N+  G   AIK     +++ +++D  R  + LA    
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 122 TSGVPQAY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
            S + + Y  Y     L  I++    G SL  L      +   K +  +  +++  ++ +
Sbjct: 79  ISNITRYYGSYLKDTSLW-IIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCI 135

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 239
           H  ++I+RDIK  N LI      +   V L DFG+A        +       +++++GT 
Sbjct: 136 HKDNVIHRDIKAANVLIT-----NEGNVKLCDFGVAAQVNQTSLR-------RQTMAGTP 183

Query: 240 RYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
            +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 184 YWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>Scas_703.5
          Length = 749

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKL 217
           RF+ +       +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 441 RFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 494

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 276
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 495 DLKDRT---------NTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WS 542

Query: 277 GLKAPNNKQKYEKIG 291
              A +N++ Y+KI 
Sbjct: 543 PFFAEDNQKMYQKIA 557

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 99/236 (41%), Gaps = 33/236 (13%)

Query: 57  SGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTY 116
           S  D    +   FK  + IG G FG++++G ++      AIK     +   +++D  R  
Sbjct: 4   SNEDKEKDISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREI 63

Query: 117 KILAGTSGVPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTV 165
           + LA    +P    Y+G           L G SL  + ++C            +   K +
Sbjct: 64  QFLASLKQIPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYI 114

Query: 166 VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQ 225
             +  +++  ++ +H  ++I+RDIK  N LI    Q     V L DFG+A        + 
Sbjct: 115 GVIMRELLVALKVIHKDNVIHRDIKAANVLITNEGQ-----VKLCDFGVAAQLNQTSLR- 168

Query: 226 HIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
                 +++++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 169 ------RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>Kwal_47.16761
          Length = 744

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKL 217
           RF+         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 431 RFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILL------DANGNIALCDFGLSKA 484

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 276
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 485 DLKDRT---------NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WS 532

Query: 277 GLKAPNNKQKYEKIG 291
              A +N++ Y+KI 
Sbjct: 533 PFFAEDNQKMYQKIA 547

>Scas_613.5
          Length = 517

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 103/235 (43%), Gaps = 41/235 (17%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTE----APQLKDEYRTYKILAGTS 123
           + +GK +G G +  + EG N + G  VA+K F P++ +    + Q ++E      +   +
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 124 GVPQAYYF----GQEGLHNILVIDLLGPSLEDLFD-----WCGRRFSVKTVVQVAVQMIT 174
            V    +F     +  +   LV+D +     +LF+      C R+   K +     Q++ 
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDG--ELFERIVKKTCLRQDETKAIFN---QILM 318

Query: 175 LIEDLHAHDLIYRDIKPDNFL--IGRPDQPDAN------------KVHLIDFGMAKLYRD 220
            ++ LH  ++I+RDIKP+N L  I R   P+              +V + DFG+AK   +
Sbjct: 319 GLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE 378

Query: 221 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
                    +   +L GT  Y++      +  + + DM + G + +  L G  P+
Sbjct: 379 --------MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPF 425

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTS 123
           F+I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++   
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPF 211

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            +     F Q+  H  +V+D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 212 IIRMWGTF-QDSQHVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 269

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ +        + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDK-----NGHIKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>Scas_689.25*
          Length = 409

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 25/214 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTS 123
           F I +  G GSFG +    ++ NG   A+K   ++T     +     DE R   + +  +
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSV-SVHA 157

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHA 181
            + + +   Q+  H  +++D +     +LF    R  RF        A ++   ++ LH+
Sbjct: 158 FIVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
            D+IYRD+KP+N L+ R        + + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDR-----NGHIKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 103/235 (43%), Gaps = 33/235 (14%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT--EAPQLKDEYRTYKILAGTSGVP 126
           F++ + +G+G+FG +++          A+K   +K   +  ++        IL  T+   
Sbjct: 304 FEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS 363

Query: 127 QAYYFG-----QEGLHNILVIDLLGPSLEDLFDWCGR---RFSVKTVVQVAVQMITLIED 178
             +  G     Q      LV D L  S  +LF W  +   RF+ +       +++  +E 
Sbjct: 364 CPFIVGLKFSFQTPTDLYLVTDFL--SGGELF-WHLQKEGRFTEERAKFYIAELVLALEY 420

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 237
           LH +D++YRD+KP+N L+      DAN  + L DFG++K     +T          +  G
Sbjct: 421 LHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFCG 465

Query: 238 TARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 291
           T  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 466 TTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 517

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 103/238 (43%), Gaps = 35/238 (14%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
           + +GK +G G + ++ E  N   G  VA+K F P++ +  +   ++R    +      P 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 128 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 177
                        +  +   LV++ +     +LFD   ++ S+      A+  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 178 DLHAHDLIYRDIKPDNFL--IGRPDQPDAN------------KVHLIDFGMAKLYRDPKT 223
            LH+ ++I+RDIKP+N L  I R   PD              +V + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 224 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 281
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIK----------FEPRKTEAPQLKDEYRTYKILAG 121
            G+ IG+GSFG ++ G N+  G  +A+K           E     A  L  E  T K L  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 122  TSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             + V    +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYG-HFDEQLIRFLTTQVLEGLAYLHL 1245

Query: 182  HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
              +++RD+K DN L+   D     K+   DFG++      +   +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLL---DNDGVCKIS--DFGIS------RKSNNIYSNSEMTMRGTVFW 1294

Query: 242  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
            M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 160 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI----GRPDQPDANKVHLIDFGMA 215
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R D     K  + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 216 KLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           +LY           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 101/247 (40%), Gaps = 52/247 (21%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDE---YRTYKILAGTSGV 125
           +K+GK +G+GS G +    NM  G   AIK  P+K       +      +Y     TS V
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNV 140

Query: 126 PQAYYFGQE----------GLH-NILVIDLLGPS------------------LE-----D 151
                  +E          G+   I+++ L+  +                  LE     +
Sbjct: 141 SSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGE 200

Query: 152 LFDWCGRR--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           LFD+   +     +  +    Q++  +   H+ ++ +RD+KP+N L+ + ++    ++ +
Sbjct: 201 LFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR----RIKI 256

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYF 268
            DFGMA L         +P +  K+  G+  Y S    +GR       D+ + G V F  
Sbjct: 257 ADFGMAAL--------ELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFAL 308

Query: 269 LRGQLPW 275
           L G LP+
Sbjct: 309 LTGHLPF 315

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 105/252 (41%), Gaps = 27/252 (10%)

Query: 46  AGVAGSNVSTVSGRDDTTIVGLH-FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT 104
           AG+       +  RD +    L  F+I + +G GSFG +    +  NG   A+K   + T
Sbjct: 64  AGICLVKKPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHT 123

Query: 105 -----EAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGR 158
                +     DE R   I++    +     F Q+     +V+D + G  L  L     +
Sbjct: 124 IVKLKQVEHTNDERRMLSIVSHPFIIRMWGTF-QDSQQVFMVMDYIEGGELFSLLR-KSQ 181

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           RF        A ++   +E LH+ D+IYRD+KP+N L+ +        + + DFG AK  
Sbjct: 182 RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDK-----NGHIKITDFGFAKYV 236

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 278
            D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+   
Sbjct: 237 PD------VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN- 285

Query: 279 KAPNNKQKYEKI 290
              N  + YE I
Sbjct: 286 --SNTMKTYENI 295

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 104/233 (44%), Gaps = 31/233 (13%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRT-YKILAGTSG---VP 126
           GK++G G + ++ E  N I G  VA+K F P+K +  +   ++R   KIL G +    V 
Sbjct: 158 GKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVK 217

Query: 127 QAYYFGQEGLHNILVIDLLGPSLED--LFDWCGRRFSVKTVVQVAV--QMITLIEDLHAH 182
               F +    + +   L+   ++D  LFD   R+  +      A+  Q++  ++ LH  
Sbjct: 218 LLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDR 277

Query: 183 DLIYRDIKPDNFL--IGRPDQPDANK------------VHLIDFGMAKLYRDPKTKQHIP 228
           ++I+RDIKP+N L  I R   PD  +            V + DFG+AK   +        
Sbjct: 278 NIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE-------- 329

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 281
            +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 28/229 (12%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 122
           F I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLKLVEHP 109

Query: 123 SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             +     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 110 FLIRMWGTF-QDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
           H++IYRD+KP+N L+ R        + + DFG A      K  + + +    +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDR-----NGHIKITDFGFA------KEVETVTW----TLCGTPDY 212

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           ++      +  ++  D  +LG + +  L G  P+         + YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKI 258

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKL 217
           RF+         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 422 RFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 475

Query: 218 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 276
               +T          +  GT  Y++    +     ++  D  +LG + F    G   W 
Sbjct: 476 DLKDRT---------NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WS 523

Query: 277 GLKAPNNKQKYEKIG 291
              A +N++ Y+KI 
Sbjct: 524 PFFASDNQKMYQKIA 538

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 99/234 (42%), Gaps = 26/234 (11%)

Query: 63  TIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLKDEYRTYK 117
           +IV  +F+I + +G GSFG +    +  NG   A+K        R  +     DE     
Sbjct: 81  SIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLS 140

Query: 118 ILAGTSGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 176
           I+     +     F Q+     +++D + G  L  L     +RF        A ++   +
Sbjct: 141 IVTHPFIIRMWGTF-QDAQQIFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLAL 198

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 236
           E LH+ D+IYRD+KP+N L+ +        + + DFG AK   D      + Y    +L 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDK-----NGHIKITDFGFAKYVPD------VTY----TLC 243

Query: 237 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           GT  Y++      +  ++  D  + G + +  L G  P+      N  + YEKI
Sbjct: 244 GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>Scas_721.124
          Length = 684

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 93/233 (39%), Gaps = 33/233 (14%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     T  I  +    K +   K+E      E      +    
Sbjct: 351 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPF 410

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITLIE 177
            VP  + F       +++  + G  L      E  FD    RF        A +++  +E
Sbjct: 411 IVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRF-------YAAELLCALE 463

Query: 178 DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 237
            LH  ++IYRD+KP+N L+          + L DFG+ KL      K         +  G
Sbjct: 464 TLHNLNVIYRDLKPENILLDY-----QGHIALCDFGLCKLNMKDDDKTD-------TFCG 511

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           T  Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 512 TPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 561

>Scas_660.28
          Length = 623

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 101/222 (45%), Gaps = 25/222 (11%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP-----QLKDEYRTYKILAGT 122
           +++I K +GEGSFG +    +M  G  VA+K   +K  A      +++ E    ++L   
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 104

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 180
             + + Y   +     I+V++  G    +LFD+  +R   S     +   Q+I+ +E  H
Sbjct: 105 H-IIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
            H +++RD+KP+N L+      +   V + DFG++ +  D            K+  G+  
Sbjct: 161 RHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTDGNF--------LKTSCGSPN 207

Query: 241 YMSINTHLGREQSRRD-DMEALGHVFFYFLRGQLPWQGLKAP 281
           Y +     G+  +  + D+ + G + +  L  +LP+     P
Sbjct: 208 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIP 249

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 22/141 (15%)

Query: 150 EDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           E +FD    RF        A +++  ++ LH  D++YRD+KP+N L+          + L
Sbjct: 469 EGIFDISRARF-------YASELLLALDSLHKMDVVYRDLKPENILLDS-----QGHIAL 516

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 269
            DFG+ KL      K         +  GT  Y++    LG+  ++  D   LG + +  L
Sbjct: 517 CDFGLCKLNMKDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEML 569

Query: 270 RGQLPWQGLKAPNNKQKYEKI 290
            G  P+      N  + Y+KI
Sbjct: 570 TGLPPYYD---ENVSEMYKKI 587

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 104/248 (41%), Gaps = 51/248 (20%)

Query: 68  HFKIGKKIGEGSFGVLFE--GTNMINGVPVAIKFEPRK----------------TEAPQL 109
           ++K+  KIGEG+F  +F+  G N  +  PVAIK   +K                +   ++
Sbjct: 120 NYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKV 179

Query: 110 KDEYRTYKILAGTS-GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVV 166
            +E   +K+++  +    +   F +   +  LV +L+     ++FD   +   FS     
Sbjct: 180 LNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDLAR 237

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLI---------GRPDQPD----------ANKV 207
            V  Q+   I+ +H   +++RD+KP+N L          G   + D             V
Sbjct: 238 HVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLV 297

Query: 208 HLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 267
            L+DFG+AK  R+            K+  GT  Y++      +  S + DM ++G V F 
Sbjct: 298 KLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFT 348

Query: 268 FLRGQLPW 275
            L G  P+
Sbjct: 349 LLCGYPPF 356

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 16/160 (10%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKT 223
           TV   A ++   ++ LH+  ++YRD+KP+N L+ +        + L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQ-----NGHLVLTDFGLSKSSASNAS 325

Query: 224 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 277 GLKAPNNKQKYEKIGEKKRSTNV-YDLSQGLPVQFGRYLE 315
           G    N+K    KI   K+   + Y LS G+    G  L+
Sbjct: 386 G---ANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLK 422

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 81/178 (45%), Gaps = 28/178 (15%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  N++    +A+K    +TE   Q   E +  ++L         ++F +
Sbjct: 375 LGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLR 434

Query: 134 ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIEDLHAHDL 184
                    H  LV +LL  +L +L      +F   S++ +     Q++  +  L    L
Sbjct: 435 MYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCVLKESKL 492

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFG-------------MAKLYRDPKTKQHIPY 229
           I+ D+KP+N L+  PD+P+   + +IDFG              ++ YR P+    IPY
Sbjct: 493 IHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPY 547

>Kwal_33.13984
          Length = 649

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 24/176 (13%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  N++    +A+K    K+E   Q   E +  ++L G       ++F +
Sbjct: 284 LGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQGEHHFLR 343

Query: 134 ------EGLHNILVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIY 186
                    H  LV +LL  +L +L         S+  +   A Q++  +  L  H LI+
Sbjct: 344 MHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLKEHKLIH 403

Query: 187 RDIKPDNFLIGRPDQPDANKVHLIDFGMA-------------KLYRDPKTKQHIPY 229
            D+KP+N L+   D+P+   + +IDFG A             + YR P+    IPY
Sbjct: 404 CDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVILGIPY 456

>Scas_690.13
          Length = 354

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 104/233 (44%), Gaps = 28/233 (12%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 122
           F++ + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLKLVEHP 102

Query: 123 SGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
             +     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+
Sbjct: 103 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
           H++IYRD+KP+N L+ R        + + DFG AK   D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDR-----NGHIKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 294
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTP---MKTYEKILQGK 255

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 81/178 (45%), Gaps = 28/178 (15%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  N+     +A+K    ++E   Q   E +  ++L         ++F +
Sbjct: 367 LGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNNKHHFLR 426

Query: 134 ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIEDLHAHDL 184
                    H  LV +LL  +L +L      +F   S++ +    +Q++  +  L    L
Sbjct: 427 MHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCVLKDSKL 484

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFG-------------MAKLYRDPKTKQHIPY 229
           I+ D+KP+N L+  PD+PD   + +IDFG              ++ YR P+    IPY
Sbjct: 485 IHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIILGIPY 539

>Scas_648.17
          Length = 340

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 76/166 (45%), Gaps = 38/166 (22%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
           ++I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL   +G P 
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 128 AYYFGQEGLHNILVIDLLG---------PSL--EDLFDWCGRR----FSVKTVVQVAVQM 172
                        VI+LL          P+L  E++ +   R+    F++  +     Q+
Sbjct: 105 -------------VIELLDIVQDPGSKIPALIFEEVKNMDFRQLYPTFTLPDIQFYFTQL 151

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           +  +   H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 152 LIALNYCHSMGIMHRDVKPQNVMI----DPKERKLRLIDWGLAEFY 193

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 16/160 (10%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP-----QLKDEYRTYKILAGT 122
           +++I K +GEGSFG +    +   G  VA+K   +K  A      +++ E    ++L   
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRH- 112

Query: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 180
             + + Y   +     I+VI+  G    +LFD+  +R   S +   +   Q+I+ +E  H
Sbjct: 113 PHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
            H +++RD+KP+N L+      +   V + DFG++ +  D
Sbjct: 170 RHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 204

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 96/223 (43%), Gaps = 34/223 (15%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQA 128
           +K+GK +G+GS G +    NM +G   AIK  P++         +   ++ A   G+ + 
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNV------RHNQKQVTALPYGIERE 114

Query: 129 YYFGQEGLH-NILVI-------DLLGPSLE-----DLFDWCGRR--FSVKTVVQVAVQMI 173
               +   H NI+ +         L   LE     +LFD+   R     +  +    Q++
Sbjct: 115 IIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIV 174

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233
             +   H  ++ +RD+KP+N L+ + ++     V + DFGMA L            R  +
Sbjct: 175 QGVSYCHNFNICHRDLKPENLLLDKKNK----TVKIADFGMAAL--------ETTNRLLE 222

Query: 234 SLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
           +  G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 223 TSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 12/123 (9%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           RFS+        +++  ++ LH  D+IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDY-----QGHIALCDFGLCKLN 492

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 278
                K         +  GT  Y++    LG+  ++  D   LG + +  + G  P+   
Sbjct: 493 MKDNDKT-------DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545

Query: 279 KAP 281
             P
Sbjct: 546 NVP 548

>Scas_717.69
          Length = 674

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 93/230 (40%), Gaps = 27/230 (11%)

Query: 69  FKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTS 123
           F + K IG+GSFG + +     T  I  +    K +   K+E      E      +    
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404

Query: 124 GVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 180
            VP  + F   E L+ +L     G    +LF    +  RF +        +++  +E LH
Sbjct: 405 IVPLKFSFQSPEKLYLVLACINGG----ELFYHLQKEGRFELSRARFYTAELLCALETLH 460

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
             D+IYRD+KP+N L+          + L DFG+ KL    + K         +  GT  
Sbjct: 461 NLDVIYRDLKPENILLDY-----QGHIALCDFGLCKLNMKDQDKT-------DTFCGTPE 508

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           Y++    L +  S+  D   LG + +  L G  P+     P   + Y KI
Sbjct: 509 YLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP---KMYRKI 555

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 18/145 (12%)

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYR 230
           Q+   ++ +H  ++I+RDIKP+N LIG       N + L DFG + +  +P      P  
Sbjct: 210 QIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWSII--NP------PEN 256

Query: 231 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
            +K++ GT  Y+S      RE     D  ALG + F  L G  P++          Y++I
Sbjct: 257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTTYKRI 313

Query: 291 G--EKKRSTNVYDLSQGLPVQFGRY 313
              + K  +N+   +Q L ++  +Y
Sbjct: 314 AALDIKMPSNISQDAQDLILKLLKY 338

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           RF +        +++  +++LH  D++YRD+KP+N L+          + L DFG+ KL 
Sbjct: 441 RFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDY-----QGHIALCDFGLCKLN 495

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 278
                K         +  GT  Y++    LG   ++  D   LG + +  L G  P+   
Sbjct: 496 MKDDDKT-------DTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDE 548

Query: 279 KAPNNKQKYEKI 290
             P   + Y+KI
Sbjct: 549 DVP---KMYKKI 557

>Scas_700.54
          Length = 698

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 102/228 (44%), Gaps = 28/228 (12%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTS--GVPQAYYFG 132
           +G+G+F  + +      G   A+K   ++     ++   R  ++L       + +   F 
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELEVLQQLDHPRIVRLKGFY 288

Query: 133 QEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIK 190
           ++     +V++ +     DL D+     +V  +   +++ Q++  ++ +H+  + +RD+K
Sbjct: 289 EDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLK 346

Query: 191 PDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 250
           PDN LI   +Q D   V + DFG+AK+  +            K+  GT  Y++     G+
Sbjct: 347 PDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIGGK 395

Query: 251 --------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
                   E S   DM ++G + +  L G LP+ G      +Q Y++I
Sbjct: 396 GETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQLYKQI 440

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 103/232 (44%), Gaps = 18/232 (7%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT---EAPQLKDE 112
           V+G+  + +    +  GK +G G+FGV+ +   + +G  VA+K   +K    ++ QL+  
Sbjct: 33  VTGQPSSYVNKSDYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQML 92

Query: 113 YRTYKILAGTSGVPQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQV 168
           Y    IL   +  P    F    E      ++  L    E LFD    +  F     V +
Sbjct: 93  YDELSILQQLNH-PNIVRFKDWFESKEKFYIVTQLATGGE-LFDRILEKGKFCEVDAVFI 150

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ LH  ++++RD+KP+N L    ++ D + + + DFG+AK  +D     H  
Sbjct: 151 VKQILQGVQYLHQRNIVHRDLKPENIL--YLNKSDDSPLVIGDFGIAKELKDDNELIH-- 206

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
                  +G+  Y++          +  D+ ++G + +  L G  P+    A
Sbjct: 207 -----KAAGSMGYVAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPFLAESA 253

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 67/139 (48%), Gaps = 10/139 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      + S + +     Q++T +E LH+  L +RD+K DN +I      +   V L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVIN-----NQGIVKL 562

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A+++  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 269 LRGQLPWQGLKAPNNKQKY 287
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 104/247 (42%), Gaps = 27/247 (10%)

Query: 51  SNVSTVSGRDDTTIVGLH-FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT----- 104
           S+ ST+  R  +    L+ F+I + +G GSFG +    +  NG   A+K   + T     
Sbjct: 126 SSTSTLKARVTSGKYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLK 185

Query: 105 EAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVK 163
           +     DE     I++    +     F Q+     +++D + G  L  L     +RF   
Sbjct: 186 QVEHTNDERNMLSIVSHPFIIRMWGTF-QDSQQLFMIMDYIEGGELFSLLR-KSQRFPNP 243

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKT 223
                A ++   +E LH+  +IYRD+KP+N L+ +        + L DFG AK   D   
Sbjct: 244 VAKFYAAEVCLALEYLHSKGIIYRDLKPENILLDK-----NGHIKLTDFGFAKYVPD--- 295

Query: 224 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 283
              + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+      N 
Sbjct: 296 ---VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNT 345

Query: 284 KQKYEKI 290
            + YE I
Sbjct: 346 IKTYENI 352

>Kwal_47.18233
          Length = 598

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 78/159 (49%), Gaps = 16/159 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTS 123
           ++I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 89

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHA 181
            + + Y   +     ++VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
           H +++RD+KP+N L+      +   V + DFG++ +  D
Sbjct: 147 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 180

>Kwal_56.24091
          Length = 381

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 13/117 (11%)

Query: 160 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYR 219
           F+  T      QM   +  +H+ ++++RDIKP+N L+G       N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 220 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
                 ++   ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 28/178 (15%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  NM     VA+K    KTE   Q   E +  ++L         ++F +
Sbjct: 279 LGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLNQHHFLR 338

Query: 134 ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIEDLHAHDL 184
                    H  LV +LL  +L +L      +F   S+  +     Q++  +  L    L
Sbjct: 339 LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSLCVLKESKL 396

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMA-------------KLYRDPKTKQHIPY 229
           I+ D+KP+N L+  PD+P+   + +IDFG A             + YR P+    IPY
Sbjct: 397 IHCDLKPENVLLVSPDRPE---LKVIDFGSACEEARTVYTYIQSRFYRAPEVLMGIPY 451

>Scas_616.10
          Length = 1461

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 110/281 (39%), Gaps = 64/281 (22%)

Query: 42  FSQQAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP 101
            SQQ     ++  T S +  +      +K+GK +G+GS G +    N+  G   AIK  P
Sbjct: 74  LSQQDSQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVP 133

Query: 102 RKTEAPQLKDEYRTYKILAGTSGV---------------------PQAYYFGQEGLHNIL 140
           +K +   +K  +      +  S                       P  Y   +E    I+
Sbjct: 134 KKHKL-FMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIERE----IV 188

Query: 141 VIDLLG-PSLE----------------------DLFDWCGRR--FSVKTVVQVAVQMITL 175
           ++ L+  P++                       +LFD+   +   S K  V    Q+I  
Sbjct: 189 IMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQG 248

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSL 235
           +   H+ ++ +RD+KP+N L+ + ++     + + DFGMA L         +P +  ++ 
Sbjct: 249 VSYCHSFNICHRDLKPENLLLDKKNK----SIKIADFGMAAL--------ELPNKLLQTS 296

Query: 236 SGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
            G+  Y S    +G+       D+ + G + F  L G LP+
Sbjct: 297 CGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 95/210 (45%), Gaps = 15/210 (7%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ-----LKDEYRTYKILAGTSGVPQ 127
           + +G GSFGV+     + +   VA+K   ++          + DE    + L   + V  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 128 AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYR 187
             +F  E    I+     G  L D     G+ ++ +  V + VQ++  +E LH+ ++I+R
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGK-YTEEDAVNIVVQILKAVEYLHSQNIIHR 187

Query: 188 DIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTH 247
           D+KP+N L    D+   +++ L DFG+A   R  +    + YR     +G+  Y++    
Sbjct: 188 DLKPENLLY--LDKSKDSRIVLADFGIA---RQLENDDDVIYRP----AGSLGYVAPEVF 238

Query: 248 LGREQSRRDDMEALGHVFFYFLRGQLPWQG 277
                 +  D+ ++G + +  L G  P++ 
Sbjct: 239 TSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 78/159 (49%), Gaps = 16/159 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTS 123
           +++ K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 97

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHA 181
            + + Y   +     I+VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
           H +++RD+KP+N L+      +   V + DFG++ +  D
Sbjct: 155 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>Scas_720.94
          Length = 1683

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 112/252 (44%), Gaps = 47/252 (18%)

Query: 62   TTIVGLHFKIGKK--IGEGSFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLKDEY 113
            ++I  L  +  K+  IG G+FG ++   N+ NG  +A   IK +  KT     P +K+E 
Sbjct: 1352 SSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEM 1411

Query: 114  RTYKILAGTSGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV- 168
               ++L   + V    Y+G E +H    NI +    G S+  L +    R   + V QV 
Sbjct: 1412 TVLEMLNHPNIVQ---YYGVE-VHRDKVNIFMEYCEGGSMASLLE--HGRIEDEMVTQVY 1465

Query: 169  AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMA-KLYRDPKTKQH 226
             ++++  +  LH   +++RDIKP+N L+      D N  +  +DFG A K+ ++     +
Sbjct: 1466 TLELLEGLAYLHQAGVVHRDIKPENILL------DFNGIIKYVDFGAARKIAKNGTKVTN 1519

Query: 227  IPYREKK-----------------SLSGTARYM---SINTHLGREQSRRDDMEALGHVFF 266
            I  + K                   + GT  YM   SI  +  + +   DD+ + G V  
Sbjct: 1520 INSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVL 1579

Query: 267  YFLRGQLPWQGL 278
              + G+ PW  L
Sbjct: 1580 EMITGRRPWANL 1591

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 47/195 (24%)

Query: 69  FKIGKKIGEGSFGVLF--------------EGTNMINGVPVAIKFE-------------P 101
           +K+ +++G GSFG +               EGT M   +   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 102 RKTEAPQLKDEYRTYKI-----LAGTSGVPQAY-YFGQEGLHNI-LVIDLLGPSLEDLFD 154
             T  P L D  R  +I     +   + + Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 155 WCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQ------------ 201
              RR FS+ T+  +  Q+++ I  +HAH+  +RDIKP+N LI   ++            
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 202 PDANKVHLIDFGMAK 216
           PD   V + D+G+A+
Sbjct: 218 PDNYVVKIADYGLAR 232

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 97/221 (43%), Gaps = 28/221 (12%)

Query: 69  FKIGKKIGEGSFGVLFEG---TNMINGVP--VAIKFEPRKTEAPQLKDEYRTYKILAGTS 123
           + IG  +GEG FG +  G    +  N VP  VAIK   R T       E + Y+ +    
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 124 GV--PQAYYFGQEGLHNILVIDLLGPSLE--DLFDWC--GRRFSVKTVVQVAVQMITLIE 177
            +  P   Y  +E L N   I ++   +   + + +    RR    +  ++  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 178 DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA-KLYRDPKTKQHIPYREKKSLS 236
            +H   L++RD+K +N L+ + +      + + DFG   + + D +          K+  
Sbjct: 165 YMHYKGLVHRDLKLENLLLDKHEN-----LVITDFGFVNEFFEDNEL--------MKTSC 211

Query: 237 GTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 275
           G+  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 212 GSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 115/269 (42%), Gaps = 38/269 (14%)

Query: 44  QQAGVAGSNVSTVSGRD-DTTIVGLH--FKIGKKI-GEGSFGVLFEGTNMINGVPVAIKF 99
           Q+    G  VS+ S  + +  + G++  F I  ++ G G+F  + +      G   A+K 
Sbjct: 159 QELSSQGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKI 218

Query: 100 EPRKTEAPQLKDEYRTYKILAGTS--GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCG 157
             ++     +    R  ++L   +   +     F ++  +  +V++ +     DL D+  
Sbjct: 219 INKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGG--DLMDFVA 276

Query: 158 RRFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
              +V      +++ Q++  I+ +H+  + +RD+KPDN LI   +Q D   V + DFG+A
Sbjct: 277 AHGAVGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILI---EQDDPVLVKITDFGLA 333

Query: 216 KLYRDPKTKQHIPYREKKSLSGTARYMSINTHLG--------------REQSRRDDMEAL 261
           K+  +            K+  GT  Y++     G               E S   DM ++
Sbjct: 334 KVQGNGSI--------MKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSM 385

Query: 262 GHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           G + F  L G LP+ G      +Q YE+I
Sbjct: 386 GCLVFVILTGHLPFSG---STQEQLYEQI 411

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK--LYRDP 221
           TV   A ++   ++ LH+  ++YRD+KP+N L+      +   + L DFG++K  ++ D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLN-----ERGHLVLTDFGLSKKSVFDDA 336

Query: 222 KTKQH-IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 278
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 279 KAPNNKQKYEKIGEK 293
           K   NK K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 16/149 (10%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLI--DFGMA-KLYRD 220
           TV   A ++   +  LH   ++YRD+KP+N L+ +       + HL+  DFG++ K   D
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQ-------RGHLVLTDFGLSKKSAND 305

Query: 221 PKTKQHIPYREKK--SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 278
               +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G+ P+ G 
Sbjct: 306 SAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG- 364

Query: 279 KAPNNKQKYEKIGEKKRSTNV-YDLSQGL 306
              N+K    KI + K+   + + LS+G+
Sbjct: 365 --SNHKVIINKIQQNKQGPKIPFYLSEGM 391

>Scas_698.37
          Length = 347

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 73/158 (46%), Gaps = 22/158 (13%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
           ++I  KIG G +  +F G +++N V   IK  +P K     L+  +R  KIL   +G P 
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVK-----LRKIHRELKILWNLTGGPN 112

Query: 128 AYYFGQEGLHN-------ILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
                 + +H+        +  D+      +L+      F +  V     Q++  +   H
Sbjct: 113 IVEL-LDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAH 167

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 168 SMGIMHRDVKPQNVMI----DPVQRKLRLIDWGLAEFY 201

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 96/214 (44%), Gaps = 21/214 (9%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ---LKDEYRTYKILAGTS-- 123
           F++G+K+G+G FG ++   +  +G   A+K    K E  Q   LK   R   I  G    
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHP 158

Query: 124 GVPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            + + Y +F  E    +L+   +   L       G  F+         Q+   +  +H  
Sbjct: 159 NIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADALHYMHKK 217

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
            +I+RD+KP+N LIG       N V L DFG + L  +P+  +      +K+L GT  Y+
Sbjct: 218 RIIHRDVKPENVLIGF-----DNVVKLADFGWSIL--NPEGSK------RKTLCGTIDYL 264

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
           S      RE   + D+ ALG + +  + G  P++
Sbjct: 265 SPEMITPREYDEQVDVWALGVLAYELVVGVPPFE 298

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 69/155 (44%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F+  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          V L DFG++
Sbjct: 517 KLGFIHRDIKPDNILIDI-----RGHVKLSDFGLS 546

>Kwal_26.8796
          Length = 796

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 21/137 (15%)

Query: 151 DLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVH 208
           DL D+     SV      ++  Q++  ++ +H+  + +RD+KPDN LI R    D   V 
Sbjct: 270 DLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLKPDNILIER---DDPVLVK 326

Query: 209 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRD--------DMEA 260
           + DFG+AK+  +            K+  GT  Y++     G+    ++        DM +
Sbjct: 327 ITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGKNSGEKEGNTYSSLVDMWS 378

Query: 261 LGHVFFYFLRGQLPWQG 277
           +G + +  L G LP+ G
Sbjct: 379 IGCLVYVILTGHLPFSG 395

>Scas_651.18
          Length = 371

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 26/228 (11%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTS 123
           F+I + +G GSFG +    +  NG   A+K   + T     +     DE     +++   
Sbjct: 59  FQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVVSHPF 118

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V     F Q+     +++D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 119 LVRMWGTF-QDFEQVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSM 176

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ +        + + DFG AK   D      I Y    +L GT  Y+
Sbjct: 177 DIIYRDLKPENILLDK-----NGHIKITDFGFAKYVPD------ITY----TLCGTPDYI 221

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 222 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---SNTMKTYENI 266

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 104/241 (43%), Gaps = 47/241 (19%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQAYY 130
           GK++G G + ++ E  N   G  VA+K F P++ +     D+ RT K    T  +    +
Sbjct: 104 GKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLSIQH 158

Query: 131 -------------FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITL 175
                          +  +   LV++ +     +LF+   R+ +++     A+  Q++  
Sbjct: 159 PNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQLLNG 216

Query: 176 IEDLHAHDLIYRDIKPDNFLIG---------------RPDQPDANKVHLIDFGMAKLYRD 220
           ++ LH+ ++I+RDIKP+N L+                  D+ D  +V + DFG+AK   +
Sbjct: 217 LKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDI-QVKIADFGLAKFTGE 275

Query: 221 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
            K           +L GT  Y++    +    + R DM + G + +  L G  P+    A
Sbjct: 276 MKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLA 327

Query: 281 P 281
           P
Sbjct: 328 P 328

>Kwal_33.14434
          Length = 759

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I +        V L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINK-----HGVVKL 543

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 269 LRGQLPWQGLKAPNNKQK 286
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTS 123
           ++I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L    
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 93

Query: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHA 181
            + + Y   +     I+VI+  G    +LFD+  +R  +  +   +   Q+I+ ++  H 
Sbjct: 94  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
           H +++RD+KP+N L+      +   V + DFG++ +  D
Sbjct: 151 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 184

>Kwal_14.1273
          Length = 415

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 104/258 (40%), Gaps = 41/258 (15%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-------APQLKDEYRTYKIL-AGTSGV 125
           KI  GSF  ++   +      VA+K   + +E       A  +  E    ++L  G   V
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 126 PQAYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRRFSVKTV----VQVAVQMITLIE 177
                F +     + V++       DL+D    W  +R S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 178 DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 237
             H+  + +RDIKP+N L+       A  V L D+G++       T+  +    +    G
Sbjct: 123 YAHSCGIAHRDIKPENVLLD-----SAGNVKLADWGLS-------TRMRVSCDTRI---G 167

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL---KAPNNKQKYEKIGEKK 294
           T +Y++   +     +   D  +LG    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 295 RSTNVYDLSQGLPVQFGR 312
           R  + Y     LP++  R
Sbjct: 228 RFISEYYF---LPLRAAR 242

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 68/155 (43%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F   K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 352 FHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 409

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 410 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIH 467

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          + L DFG++
Sbjct: 468 KLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 497

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 25/185 (13%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD-----EYRTYKILAGTSGVPQ 127
           KK GEG++ V++ GT    G  +A+K    + +  Q KD       R  K L     V  
Sbjct: 14  KKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELKHVNV 69

Query: 128 A----YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 183
                 +   + L+  LV++ L   LE +       FS   +    +  +  +   H + 
Sbjct: 70  IELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127

Query: 184 LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPK---TKQHIP--YREKKSLSGT 238
           +++RD+KP+N L+     PD  ++ + DFG+A+L   P+   T   +   YR  + L G 
Sbjct: 128 ILHRDLKPNNLLLA----PDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182

Query: 239 ARYMS 243
             Y S
Sbjct: 183 KHYTS 187

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 26/153 (16%)

Query: 151 DLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVH 208
           DL D+     SV      ++  Q++  +  +H   + +RD+KPDN LI   +Q D   V 
Sbjct: 299 DLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILI---EQDDPVLVK 355

Query: 209 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI----------NTHLGREQSRRDDM 258
           + DFG+AK+ +D  T         K+  GT  Y++           N   G   S   DM
Sbjct: 356 ITDFGLAKI-QDNTTFM-------KTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSLVDM 407

Query: 259 EALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 291
            ++G + +  L G LP+ G      +Q Y++I 
Sbjct: 408 WSIGCLVYVILTGHLPFSG---STQEQLYKQIA 437

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 116/276 (42%), Gaps = 51/276 (18%)

Query: 69  FKIGKKIGEGSFGVLFEG-----TNMINGV-----PVAIKFEPRKTEAPQLKDEYRTYKI 118
           + +G  +GEG FG +  G     +N  N        VAIK   R + +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 119 LAGTSGVPQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQ 167
           +     +        +E L N   I ++      L   CG          RR       +
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV------LEYACGGEFYKYIQKKRRLKEMNACR 154

Query: 168 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHI 227
           +  Q+I+ +  +H+  L++RD+K +N L+ +    + N V + DFG    +    ++  +
Sbjct: 155 LFSQLISGVHYIHSKGLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF---CSRNEL 206

Query: 228 PYREKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 285
                K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW     PNN +
Sbjct: 207 ----MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNNPE 260

Query: 286 KYEKIGEKKRSTNVYDLSQGLPVQFGRY-LEIVRNL 320
             + IG       +Y+     P++F  Y L I R+L
Sbjct: 261 GSD-IGR------LYNYINSTPLKFPDYILPIPRDL 289

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 14/165 (8%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + I K I +G++G ++     I G   AIK   +     K +   +K E     + +   
Sbjct: 682 YDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKP 741

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + Y   Q   +  LV++ L G  L  L    G     K   Q   ++I  ++D+H  
Sbjct: 742 YVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGN-LPDKWAKQYITEVIIGVDDMHMS 800

Query: 183 DLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQH 226
            +I+ D+KPDN LI      D+N  V L DFG++++    + K+H
Sbjct: 801 GIIHHDLKPDNLLI------DSNGHVKLTDFGLSRIGLIQRHKKH 839

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 81/178 (45%), Gaps = 28/178 (15%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  N+I    +A+K    K+E   Q   E +  ++L         ++F +
Sbjct: 338 LGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNNEHHFLR 397

Query: 134 ------EGLHNILVIDLLGPSLEDLF---DWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
                    H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  L    L
Sbjct: 398 LHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCVLKDSKL 455

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMA-------------KLYRDPKTKQHIPY 229
           I+ D+KP+N L+   D+PD   + +IDFG A             + YR P+    IPY
Sbjct: 456 IHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLLGIPY 510

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 68/155 (43%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F   K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 310 FHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 367

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 425

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          + L DFG++
Sbjct: 426 KLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 455

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 68/155 (43%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F   + IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAGT  
Sbjct: 370 FHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDS 427

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIH 485

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          + L DFG++
Sbjct: 486 KLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 515

>Kwal_55.21709
          Length = 340

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 30/163 (18%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
           H++I  KIG G +  +F G  ++N     IK      +  +LK  YR  KIL   +G P 
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGPN 104

Query: 128 AYYFGQEGLHNILVIDLLGPS--------LEDL----FDWCGRRFSVKTVVQVAVQMITL 175
                      I ++D++  S         E++    F     +F++  +     Q++  
Sbjct: 105 V----------IALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIA 154

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           ++  H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 155 LDYCHSMGIMHRDVKPQNVMI----DPVERKLRLIDWGLAEFY 193

>Kwal_33.14554
          Length = 714

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 69/155 (44%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F+  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          + L DFG++
Sbjct: 419 KLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 448

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 24/182 (13%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++   T+ +   PVAIK   +P  T A   K  Y
Sbjct: 10  TQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTY 68

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + V   
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYF 124

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +I+RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 125 LYQILRGLKYVHSAGVIHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 178

Query: 229 YR 230
            R
Sbjct: 179 TR 180

>Scas_580.6
          Length = 1015

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 97/228 (42%), Gaps = 33/228 (14%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           V   F+  + IG G FG++++G ++      AIK     ++  +++D  R  + L+    
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 125 VPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQVAVQMI 173
           +P    Y+G           L   SL  + ++C            +   K +  +  +++
Sbjct: 93  IPNITRYYGSY---------LKDTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 143

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233
             ++ +H  ++I+RDIK  N LI      +   V L DFG+A        +       ++
Sbjct: 144 VALKYIHKDNVIHRDIKAANVLIT-----NEGSVKLCDFGVAAQLNQSTLR-------RQ 191

Query: 234 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 192 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 94/221 (42%), Gaps = 21/221 (9%)

Query: 70  KIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQA 128
           + G+K+G G+ G +     + + V  A+K F P+     + K +Y           +   
Sbjct: 391 RTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHEN--ETKRDY--------IKKITSE 440

Query: 129 YYFGQEGLHNILVIDLLGPSLEDLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYR 187
           Y  G    H+ +++ ++     DLF      R S + +     Q++  I  LH+  L +R
Sbjct: 441 YCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLAHR 500

Query: 188 DIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTH 247
           D+K DN ++          V +IDFG A ++  P +   +   E   + G+  Y++    
Sbjct: 501 DLKLDNCVLN-----SQGIVKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPEVC 552

Query: 248 L-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 287
           +  +   R  D+ +   ++   +  + PW+  K  +N  K+
Sbjct: 553 IFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 73/159 (45%), Gaps = 17/159 (10%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK---------FEPRKTEAPQLKDEYRTYK- 117
           H+K+   IGEG++G++    +   G  VAIK         F  R     +L   + +++ 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 118 ILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 177
           I++    V    Y   E ++  LV +L+   L+ +        S   +     Q++  ++
Sbjct: 72  IISVLDIVRPTSYQDFEAVY--LVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALK 129

Query: 178 DLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
            LH+  +I+RD+KP N L+       +  + L DFG+++
Sbjct: 130 SLHSAQVIHRDLKPSNLLLN-----SSCDLKLCDFGLSR 163

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 96/224 (42%), Gaps = 32/224 (14%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++   T+ +   PVAIK   +P  T     K  Y
Sbjct: 9   TQIFGTVFEITNRYTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSV-LAKRTY 67

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + V   
Sbjct: 68  RELKLLKHLRHENLICLEDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYF 123

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +I+RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 124 LYQILRGLKYVHSAGVIHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 177

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQ 272
            R  ++      +   N  +        D+ + G +F   + G+
Sbjct: 178 TRYYRAPEIMLTWQKYNVEV--------DIWSAGCIFAEMIEGK 213

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 20/167 (11%)

Query: 64  IVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD-----EYRTYKI 118
           +  +++   KK+GEG++ V++ G    +G  +AIK    + +  Q KD       R  K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 119 LAGT--SGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 174
           L     + V +    +  QE L+  LV++ L   LE L       F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
            +   H   +++RD+KP+N L+     PD  ++ + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLA----PDG-QLKIADFGLARTLAAP 156

>Kwal_26.8703
          Length = 444

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 21/154 (13%)

Query: 129 YY--FGQEGLHNILVID--LLGPSLEDLFDWC---GRRFSVKTVVQVAVQMITLIEDLHA 181
           YY  F +E   +I +    + G SL+ ++      G R   K + ++A  ++  +  L  
Sbjct: 219 YYGMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQE 278

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
             +I+RDIKP N L+      +A +V L DFG++ +  +             + +GT+ Y
Sbjct: 279 RKIIHRDIKPQNILLN-----EAGQVKLCDFGVSGVAVN---------SLATTFTGTSFY 324

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           M+     G+  S   D+ +LG       +GQ P+
Sbjct: 325 MAPERIQGQPYSVTSDVWSLGLTLLEVAQGQFPF 358

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 107/263 (40%), Gaps = 51/263 (19%)

Query: 52  NVSTVSGRDDTTIVGLHFKI--------GKKIGEGSFGVLFEGTNMINGVPVAIK---FE 100
           N  + S  DD  IV L  K+        G +IG GSFG ++ G N   G  +A+K    E
Sbjct: 390 NSESESECDDDNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELE 449

Query: 101 PRKTEAPQLKDEYRTY----KILAGTSGVPQ---------------------AYYFG--Q 133
           P    A    D+ +++     ++   +  PQ                       Y+G  Q
Sbjct: 450 PTTVMASS--DDKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHHENIVTYYGSSQ 507

Query: 134 EGLH-NILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPD 192
           EG + NI +  + G S+  + +  G  F    V     Q +  +  LH  ++I+RDIK  
Sbjct: 508 EGGNLNIFLEYVPGGSVSSMLNSYGP-FEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGA 566

Query: 193 NFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQ 252
           N LI          V + DFG++K       KQ+    ++ SL G+  +M+         
Sbjct: 567 NLLIDI-----KGSVKITDFGISKKLSPLNKKQN----KRASLQGSVYWMAPEVVKQVVT 617

Query: 253 SRRDDMEALGHVFFYFLRGQLPW 275
           + + D+ ++G V      G+ P+
Sbjct: 618 TEKADIWSVGCVVVEMFTGKHPF 640

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 111/263 (42%), Gaps = 52/263 (19%)

Query: 56   VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEA---PQL 109
            VS     + V + ++    IG G+FG ++   ++ NG  +A+K    +  K+     P +
Sbjct: 1253 VSLASSISNVSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLI 1312

Query: 110  KDEYRTYKILAGTSGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTV 165
            K+E    +IL   + V    Y+G E +H    NI +    G SL  L +    R   + V
Sbjct: 1313 KEEMSVLEILNHPNIVS---YYGVE-VHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMV 1366

Query: 166  VQV-AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKV-HLIDFGMAKLYRDPKT 223
             QV  +Q++  +  LH   +++RD+KP+N L+      D N V   +DFG AK   +  T
Sbjct: 1367 TQVYTLQLLEGLAYLHESGIVHRDVKPENILL------DFNGVIKYVDFGAAKKIANNGT 1420

Query: 224  K-----------------------QHIPYREKKSLS--GTARYM---SINTHLGREQSRR 255
            +                       + +   E   L   GT  YM   SI     + +   
Sbjct: 1421 RLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGA 1480

Query: 256  DDMEALGHVFFYFLRGQLPWQGL 278
            DD+ +LG V    + G+ PW  L
Sbjct: 1481 DDVWSLGCVVLEMITGRRPWANL 1503

>Scas_673.20*
          Length = 758

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 88/213 (41%), Gaps = 32/213 (15%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQAYYFG 132
           K+IGEG+ G+++    +   + VAIK    K + P+L+  +    +L          +  
Sbjct: 485 KRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQ-PRLQMIWTEMLVLKEYQHPNIINFIN 543

Query: 133 QEGLHNILVIDLL---GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED-------LHAH 182
              LH+ L I +    G SL D+         V        QM T+  +       LH+ 
Sbjct: 544 SYLLHDTLWIVMEYMDGGSLADI---------VSFFTPTEEQMATICRETLFGLNFLHSR 594

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
            +++RDIK DN L+          + + DFG      +  TK       + ++ GT  +M
Sbjct: 595 GIVHRDIKSDNILLSM-----NGDIKITDFGFCGQLTESNTK-------RTTMVGTPYWM 642

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           +      +E   + D+ +LG +    + G+ P+
Sbjct: 643 APEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 119/316 (37%), Gaps = 87/316 (27%)

Query: 55  TVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT------EAPQ 108
           TVS +D  TI    + +G   G G FG + +  +   G  VA+K  P+K          Q
Sbjct: 76  TVSDQDKKTIN--QYTLGVSAGSGQFGYVRKAYSSTLGKVVAVKIIPKKPWNAQQYSVNQ 133

Query: 109 LKDEYRTYK----ILAGTSGVPQAYYFGQE--------------GLHNILVIDLL-GPSL 149
           +  + + +K    I    SG         E               +H + +I+ L  P  
Sbjct: 134 VMRQIQLWKSKGKITTNMSGNEAMRLMNIEKCRWEIFAASRLRNNVHIVRLIECLDSPFS 193

Query: 150 EDLF---DWCG-----------------------RRFSVKTVVQVAVQMITL-IEDLHAH 182
           E ++   +WC                           SV T  +  ++ +T  +E LH+ 
Sbjct: 194 ESIWIVTNWCSLGELQWKRDDDEDILPQWKKIVISNCSVSTFAKKILEDMTKGLEYLHSQ 253

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPY----------REK 232
             I+RDIKP N L+   ++       L DFG         T Q +P+          RE 
Sbjct: 254 GCIHRDIKPSNILLDEEEK----VAKLSDFGSCIF-----TPQSLPFSDANFEDCFQREL 304

Query: 233 KSLSGTARYMSIN-THLGREQSRRD--------DMEALGHVFFYFLRGQLPWQGLKAPNN 283
             + GT  +++    HLG   S+RD        D+ +LG   +  L  +LP+ G    N 
Sbjct: 305 NKIVGTPAFIAPELCHLG--NSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFFG---ENE 359

Query: 284 KQKYEKIGEKKRSTNV 299
            + Y KI E   S+ +
Sbjct: 360 FETYHKIIEVSLSSKI 375

>Scas_651.3
          Length = 793

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 24/176 (13%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLKDEYRTYKILAGTSGVPQAYYFGQ 133
           +G+G+FG + +  N+     +A+K    ++E   Q   E +  +++         ++F +
Sbjct: 386 LGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQSITEAKILELINNKIDPENKHHFLR 445

Query: 134 ------EGLHNILVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIY 186
                    H  LV +LL  +L +L         S++ +     QM+  +  L    LI+
Sbjct: 446 MYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLKDSKLIH 505

Query: 187 RDIKPDNFLIGRPDQPDANKVHLIDFG-------------MAKLYRDPKTKQHIPY 229
            D+KP+N L+  PD+P    + +IDFG              ++ YR P+    IPY
Sbjct: 506 CDLKPENILLCSPDKP---ALKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGIPY 558

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 15/119 (12%)

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
            +RF        A ++   +E LH+ D+IYRD+KP+N L+ +        + L DFG AK
Sbjct: 168 SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDK-----NGHIKLTDFGFAK 222

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
              D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+
Sbjct: 223 YVPD------VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 91/222 (40%), Gaps = 28/222 (12%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPR-KTEAPQLKDEYRTYKILAGTS---GVPQA 128
           + I  G+F  +++  +  +   VA+K  P+ KT    +K+EY   KIL+  +    +   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 129 YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL-------H 180
             F  +  + I+V++      L D  D    + S  +   + + M  +I+ L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQH----IPYREKKSLS 236
           +  + +RDIKP+N L+          + L D+G A   + PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTI-----NGDIKLADWGHA--IQSPKSNDFQIGTDNYRAPETFS 178

Query: 237 GTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRGQL 273
           G         +  R       + + D  +LG   FY + G  
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFGDC 220

>Scas_627.7
          Length = 349

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 13/110 (11%)

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQH 226
           +   Q+   +  LH   +I+RD+KP+N LIG       N + L DFG + +  +P+  + 
Sbjct: 193 RFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWSII--NPRGVK- 244

Query: 227 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
                +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++
Sbjct: 245 -----RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 91/217 (41%), Gaps = 22/217 (10%)

Query: 66  GLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGV 125
            + +++ + IG GS+GV+++ TN      VAIK E    +  +L D      +L   + +
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 126 PQAYYFG----QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 181
               Y G    Q  L+ IL     G SL++L     R  S         Q +  +  LH 
Sbjct: 78  NIVKYHGFIQKQHNLYIILEYCAKG-SLKNLISR-NRPMSEHEAKPYVRQTLNGLNYLHE 135

Query: 182 HDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 241
             +I+RDIK  N L+        N V L DFG++       TK +       +L+G+  +
Sbjct: 136 QGVIHRDIKAANILLD-----SENVVKLADFGVS-------TKVN---NTAMTLAGSLNW 180

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 278
           M+      R  S   D+ +LG      L G  P+  L
Sbjct: 181 MAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 88/201 (43%), Gaps = 18/201 (8%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + + K I +G++G ++     + G   AIK   +     K +   +K E     + +   
Sbjct: 702 YDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 761

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + Y   Q   +  LV+  L G  +  L    G     K   Q   ++I+ ++D+H +
Sbjct: 762 YVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGN-LPEKWAKQYICEVISGVDDMHQN 820

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK--LYRDPKTKQHIPYREKKSLSGTAR 240
            +I+ D+KPDN LI          + L DFG+++  L R  K K+    R  +  S    
Sbjct: 821 GIIHHDLKPDNLLIDS-----LGHIKLTDFGLSRMGLLRRHKEKR----RNSQIQSSRNP 871

Query: 241 YMSINTHLGREQSRRDDMEAL 261
             + ++ + R+ S  D ++++
Sbjct: 872 SFTCDSSVTRKNSVTDSLQSV 892

>Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement
          Length = 434

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 96/224 (42%), Gaps = 32/224 (14%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++   T+     PVAIK   +P  T A   K  Y
Sbjct: 10  TQIFGTVFEITNRYTDLNPVGMGAFGLVCSATDTYTSQPVAIKKIMKPFST-AVLAKRTY 68

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + V   
Sbjct: 69  RELKLLKHLRHENLICLEDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYF 124

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +I+RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 125 LYQILRGLKYVHSAGVIHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 178

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQ 272
            R  ++      +   N  +        D+ + G +F   + G+
Sbjct: 179 TRYYRAPEIMLTWQKYNVEV--------DIWSAGCIFAEMIEGK 214

>Scas_713.38
          Length = 432

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 24/182 (13%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++   T+ +   PVAIK   +P  T A   K  Y
Sbjct: 10  TQIFGTVFEITNRYTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTY 68

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + V   
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYF 124

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +I+RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 125 LYQILRGLKYVHSVGVIHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 178

Query: 229 YR 230
            R
Sbjct: 179 TR 180

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 16/161 (9%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD-EYRTYKILAGTS 123
           V + F   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L+  +
Sbjct: 35  VQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLSHIN 91

Query: 124 GVPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
            +   Y+F     Q+ ++  L+++ +  SL         + +  + +++   M  L + L
Sbjct: 92  IIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSL 151

Query: 180 ----HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
               H  ++ +RDIKP N L+     P+   + L DFG AK
Sbjct: 152 NYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAK 188

>Kwal_26.8709
          Length = 829

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 98/226 (43%), Gaps = 37/226 (16%)

Query: 69  FKIGKKIGEGSFGVLFEG----TNMINGVP--VAIKFEPRKTEAPQLKDEYRTYKILAGT 122
           + +G  +GEG FG +  G    +N    VP  VAIK   R T     + E + Y+ +   
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 123 SGV--PQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWC--GRRFSVKTVVQVAVQMI 173
             +  P      +E L N   I ++   LE     + + +    RR       ++  Q+I
Sbjct: 100 KHLNHPNIVRL-EEVLQNSKYIGIV---LEYASGGEFYKYIQKKRRLKEGPACRLFAQLI 155

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLI-DFGMAKLYRDPKTKQHIPYRE- 231
           + +  +H+  L++RD+K +N L+      D N+  LI DFG    +        +P  E 
Sbjct: 156 SGVYYMHSKGLVHRDLKLENLLL------DKNENLLITDFGFVNEF--------LPENEL 201

Query: 232 KKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 275
            K+  G+  Y +    +     ++R+ D+ + G + +  L G LPW
Sbjct: 202 MKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPW 247

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 101/232 (43%), Gaps = 29/232 (12%)

Query: 62  TTIVGLH--FKIGKKI-GEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKI 118
           T + G+H  + I   I G+G+F  + +      G   A+K   ++    +     R   +
Sbjct: 182 TELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKRELDV 241

Query: 119 LAGTS--GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMIT 174
           L   +   + +   F ++  +  ++++ +     DL D+     +V      ++  Q++ 
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGG--DLMDFVAAHGTVGEDAGREITRQVLE 299

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKS 234
            ++ +H   + +RD+KPDN +I   +Q D   + + DFG+AK+                +
Sbjct: 300 AVKYMHDQGISHRDLKPDNIMI---EQDDPVLIKITDFGLAKVQNQNTFLN--------T 348

Query: 235 LSGTARYMS---INTHLGREQSRRD------DMEALGHVFFYFLRGQLPWQG 277
             GT  Y++   I+     +++ RD      DM ++G + +  L G LP+ G
Sbjct: 349 FCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSG 400

>Kwal_27.9804
          Length = 473

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 76/175 (43%), Gaps = 27/175 (15%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK---------------TEAPQ-LKDE 112
           +K+  KIGEG+F  +++  ++   V  A      K               T +PQ + +E
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 113 YRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 172
                +L G++ V           H   VI +L     + F    R   +K + +   ++
Sbjct: 86  LNLLYMLCGSTRVAP---LCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSEL 142

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKL----YRDPKT 223
           +  +  +H+  +I+RDIKP NFL      P   +  L+DFG+A+      RDP+T
Sbjct: 143 LQALSFVHSKAIIHRDIKPTNFLYS----PQLGRGVLVDFGLAETEVSHARDPET 193

>Scas_654.12
          Length = 737

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 67/155 (43%), Gaps = 17/155 (10%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           F   K IG+G+FG    V    T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 319 FHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 376

Query: 125 --VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 180
             V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIH 434

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
               I+RDIKPDN LI          + L DFG++
Sbjct: 435 KLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 464

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 69/147 (46%), Gaps = 14/147 (9%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKL----YR 219
           TV   A ++   ++ LH+  ++YRD+KP+N L+      D   + L DFG++K       
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 220 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 279
            P   + +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G+ P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 280 APNNKQKYEKIGEKKRSTNVYDLSQGL 306
             N+K    KI + K     + LS G+
Sbjct: 376 -ANHKVILSKIKQDKGIKIPHYLSDGM 401

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 92/208 (44%), Gaps = 24/208 (11%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLKDEYRTYKILAGT- 122
           ++K  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L    
Sbjct: 6   NYKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPS--TAIREISLLKELR 63

Query: 123 -SGVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIED 178
              + + Y       H + LV + L   L+   +   +      K + +  +Q+   I  
Sbjct: 64  DDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAY 123

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
            HAH +++RD+KP N LI R    D N + L DFG+A+ +        +P R       T
Sbjct: 124 CHAHRILHRDLKPQNLLINR----DGN-LKLGDFGLARAF-------GVPLRAYTHEIVT 171

Query: 239 ARYMSINTHLGREQ-SRRDDMEALGHVF 265
             Y +    LG +Q S   D+ ++G +F
Sbjct: 172 LWYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYR 230
           QM   +  +H  ++++RDIKP+N LIG       N + L DFG + +             
Sbjct: 246 QMADALNYMHDRNVLHRDIKPENILIGF-----QNTLKLTDFGWSVI--------STTGA 292

Query: 231 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
           ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 293 KRKTLCGTLDYLSPELVKYREYDEKVDVWALGVLAYELLVGTPPFE 338

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I      +   V L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVIN-----EKGIVKL 577

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 269 LRGQLPWQGLKAPNNKQK 286
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 152 LFDWCGRRFSVKT----VVQVAVQMITLIEDLHAHD--LIYRDIKPDNFLIGRPDQPDAN 205
           L D+   R   +     ++Q+  Q+   +  +HA    LI+RDIK +N LI        N
Sbjct: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISA-----NN 171

Query: 206 KVHLIDFG-MAKLYRDPKTKQHIPYREKKSL-SGTARYMS---INTHLGREQSRRDDMEA 260
           +  L DFG +  + R P+  Q + Y ++  L + TA+Y S   I+T  G     + D+ A
Sbjct: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231

Query: 261 LGHVFFYFL 269
           LG +F Y L
Sbjct: 232 LG-IFLYKL 239

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 90/236 (38%), Gaps = 61/236 (25%)

Query: 70  KIGKKIGEGSFGVLFEG-TNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQA 128
           ++G  IGEGSFG +        + V VA+KF    T                  SG+ Q 
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPT---------------CAESGLSQK 59

Query: 129 YYFGQEGLH-------NIL-VIDL------LGPSLE-----DLFDWCGRRFSVK-TVVQV 168
               +  LH       N+L VID       L   LE     DLFD       V   V Q 
Sbjct: 60  DVSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQF 119

Query: 169 AVQ-MITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHI 227
             Q +I  +  LH   + +RDIKP+N L+ +        + L DFG+A  +R       +
Sbjct: 120 YFQQLIRALNYLHDVGVAHRDIKPENILLDK-----KGNLKLADFGLASQFRRKDGTLRV 174

Query: 228 --------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
                   PY   + LS    Y +I            D+ + G + F  L G++PW
Sbjct: 175 STDQRGSPPYMAPEILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>Kwal_14.1159
          Length = 1521

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 71/155 (45%), Gaps = 12/155 (7%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + + K I +G++G +F     I G   AIK   +     K +   +K E     + +   
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGS-LPDQWVKQYISEVIYGVEDMHQS 795

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKL 217
            +I+ D+KPDN LI   DQ     + L DFG++++
Sbjct: 796 GIIHHDLKPDNLLI---DQ--RGHLKLTDFGLSRM 825

>Scas_718.72
          Length = 550

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVP-------------VAIKFEPRKTEAPQ-LKDEY 113
           ++ I  KIGEG+F  +++  ++   V              VA+K +   T +PQ + +E 
Sbjct: 47  NYNIIDKIGEGTFSSVYKAQDLKGKVTSKYASHFWKSPKYVALK-KIYVTSSPQRIYNEL 105

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
               IL G+S V               VI +L     D F    R   +K +     +++
Sbjct: 106 NLLYILTGSSKVAP---LCDAMRMRDQVIAILPYYPHDEFRTFYRDLPIKGIKMYIWELL 162

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
             +  +H+  +I+RD+KP NFL      P+  +  L+DFG+A++  D
Sbjct: 163 QALNFVHSKGIIHRDVKPTNFLFN----PELGRGVLVDFGLAEIQSD 205

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 98/229 (42%), Gaps = 39/229 (17%)

Query: 69  FKIGKKIGEGSFGVLFEG-TNMINGVP---------VAIKFEPRKTEAPQLKDEYRTYKI 118
           + +G  +GEG FG +  G T   +  P         VAIK   R T     + E + Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 119 LAGTSGV--PQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWC--GRRFSVKTVVQVA 169
           +     +  P      +E L N   I ++   LE     + + +    RR    T  ++ 
Sbjct: 104 INALKHLTHPNVVRL-EEVLQNSKYIGIV---LEYASGGEFYKYIQRKRRLKESTACRLF 159

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPY 229
            Q+I+ +  +H+ +L++RD+K +N L+ +    + N V + DFG    +        +P 
Sbjct: 160 AQLISGVTYMHSKNLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF--------LPD 206

Query: 230 RE-KKSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 275
            E  K+  G+  Y +    +      +R+ D+ + G + +  L G LPW
Sbjct: 207 NEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      +   + +  +  Q+I  ++ LH   L +RD+K DN ++ R        + L
Sbjct: 446 DLFSLVMSEKMHYEEICCLFKQLINGVKYLHDIGLSHRDLKLDNCVVTR-----RGILKL 500

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-RRDDMEALGHVFFYF 268
           IDFG + ++  P + Q I   E   + G+  Y+S       E   R  D+ ++G +FF  
Sbjct: 501 IDFGASSVFHYPLSSQMI---EANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCM 557

Query: 269 LRGQLPWQ 276
           +  + PW+
Sbjct: 558 ITRRFPWK 565

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD-EYRTYKILAGTS 123
           + + F   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L   +
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLQHRN 89

Query: 124 GVPQAYYFGQ----EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
            +   YYF +    E +   L++D +  SL         + +    +++ + M  L + L
Sbjct: 90  IIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKAL 149

Query: 180 ----HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
               H  ++ +RDIKP N L+     P++  + L DFG AK
Sbjct: 150 NYLHHTANVCHRDIKPQNLLVD----PNSWCLRLCDFGSAK 186

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 97/231 (41%), Gaps = 46/231 (19%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMIN-GVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
            ++G+ IG+GSF  +   +  ++    +A+KF       P  + +           G+ Q
Sbjct: 15  LQLGRTIGKGSFAFVKRASLEVDPSTVIAVKF----IHLPSCEKQ-----------GMSQ 59

Query: 128 AYYFGQEGLHN-----ILVIDLLGPSLEDLFDWCGRRFS------------VKTVVQVA- 169
                +  LH+     + V+ ++  +L D F W     +            +    +VA 
Sbjct: 60  EDVLREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQ 119

Query: 170 ---VQMITLIEDLH-AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQ 225
               Q+I  I  LH    + +RDIKP+N L+ +    D N + L DFG+A L++     +
Sbjct: 120 FYYKQLIKAISYLHDTCGVAHRDIKPENILLDK----DGN-LKLADFGLASLFKRKDGSK 174

Query: 226 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
            I   ++ SL   A  +    +     +   D+ ++G + F  L G+ PW+
Sbjct: 175 RISRDQRGSLPYMAPEI---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>Kwal_23.3590
          Length = 499

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 102/238 (42%), Gaps = 41/238 (17%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIKF-------EPRKTEAPQLKDEYRTYKILAGTSG 124
           GK++G G + ++ E  +  +G  VA+K        + +KT+  Q ++E +    +   + 
Sbjct: 189 GKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTK--QFREETKILMSIQHKNI 246

Query: 125 VPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIED 178
           V     F     +  +   LV++ +     +LFD   R+  ++     A+  Q++  +  
Sbjct: 247 VKLIDRFVEPVSKAQIQTFLVLEKVSDG--ELFDRIVRKTRLREDETNAIFKQILNGLRY 304

Query: 179 LHAHDLIYRDIKPDNFLIG---------------RPDQPDANKVHLIDFGMAKLYRDPKT 223
           LHA ++I+RDIKP+N L+                  D+ D   + + DFG+AK   +   
Sbjct: 305 LHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDIT-IKIADFGLAKFIGE--- 360

Query: 224 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 281
                 +   +L GT  Y++         + R DM + G + +  L G  P+    AP
Sbjct: 361 -----MQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAP 413

>Scas_655.2
          Length = 800

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I      +   V L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVIN-----EKGIVKL 582

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 269 LRGQLPWQGLKAPNNKQK 286
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 12/109 (11%)

Query: 171 QMITLIEDLHAHD-LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPY 229
           Q+++ I  LH    + +RDIKP+N L+ +        + L DFG+A  +R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDK-----NGNLKLADFGLASQFRRKDGTLRVSM 178

Query: 230 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQ 276
            ++    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLKDEYRTYKILAGTS 123
           ++K  +K+GEG++GV+++  ++ +G  +     I+ E      P       +        
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 124 GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 180
            + + Y       H + LV + L   L+   +   +      K + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
           AH +I+RD+KP N LI R        + L DFG+A+ +        +P R       T  
Sbjct: 126 AHRIIHRDLKPQNLLINR-----NGNLKLGDFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDVWSIGCIF 199

>Scas_593.14d
          Length = 495

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKL-----Y 218
           TV   A ++   ++ LH   ++YRD+KP+N L+      D   + L DFG++K       
Sbjct: 249 TVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN-----DKGHLVLTDFGLSKKSVTQNS 303

Query: 219 RDPK--TKQHIPYREKKSLS---GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 273
            +P   T  + P  +  +L    GT  Y +     G   ++  D  +LG + +  L G+ 
Sbjct: 304 ANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKP 363

Query: 274 PWQGLKAPNNKQKYEKIGEKKRSTNV-YDLSQGL 306
           P+ G    N+K    KI + K+   + Y LS+G+
Sbjct: 364 PYTG---ANHKVILNKIQKDKQGPKIPYYLSEGM 394

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 14/132 (10%)

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+    Q     V L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-----VKLCDFGVSG 372

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
              +             + +GT+ YM+     G+  S   D+ +LG        G+ P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 277 GLKAPNNKQKYE 288
             K   N   +E
Sbjct: 424 SEKMAANIAPFE 435

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 107/246 (43%), Gaps = 60/246 (24%)

Query: 55  TVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMING---VPVAIKFEPRKTEAPQ--- 108
           T+  + + +I G H+++ + +G+GS+G +    + +N    + +AIK   + T   Q   
Sbjct: 60  TIYTKANFSIPG-HYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIK---KITNIFQREV 115

Query: 109 -LKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGP-------SLEDLFDWCGRR- 159
            LK   R  K +         Y+ G + + +++ ++++           ++L D+   R 
Sbjct: 116 LLKRAIRELKFMH--------YFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARV 167

Query: 160 ------FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFG 213
                 FS   +     Q++  ++ +H+ D+I+RD+KP N L     Q     + + DFG
Sbjct: 168 IHSNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQ-----LKICDFG 222

Query: 214 MAK----LYRDPKTKQHIP-------YREKKSLSGTARYMSINTHLGREQSRRDDMEALG 262
           +A+    L+ + KT  HI        YR  + +    RY           ++  DM A+G
Sbjct: 223 LARGISPLFTNTKTSNHITNYVATRWYRAPELILSHKRY-----------NKSIDMWAIG 271

Query: 263 HVFFYF 268
            +   F
Sbjct: 272 CILAEF 277

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 91/200 (45%), Gaps = 26/200 (13%)

Query: 60  DDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLKDEYRTY 116
           DD  +  +  K+GK IG G++G++ E  ++ +G   A+K   F+  +     +  E   +
Sbjct: 478 DDKGLFIMGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVW 537

Query: 117 KILAGTSGVP---------QAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS------ 161
           K +     +P          A Y   E + +  + DL+         W  R+ +      
Sbjct: 538 KEMHHMYILPLLDWKLISDYAMYCLTERVKDGTLYDLV-------LSWEDRKNNQIPVDE 590

Query: 162 -VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRD 220
            +K  + + +Q+I+ ++ +H++  ++ DIK +N L+ +  Q     + L DFGM+  +  
Sbjct: 591 RIKLTMFLMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGS 650

Query: 221 PKTKQHIPYREKKSLSGTAR 240
            +++      E+K+ SG  R
Sbjct: 651 YRSRYDTLIDEEKNNSGIIR 670

>Scas_707.3
          Length = 1598

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 70/154 (45%), Gaps = 12/154 (7%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + I K I +G++G ++     I G   AIK   +     K +   +K E     + +   
Sbjct: 699 YTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 758

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + +   Q   +  LV++ L G  L  L    G     + V Q   ++I  ++D+H +
Sbjct: 759 YVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRN 817

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
            +I+ D+KPDN LI      +   V L DFG+++
Sbjct: 818 WIIHHDLKPDNLLID-----NLGHVKLTDFGLSR 846

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 69/156 (44%), Gaps = 19/156 (12%)

Query: 69  FKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEP-RKTEAPQLKDEYRTYKILAGTS 123
           F   K IG+G+FG    V  + T  I  +   +K E   K +   +K E     +LAG+ 
Sbjct: 303 FNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAER---DVLAGSD 359

Query: 124 G--VPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 179
              V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +
Sbjct: 360 SPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVI 417

Query: 180 HAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA 215
           H    I+RDIKPDN LI          + L DFG++
Sbjct: 418 HKLGFIHRDIKPDNILIDI-----RGHIKLSDFGLS 448

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 94/241 (39%), Gaps = 42/241 (17%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK----FEPR-------KTEAPQLKDEYRTY 116
           +F+I   +G G +G +    ++  G  VAIK    FE R       K E P++  E    
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVM 108

Query: 117 KILAGTSGVPQAYYF--GQEGLHNILVIDLL--GPSLEDLFDWCGR-RFSVKTV------ 165
           K       V + Y      E     LV++    GP       WC   +  +K V      
Sbjct: 109 K-RCHHENVVELYEILNDPESTKVYLVLEYCSRGP-----VKWCPENKMEIKAVGPSILT 162

Query: 166 ----VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
                +V + +++ +E LH+  + +RDIKP N LI          V + DFG+A      
Sbjct: 163 FQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLIS-----SNGTVKISDFGVAMSTATG 217

Query: 222 KTKQHIPYRE--KKSLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
            T     + +  K    GT  + +    +T      S   D+ +LG   +  L G+LP+ 
Sbjct: 218 STNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFN 277

Query: 277 G 277
            
Sbjct: 278 A 278

>Kwal_55.21545
          Length = 865

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 98/229 (42%), Gaps = 35/229 (15%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSG 124
           V   FK  + IG G FGV+++G         AIK     +   +++D  +  + L+    
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 125 VPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ-----------VAVQM 172
           VP   +Y+G           L    L  + ++C    S++T+++           +  ++
Sbjct: 75  VPNITHYYGSY---------LNDTKLWVIMEYCAGG-SLRTLLRPGKIGEQYIGVIMREL 124

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREK 232
           +T +  +H   +I+RDIK  N LI      +   + L DFG+A      K +       +
Sbjct: 125 LTALMHIHKDGVIHRDIKAANVLIT-----NDGHIKLCDFGVAAQLSQTKIR-------R 172

Query: 233 KSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
           ++++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH]
           complement(313261..314856) [1596 bp, 531 aa]
          Length = 531

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 68/162 (41%), Gaps = 29/162 (17%)

Query: 160 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN----KVHLIDFGMA 215
            S + V+ VA  +   + +LH+ D+I+RD+KP N L+     P +     K+ + DFG +
Sbjct: 260 LSTRQVLSVASDLAHGLRELHSLDIIHRDLKPSNCLLLGEYDPSSTENFPKILIGDFGES 319

Query: 216 KLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSR-------------RDDMEALG 262
           +L    +T            +GT  + +    L  +  R               DM +LG
Sbjct: 320 QLRGQLRT--------ATGATGTLEFTAPELVLFEDDVRVKAMTSSAPQFTFESDMYSLG 371

Query: 263 HVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQ 304
            + ++ + G+LP+     P    +  K   KK S +   L Q
Sbjct: 372 MILYFVVFGELPF----GPGGDMRLLKTQIKKYSCSASALQQ 409

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 114/261 (43%), Gaps = 43/261 (16%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK------------FEPRKTEAPQLK----- 110
           ++ + K+IG+GSF V+++G ++ +G  +AIK             E  + E   LK     
Sbjct: 20  NYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHP 79

Query: 111 ------DEYRT---YKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS 161
                 D  RT   + ++     +    +F ++  + +L   L+    E           
Sbjct: 80  HIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNG 139

Query: 162 VKTVVQVAV--QMITLIEDLHAHDLIYRDIKPDNFLIGRP--DQPDANKVHLIDFGMAKL 217
           +  V+ V    Q+ + ++ L + +L++RDIKP N L+  P  D  D    H  + G   +
Sbjct: 140 LNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFH--ELGFVGI 197

Query: 218 YRDPKTK-------QHIPYRE-KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 269
           Y  P  K       + +P     ++L G+  YM+      ++ + + D+ ++G V +   
Sbjct: 198 YNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMC 257

Query: 270 RGQLPWQGLKAPNNKQKYEKI 290
            G+ P+   KA N+ + ++KI
Sbjct: 258 CGRPPF---KASNHLELFQKI 275

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 15/185 (8%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + I K I +G++G ++     + G   AIK   +     K +   +K E     + +   
Sbjct: 782 YDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 841

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H +
Sbjct: 842 YVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGC-LPDEWVKQYLSEIIIGVEDMHNN 900

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242
            +I+ D+KP+N LI       +  + L DFG+++     K  +HIP  +  SLS      
Sbjct: 901 GIIHHDLKPENLLIDV-----SGHLKLTDFGLSRAGL-VKRHRHIP--KPISLSNADTRS 952

Query: 243 SINTH 247
           +I++H
Sbjct: 953 NIDSH 957

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 20/180 (11%)

Query: 59  RDDTTIVGLHFKIGKKIGEGSFGVLFEG----------TNMINGVPVAIKFEPRKTEAPQ 108
           RDD     L  ++GK IG G++G++ E            N        IKF+  ++   Q
Sbjct: 400 RDDKGSFILGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKFKDNRSVKRQ 459

Query: 109 LKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDW--CGR-RFSVK 163
           +  E   +  L+  + +P   +   + L    + D +  G   + +  W  CG  + S++
Sbjct: 460 VLREISIWSKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSWGECGNSKISLR 519

Query: 164 TVVQ----VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLY 218
              Q    +A+Q+I  ++ +H+  + + DIK +N L+ +  +   + K+ L DFGM+  Y
Sbjct: 520 ERCQATSALALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDWKLVLCDFGMSHFY 579

>Kwal_27.11919
          Length = 209

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLKDEYRTYKILAGTS 123
           ++K  +K+GEG++GV+++  ++ +G  V     I+ E      P       +        
Sbjct: 6   NYKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 124 GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 180
            + + Y       H + LV + L   L+   +   +        + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
           +H +++RD+KP N LI R    D N + L DFG+A+ +        +P R       T  
Sbjct: 126 SHRILHRDLKPQNLLINR----DGN-MKLADFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDIWSIGCIF 199

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 72/157 (45%), Gaps = 18/157 (11%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD--------EYRTYKILAGTSG 124
           KK+GEG++ V++ GT    G  +A+K    + +  + KD        E +  + +   + 
Sbjct: 10  KKVGEGTYAVVYVGTKQSTGRRIAVK----EIKTSEFKDGLDMSAIREVKYLQEMQHVNV 65

Query: 125 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 184
           +     F   G  N LV++ L   LE +       F+   +    +  +  +   H + +
Sbjct: 66  IELVDIFMSYGNLN-LVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCHRNFI 124

Query: 185 IYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
           ++RD+KP+N LI     PD  ++ + DFG+A+    P
Sbjct: 125 LHRDLKPNNLLIA----PDG-QIKVADFGLARAVPSP 156

>Scas_623.11
          Length = 378

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 82/162 (50%), Gaps = 18/162 (11%)

Query: 65  VGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKD-EYRTYKILAGTS 123
           + + F   + IG+GSFG++F  T       VAIK   +  +  + K+ E    K++   +
Sbjct: 43  ITITFPTTEIIGKGSFGLVFCTTIRETDEVVAIK---KVLQDRRFKNRELEIMKLIQHPN 99

Query: 124 GVPQAYYFGQEGLHNI----LVIDLLGPSL-EDLFDWCGRRFSVKTVVQVAVQMITLIED 178
            +   YYF ++ + +     L++D +  SL + L  +  +R S+ + +++   M  L + 
Sbjct: 100 VINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSM-SRLEIKFYMFQLFKS 158

Query: 179 LH----AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           L+    A ++ +RDIKP N L+     P++  + L DFG AK
Sbjct: 159 LNYLHNAKNVCHRDIKPQNILVD----PNSWNLKLCDFGSAK 196

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 20/126 (15%)

Query: 151 DLFDW-----CGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN 205
           DLF +     C    S    + +  Q++  ++ LH+  +++RD+K DN L+  P+    +
Sbjct: 243 DLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTPEP--CS 300

Query: 206 KVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS------INTHLGREQSRRDDME 259
           ++ L DFG+AK     + + H       ++ GT  Y +      ++ +  R  SR   ME
Sbjct: 301 RIVLADFGIAKDLPSTRVRMH-------TIVGTPEYCAPEVGFRVDRNSYRNFSRTASME 353

Query: 260 ALGHVF 265
             G+ F
Sbjct: 354 QQGYDF 359

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 103/224 (45%), Gaps = 33/224 (14%)

Query: 46  AGVAGSNVSTVSGR-------DDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK 98
             +A  N + +SG        DD  +  L  ++GK IG G++G++ E  ++  GV   IK
Sbjct: 419 TSIAKMNSNPLSGSAGGSARPDDKGMEILGHRLGKIIGFGAWGIIRECFDIETGVGRVIK 478

Query: 99  ---FEPRKTEAPQLKDEYRTYKILAGTSGVP---------QAYYFGQEGLHNILVIDLLG 146
              F+  +     +  E   ++ L     +P          A Y   E +++  + DL+ 
Sbjct: 479 IVKFKGHQNIKKHVLREVAIWRTLKHNRILPLLDWKLDDNYAMYCLTERINDGTLYDLVI 538

Query: 147 PSLEDLFDWCGRRFS--VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDA 204
               D F      F+   +  + +++Q+++ ++ +H+  +++ DIK +N L+ +  +   
Sbjct: 539 S--WDEFKRSKIPFAERCRLTIFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKKSD 596

Query: 205 NKVHLIDFGMA------KLYRDPKTKQHI----PYREKKSLSGT 238
            KV L DFGM+       +YR+    +++     +R++KS+  T
Sbjct: 597 WKVFLCDFGMSCHFDEKHVYRNDTFDENLSSGNSHRKRKSIEQT 640

>Scas_649.30
          Length = 648

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 70/170 (41%), Gaps = 33/170 (19%)

Query: 146 GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN 205
           G  ++D  +W            V V MI  +  L A+  I+RDIKP N L    D     
Sbjct: 216 GCDVQDFTEW------------VFVDMIKALRFLEANGCIHRDIKPANILCNARD----G 259

Query: 206 KVHLIDFGMAKL------YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSR---RD 256
              + DFG + L      ++DPK  +H    E   + GT  +++       E  R   RD
Sbjct: 260 HFQISDFGCSILLPRYVPFKDPKL-EHCFQMELNKIIGTPAFIAPELCHFNESKRNNIRD 318

Query: 257 ----DMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
               D+ +LG   +  L  +LP+ G    N    Y K+  +   +++ D+
Sbjct: 319 GFKLDIWSLGITLYCLLHNKLPFSG---ENEFDTYHKVVSESLDSDLDDV 365

>Scas_201.1*
          Length = 274

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 159 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           +F+    V + VQ++  ++ +H+ ++++RD+KP+N L   P   D +++ + DFG+AK  
Sbjct: 130 KFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLVIADFGIAK-- 185

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
            + K+   + ++     +G+  Y++          +  D+ +LG + +  L G  P+
Sbjct: 186 -ELKSNDDLIFKG----AGSLGYVAPEVLTKEGHGKPCDIWSLGVITYTLLSGYSPF 237

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+      +  +V L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLN-----EIGQVKLCDFGVSG 349

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
              +             + +GT+ YM+     G+  S   D+ +LG       +G  P+ 
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPFN 400

Query: 277 GLKAPNN 283
             K   N
Sbjct: 401 SDKMAIN 407

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 96/225 (42%), Gaps = 35/225 (15%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTSGVPQ- 127
           FK  + IG G FGV+++  ++      AIK         +++D  +  + L+     P  
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 128 AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-----------QMITLI 176
            +Y+G           L+   L  + ++C    S++T+++  +           +++  +
Sbjct: 76  THYYGSY---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILVAL 125

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 236
             +H  ++I+RDIK  N LI      +   V L DFG+A        K       +++++
Sbjct: 126 ISIHRDNVIHRDIKAANILIA-----NNGSVKLCDFGVAAQLSQSMLK-------RQTMA 173

Query: 237 GTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
           GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 174 GTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 104/250 (41%), Gaps = 67/250 (26%)

Query: 73  KKIGEGSFG-VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTSGVP 126
           K +G GS G V++EG           KF+ R     ++  ++     +  ++L+ +   P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 127 QA--YYFGQEGLHNI-LVIDLLGPSLEDLFDWCG-----RRFSVKTVVQVAVQMITLIED 178
               YY  +E    + + ++L   +LE L +        +R     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 179 LHAHDLIYRDIKPDNFLIG----RPDQP------DANKVHLIDFGMAKL--YRDPKTKQH 226
           LH+ ++I+RDIKP N LI     R  +P      +  ++ L DFG+ K   +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 227 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAL 261
           I     K+ +GT  +M+                          + +L R  ++  D+ +L
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 262 GHVFFYFLRG 271
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 108/244 (44%), Gaps = 53/244 (21%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKTEAPQLKDEYR 114
           ++KI K IGEGSFG ++   + +    V +K             F  R+ + P +    +
Sbjct: 36  NYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPNVVREVFYHRQFDFPHIT---K 92

Query: 115 TYKILAGTSGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 172
            Y+++   S V  A  Y  G+E L+  L++                R S++   ++  Q+
Sbjct: 93  LYEVIVTESKVWMALEYCPGKE-LYEYLLMQ--------------HRISLEESGKLFAQI 137

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREK 232
           ++ +   H+   ++RD+K +N L+ +       +  + DFG     R+  TK  +     
Sbjct: 138 VSAVYYAHSLQCVHRDLKLENILLDK-----KGRAKITDFGFT---RECATKTML----- 184

Query: 233 KSLSGTARYMSINTHLGREQSR---RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 289
           +++ GT  YM+    L   +S    + D+ +LG + +  + G +P+   +    K K++ 
Sbjct: 185 ETVCGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFD--EEDETKTKWKI 240

Query: 290 IGEK 293
           I E+
Sbjct: 241 INEE 244

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 35/238 (14%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLKDEYRTYKILAGTSGVPQ 127
           + +GK++G G + ++ E  N   G  VA+K F  ++ +  +   ++R    +      P 
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 128 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 177
                        +  +   LV++ +     +LF+   R+  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 178 DLHAHDLIYRDIKPDNFL--IGRPDQP--------DAN----KVHLIDFGMAKLYRDPKT 223
            LH  ++I+RDIKP+N L  I R + P        D +    +V + DFG+AK   +   
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGE--- 374

Query: 224 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 281
                 +   +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 375 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 95/231 (41%), Gaps = 31/231 (13%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ-LKDEYRTYKILAGTSGVPQAY---- 129
           I  GSF  +++G N      VA+K  P+   + + + +EY   K+L+   G P       
Sbjct: 14  IQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPFICSFVD 73

Query: 130 YFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITL-----IEDLHAH 182
           ++  E  + ++          D  +   ++   +  +++++  Q + L     I+  H+ 
Sbjct: 74  FYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAIKYAHSM 133

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHI---PYREKKSLSGTA 239
            + +RDIKP+N LI          + L D+G A +        +I    YR  ++ S   
Sbjct: 134 GIAHRDIKPENILINY-----HGDIKLADWGHA-ISASSSNDNNIGTDNYRGPETFSAKV 187

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 290
            Y   NT+       R D  ++G    Y L    P++     N K  Y+++
Sbjct: 188 SY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>Scas_711.15
          Length = 727

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 14/72 (19%)

Query: 158 RRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQ-------------PDA 204
           R FS+ ++  +  Q++  I+ +H H+  +RDIKP+N L+  P++             PD 
Sbjct: 163 RVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVS-PNKRYFDKERLELGFYPDN 221

Query: 205 NKVHLIDFGMAK 216
             V L DFG+A+
Sbjct: 222 YVVKLADFGLAR 233

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 151 DLFDW-----CGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN 205
           DLF +     C    S    + +  Q++  +  LH  D+++RD+K DN L+  P+     
Sbjct: 248 DLFSYLAKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTPEP--CT 305

Query: 206 KVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 243
           ++ L DFG+AK     K + H       ++ GT  Y +
Sbjct: 306 RIVLADFGIAKDLNSNKERMH-------TVVGTPEYCA 336

>Kwal_23.5290
          Length = 819

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 15/114 (13%)

Query: 162 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
           +  +V+   Q +  + D H   +I+RDIK DN L+      +  +V + DFG      D 
Sbjct: 647 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----NRARVKITDFGFCAKLTDK 698

Query: 222 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 699 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>Scas_689.22
          Length = 901

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 82/174 (47%), Gaps = 12/174 (6%)

Query: 55  TVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLKD 111
           T++  D    V L  K+G+ IG G++G + E +++ +G   A+K   F+        ++ 
Sbjct: 424 TLTRPDAVGNVILDHKLGRAIGAGAWGSIRECSDIQSGTRRAMKIVRFKENLNVKKHVRR 483

Query: 112 EYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGP-SLEDL-FDWC---GRRFSVKTVV 166
           E   ++ L   + +P   Y  +E      + + +   +L DL   W      + S+    
Sbjct: 484 EVSIWEQLKHENILPLLNYKFEESYAMYCLTEFINDGNLYDLAVSWSHMSNSKISLSKRC 543

Query: 167 QVAV----QMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           ++ +    Q+++ ++ +H+  + + D+K +N L+ +       KV L DFGM++
Sbjct: 544 ELTIFLGLQVVSALQYMHSKSICHGDVKLENCLLKKDKAVGNWKVLLCDFGMSR 597

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 104/273 (38%), Gaps = 82/273 (30%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVP----VAIKFEPR---------KTEAPQLKDEYR 114
           +++I  KIGEG+F  +F+   + N +     VAIK  P+         KT   Q  +E  
Sbjct: 66  NYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELN 125

Query: 115 TYKILAGTSGVPQA------------YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV 162
            +  L   + VP              YYF QE +         G     +  +    FS 
Sbjct: 126 IHLKLTK-ANVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYT--YFSE 175

Query: 163 KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFL---------------IGRPDQPDAN-- 205
                V  Q+ T ++ LH +++I+RDIKP+N +               + + D P     
Sbjct: 176 DLTRHVIRQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLD 235

Query: 206 --------------KVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS---INTH- 247
                         KV L+DFG+++L    ++    P        GT  Y++   +N + 
Sbjct: 236 EGKFIPGIGGGGIGKVRLVDFGLSRLMDPAESGARTP-------CGTFGYLAPEVLNQYK 288

Query: 248 -----LGREQSRRDDMEALGHVFFYFLRGQLPW 275
                     S + D+ A+G + +  L G  P+
Sbjct: 289 VDPRTSNTSYSYKVDIWAIGCILYTMLCGFPPF 321

>Scas_707.34
          Length = 905

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 26/160 (16%)

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRP--DQPDANKVHLIDFGMAKLYRDPKTK---- 224
           Q+ + ++ L + +L++RDIKP N L+  P  +  D    H  D G   +Y  P  K    
Sbjct: 185 QLSSALKFLRSKNLVHRDIKPQNLLLSAPLINYNDPKSFH--DLGFVGIYNLPILKIADF 242

Query: 225 ---QHIPYRE-KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 280
              + +P     ++L G+  YM+      ++ + + D+ ++G V +    G  P+   KA
Sbjct: 243 GFARFLPNTSMAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCYGNPPF---KA 299

Query: 281 PNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 320
            N+ + Y+KI  KK +  +Y         F  Y+EI  NL
Sbjct: 300 SNHLELYKKI--KKANDLIY---------FPTYIEIDNNL 328

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTS 123
           + I K I +G++G ++     + G   AIK   +     K +   +K E     + +   
Sbjct: 794 YDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 853

Query: 124 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182
            V + +   Q   +  LV++ L G  L  L    G     +   Q   +++  + D+H +
Sbjct: 854 YVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQN 912

Query: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK--LYRDPKTKQHIPYREKKSLSGT 238
            +I+ D+KP+N LI      +A  V L DFG+++  L R  K    +P++   S+S T
Sbjct: 913 GIIHHDLKPENLLID-----NAGHVKLTDFGLSRAGLIRRHK---FVPHKSSLSISST 962

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 100/226 (44%), Gaps = 51/226 (22%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKTEAPQLKDEYR 114
           +++I K++GEGSFG ++  T+ +    V +K             F  R+ E P +    +
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFIT---K 92

Query: 115 TYKILAGTSGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 172
            Y+++   + V  A  Y  G E L++ L++    P      D   R F+         Q+
Sbjct: 93  LYEVIVTETRVWMALEYCPGNE-LYDYLLLKQRIP-----LDETRRLFA---------QI 137

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQHIPYRE 231
           ++ +   H+   ++RD+K +N L+      D N    L DFG     R+  TK  +    
Sbjct: 138 VSAVFYAHSLQCVHRDLKLENILL------DKNGYAMLTDFGFT---RECATKTQL---- 184

Query: 232 KKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 275
            +++ GT  YM+    + RE     + D  +LG + +  L G +P+
Sbjct: 185 -ETVCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>Scas_613.13*
          Length = 312

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 75/180 (41%), Gaps = 30/180 (16%)

Query: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRT 115
           +S    T I    +  GKK+GEG++ V++ GT    G  +A+K    + +  + KD    
Sbjct: 1   MSTEITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVK----EIKTSEFKDGL-- 54

Query: 116 YKILAGTSGVPQAYYFGQEGLHNI--------------LVIDLLGPSLEDLFDWCGRRFS 161
                  S + +  Y  +    N+              LV++ L   LE +       F+
Sbjct: 55  -----DMSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFT 109

Query: 162 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
              +    +  +  +   H + +++RD+KP+N L+     PD   + + DFG+A+    P
Sbjct: 110 PADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLLS----PDG-VIKVADFGLARAVPSP 164

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 100/230 (43%), Gaps = 50/230 (21%)

Query: 63  TIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKTEAPQL 109
           T VG ++KI K+IGEGSFG ++  T+      V +K             F  R+ + P +
Sbjct: 37  TEVG-NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYI 95

Query: 110 KDEYRTYKILAGTSGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ 167
               + Y+++   + V  A  Y  G+E   ++L    L P+LE     C   F+      
Sbjct: 96  T---KLYEVIVTETKVWMALEYCPGKELYDHLLSKSRL-PTLE-----CAELFA------ 140

Query: 168 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDAN-KVHLIDFGMAKLYRDPKTKQH 226
              Q+   +   H  + ++RD+K +N L+      D N    L DFG     R+  TK  
Sbjct: 141 ---QITGAVHYAHTLNCVHRDLKLENVLL------DKNGNAKLTDFGFT---RESMTKAV 188

Query: 227 IPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
           +     +++ GT  YM+      +     + D+ +LG + +  L G LP+
Sbjct: 189 L-----ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 63/121 (52%), Gaps = 25/121 (20%)

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           LHA+++++RD+K +N +I      D++++ +IDFG++ +Y D + + H       +  G+
Sbjct: 260 LHANNIVHRDLKIENIMIS-----DSSEIKIIDFGLSNIY-DSRKQLH-------TFCGS 306

Query: 239 ARY-----MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 293
             +     +  N + G E     D+ + G V F  + G++P+      N+   +EKI + 
Sbjct: 307 LYFAAPELLKANPYTGPEV----DVWSFGVVLFVLVCGKVPFDD---ENSSVLHEKIKQG 359

Query: 294 K 294
           K
Sbjct: 360 K 360

>Kwal_56.22788
          Length = 515

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 18/153 (11%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYR---- 219
           TV   A ++   +  LH   ++YRD+KP+N L+      +   + L DFG++K+      
Sbjct: 238 TVAFYAAEISCALRFLHKRGVVYRDLKPENCLLD-----ERGHLVLTDFGLSKVSASDDS 292

Query: 220 ----DPKTKQH--IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 273
               D  T  H         S+ GT  Y +     G+  ++  D  +LG + F  L G+ 
Sbjct: 293 ADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKP 352

Query: 274 PWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGL 306
           P+ G+   N+K    KI + K       LS+G+
Sbjct: 353 PYTGV---NHKVILNKILKDKIPKIPSYLSEGM 382

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 95/224 (42%), Gaps = 32/224 (14%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++    +     PVAIK   +P  T A   K  Y
Sbjct: 16  TQIFGTVFEITNRYADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFST-AVLAKRTY 74

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + +   
Sbjct: 75  RELKLLKHLRHENLICLEDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFLQYF 130

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +I+RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 131 LYQILRGLKYVHSAGVIHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 184

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQ 272
            R  ++      +   N  +        D+ + G +F   + G+
Sbjct: 185 TRYYRAPEIMLTWQKYNVEV--------DIWSAGCIFAEMIEGK 220

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 14/132 (10%)

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           G R   K + ++A  ++  +  LH   +I+RDIKP N L+      +A +V L DFG++ 
Sbjct: 333 GGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLN-----EAGQVKLCDFGVSG 387

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
              +             + +GT+ YM+     G+  S   D+ +LG       +   P+ 
Sbjct: 388 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFD 438

Query: 277 GLKAPNNKQKYE 288
             K   N    E
Sbjct: 439 SGKFAANMPPIE 450

>KLLA0F22297g complement(2083448..2085547) some similarities with
           sp|P32350 Saccharomyces cerevisiae YLL019c KNS1 ser/thr
           protein kinase, hypothetical start
          Length = 699

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 7/135 (5%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQL-KDEYRTYKILAGT--SGV 125
           F+  + +G+G+FG + +  + +N + VA+K         Q  K E R  + +     SG 
Sbjct: 289 FQAMQLLGQGTFGKVVKCKDYLNDITVAVKIIRAVDRYRQAAKTELRVLQTIKENDRSGQ 348

Query: 126 PQAYY---FGQEGLHNILVIDLLGPSLEDLFDWCG-RRFSVKTVVQVAVQMITLIEDLHA 181
            Q      F     H  LV DL G S+ D     G  RF    V  +  Q++  +  LH 
Sbjct: 349 YQCLLLREFFDYKNHICLVTDLYGRSVYDFMTNNGYARFPGSHVQAIGKQLVRSVCFLHD 408

Query: 182 HDLIYRDIKPDNFLI 196
             +I+ D+KP+N LI
Sbjct: 409 LGIIHTDLKPENILI 423

>YPL031C (PHO85) [5407] chr16
           complement(492014..492914,493017..493033)
           Cyclin-dependent protein kinase that interacts with
           cyclin Pho80p to regulate phosphate pathway and with
           cyclin Pcl5p to regulate Gcn4p stability, also interacts
           with other Pho80p-like cyclins [918 bp, 305 aa]
          Length = 305

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 89/220 (40%), Gaps = 36/220 (16%)

Query: 69  FKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-------------APQLKDE--Y 113
           FK  +K+G G++  +++G N   GV VA+K     +E               +LK E   
Sbjct: 7   FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIV 66

Query: 114 RTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 173
           R Y ++   + +   + F    L   +    +G +         R   +  V     Q++
Sbjct: 67  RLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNT--------PRGLELNLVKYFQWQLL 118

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKK 233
             +   H + +++RD+KP N LI +  Q     + L DFG+A+ +        IP     
Sbjct: 119 QGLAFCHENKILHRDLKPQNLLINKRGQ-----LKLGDFGLARAF-------GIPVNTFS 166

Query: 234 SLSGTARYMSINTHLG-REQSRRDDMEALGHVFFYFLRGQ 272
           S   T  Y + +  +G R  S   D+ + G +    + G+
Sbjct: 167 SEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGK 206

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (44%), Gaps = 30/175 (17%)

Query: 165 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRP--DQPDANKVH-------------- 208
           VV    Q+ + ++ L + +L++RDIKP N L+  P  D  D  + H              
Sbjct: 143 VVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILK 202

Query: 209 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 268
           + DFG A+    P T         ++L G+  YM+      ++ + + D+ ++G V +  
Sbjct: 203 IADFGFARFL--PNTSL------AETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEM 254

Query: 269 LRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFE 323
             G+ P+   KA N+ + ++KI   K++ +V    +   ++      I   L FE
Sbjct: 255 CCGKPPF---KASNHLELFQKI---KKANDVIQFPKHAALESAMVDLICGLLTFE 303

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 162 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
           +  +V+   Q +  + D H   +I+RDIK DN L+         +V + DFG      D 
Sbjct: 621 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----THGRVKITDFGFCAKLTDK 672

Query: 222 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 673 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHL 209
           DLF      + S + +     Q++  ++ LH+  L +RD+K DN +I          V L
Sbjct: 459 DLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVIN-----SKGIVKL 513

Query: 210 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 514 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAIIFACM 570

Query: 269 LRGQLPWQGLKAPNNKQK 286
           +  + PW+  K  +N  K
Sbjct: 571 ILKKFPWKIPKLRDNSFK 588

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 162 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDP 221
           +  +V+   Q +  + D H   +I+RDIK DN L+         +V + DFG      D 
Sbjct: 670 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLDT-----RARVKITDFGFCARLTDK 721

Query: 222 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 722 RSK-------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>Kwal_27.11542
          Length = 791

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 20/136 (14%)

Query: 141 VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA--HDLIYRDIKPDNFLIGR 198
           +ID +   L++       R +   V+++   +   I  +HA    LI+RDIK +N LI  
Sbjct: 117 LIDFMNTRLQN-------RLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS- 168

Query: 199 PDQPDANKVHLIDFG-MAKLYRDPKTKQHIPYREKKSLSG-TARYMS---INTHLGREQS 253
               D     + DFG +  + R PK  Q   Y +   L   TA+Y S   I+ + G   +
Sbjct: 169 ----DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPIN 224

Query: 254 RRDDMEALGHVFFYFL 269
            + D+ ALG VF Y L
Sbjct: 225 EKSDIWALG-VFLYKL 239

>Scas_721.132
          Length = 584

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 109/291 (37%), Gaps = 72/291 (24%)

Query: 49  AGSNVSTVSGRDDTTIVG-----------LHFKIGKKIGEGSFG--VLFEGTN-----MI 90
           A +N+ T     ++T+VG           L +K  KKIGEG+F   +L+E  +     M+
Sbjct: 231 AHTNIDTFDNHAESTLVGYPLQHLDKAHVLRWKKVKKIGEGNFSDVLLYESLDQTDPKMM 290

Query: 91  NGVPVAIKFEPRKTE-----APQLKD----------------EYRTYKILAGTSGVPQAY 129
                 IK+    T+      PQ  D                +   Y  +    G+    
Sbjct: 291 QIAVKRIKYPVEVTDITFRGTPQYNDTLSRLESSLTRELGVLKLLDYPCIVKLYGINNPI 350

Query: 130 YF-GQEGLHNILVIDLLGPSLEDLFDWCGR------------RFSVKTVVQVAVQMITLI 176
           +   +  L ++L  +   P  + +  +C                 +  + ++  +++  +
Sbjct: 351 FVQSKTPLRDLLAKNPALPPCDMIMSYCSGGDLLAAISRCLGELDIWLIQRLFTELVMAV 410

Query: 177 EDLHAHDLIYRDIKPDNFLIGRP--------DQP---DANKVHLIDFGMAKLYRDPKTKQ 225
             LH +++I+RD+K +N L+  P        D P     N + L DFG+         KQ
Sbjct: 411 NYLHDNNIIHRDLKLENILLKYPLEHIIALKDSPVFTSLNMIELADFGLC--------KQ 462

Query: 226 HIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 275
             P     +  G+  Y+S    +G        D  ALG + +  L  +LP+
Sbjct: 463 IQPGELCTARCGSEDYVSPEILMGVPYDGHLTDTWALGVILYSILEDRLPF 513

>Scas_693.17
          Length = 1049

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 34/48 (70%), Gaps = 5/48 (10%)

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY 218
           Q+ + ++ LH+H++++RD+K +N +I +    D N + LIDFG++ LY
Sbjct: 208 QICSALKYLHSHNIVHRDLKIENIMISK----DGN-IKLIDFGLSNLY 250

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 24/182 (13%)

Query: 62  TTIVGLHFKIGKK------IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLKDEY 113
           T I G  F+I  +      +G G+FG++   T+ +    VAIK   +P  T A   K  Y
Sbjct: 10  TQIFGTVFEITNRYSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFAT-AVLAKRTY 68

Query: 114 RTYKIL-----AGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 168
           R  K+L          +   +    E ++   V +L G  L  L     R    + V   
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIY--FVTELQGTDLHRLLQ--TRPLEKQFVQYF 124

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIP 228
             Q++  ++ +H+  +++RD+KP N LI      +   + + DFG+A++ +DP+   ++ 
Sbjct: 125 HYQILRGLKYVHSAGVVHRDLKPSNILIN-----ENCDLKICDFGLARI-QDPQMTGYVS 178

Query: 229 YR 230
            R
Sbjct: 179 TR 180

>Kwal_55.20326
          Length = 750

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 105/260 (40%), Gaps = 54/260 (20%)

Query: 60  DDTTIVGLHFKI--------GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEA-- 106
           +D  ++ L  KI        G +IG GSFG ++ G N   G  +A+K    +P    A  
Sbjct: 441 EDEDVISLPTKIATPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGV 500

Query: 107 PQLKDEYRT-YKILAGTSGVPQA---------------------------YYFG--QEGL 136
             + DE +  Y   A  S V  +                            Y+G  QEG 
Sbjct: 501 VSVPDEVKKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGG 560

Query: 137 H-NILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFL 195
           + NI +  + G S+  + +  G  F    +     Q++  +  LH  D+I+RDIK  N L
Sbjct: 561 NLNIFLEYVPGGSVSSMLNSYGP-FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANIL 619

Query: 196 IGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR 255
           I          V + DFG++K       +Q+    ++ SL G+  +M+         +++
Sbjct: 620 IDI-----KGCVKITDFGISKKLSPLNQQQN----KRASLQGSVYWMAPEVVKQVVTTKK 670

Query: 256 DDMEALGHVFFYFLRGQLPW 275
            D+ ++G V      G+ P+
Sbjct: 671 ADIWSVGCVIIEMFTGKHPF 690

>Scas_721.46
          Length = 296

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 86/206 (41%), Gaps = 20/206 (9%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLKDEYRTYKILAGTS 123
           ++K  +K+GEG++GV+++  +M  G  V     I+ E      P       +        
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDD 66

Query: 124 GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLH 180
            + + Y       H + LV + L   L+   +   +  S+    + +   Q+   I   H
Sbjct: 67  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAYCH 126

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
           AH +++RD+KP N LI +        + L DFG+A+ +        +P R       T  
Sbjct: 127 AHRILHRDLKPQNLLINK-----EGNLKLGDFGLARAF-------GVPLRAYTHEIVTLW 174

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D  ++G +F
Sbjct: 175 YRAPEVLLGGKQYSTGVDTWSIGCIF 200

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 157 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAK 216
           G R S + + ++A  ++  +  LH   +I+RDIKP N L+      +  ++ L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLN-----EKGEIKLCDFGVSG 365

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 276
              +             + +GT+ YM+     G+  S   D+ +LG        G+ P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 277 GLKAPNN 283
             K   N
Sbjct: 417 SDKITQN 423

>CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces
           cerevisiae YDL017w Cell division control protein 7,
           hypothetical start
          Length = 504

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 23/171 (13%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVP--------------VAIKFEPRKTEAPQ-LKDE 112
            +++  KIGEG+F  +++  ++   V               VA+K +   T +PQ + +E
Sbjct: 28  QYRLIDKIGEGTFSSVYKAEDLQGKVTRKYGSHFWYKDSKYVALK-KIYVTSSPQRIYNE 86

Query: 113 YRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 172
                IL G   V             ++ +    P  E  F  C R   +K +     ++
Sbjct: 87  LNLLYILTGCVRVA-PLCDAMRVRDQVMAVLPYYPHEE--FRNCYRDLPIKGIKMYMWEL 143

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKT 223
           +  +  +H+  +I+RD+KP NFL      P+  +  L+DFG+A++  D  T
Sbjct: 144 LQALSFVHSKGIIHRDVKPTNFLYN----PEIGRGVLVDFGLAEMQSDIIT 190

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 32/181 (17%)

Query: 165 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRP--DQPDANKVH-------------- 208
           VV    Q+ + ++ L + +L++RDIKP N L+  P  +  D+   H              
Sbjct: 136 VVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILK 195

Query: 209 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 268
           + DFG A+    P T         ++L G+  YM+      ++ + + D+ ++G V F  
Sbjct: 196 IADFGFARFL--PSTSL------AETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEM 247

Query: 269 LRGQLPWQGLKAPNNKQKYEKIGEKKRSTN---VYDLSQGLPVQFGRYLEI--VRNLGFE 323
             G  P+    A N+ + ++KI       N   V ++  GL       L     + +GFE
Sbjct: 248 CCGVPPFT---ASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFE 304

Query: 324 E 324
           E
Sbjct: 305 E 305

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 179 LHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 238
           LH  ++I+RDIK DN L+         +V + DFG      D ++K       + ++ GT
Sbjct: 703 LHDKNIIHRDIKSDNVLLDT-----KARVKITDFGFCAKLTDQRSK-------RATMVGT 750

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
             +M+      +E   + D+ +LG +    L G+ P+
Sbjct: 751 PYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPY 787

>Scas_640.14*
          Length = 728

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 16/121 (13%)

Query: 158 RRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMA-K 216
           RR    T  ++  Q+I+ +  +H+  +++RD+K +N L+ + +      + + DFG   +
Sbjct: 141 RRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHEN-----LIITDFGFVNE 195

Query: 217 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLP 274
            Y D +          K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LP
Sbjct: 196 FYADNEL--------MKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLP 247

Query: 275 W 275
           W
Sbjct: 248 W 248

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 90/221 (40%), Gaps = 40/221 (18%)

Query: 63  TIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGT 122
           ++     + GKK+         +  N++NG P   +F+ +     Q    +++  I+   
Sbjct: 193 SVAKCKLRTGKKV------FALKTINILNGDP---EFQKQLLRELQFNKSFKSEYIV--- 240

Query: 123 SGVPQAYYFG-----QEGLHNILVIDLLGPSLEDLFDWC---GRRFSVKTVVQVAVQMIT 174
                  YFG     Q     I +  + G SLE ++      G R S K + +++  ++ 
Sbjct: 241 ------RYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLR 294

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKS 234
            +  LH   +I+RDIKP N L+    Q     V L DFG++    +             +
Sbjct: 295 GLSYLHEKKVIHRDIKPQNILLNEDGQ-----VKLCDFGVSGEAVNSLA---------TT 340

Query: 235 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 275
            +GT+ YM+     G+  S   D+ +LG       +G  P+
Sbjct: 341 FTGTSYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>KLLA0D13266g complement(1137750..1141208) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1 protein kinase
           singleton, hypothetical start
          Length = 1152

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 38/174 (21%)

Query: 68  HFKIGKKI-GEGSFG-VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEY-----RTYKILA 120
           H  I  ++ G GS G V+F+G           KF+ R     +L  ++     +  ++L+
Sbjct: 707 HLSISSRVLGYGSSGTVVFQG-----------KFQNRPVAVKRLLIDFYDIASKEIQLLS 755

Query: 121 GTSGVPQA--YYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSVKTV--------VQVA 169
            +   P    YYF +     + + ++L   SLED+ +  G +   K V        + V 
Sbjct: 756 ESDDHPNVIRYYFSESTEKFMYIAVELCSASLEDVIE--GSKGLAKNVAVQKNIDPINVL 813

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQ-----PDANKVHLI--DFGMAK 216
            Q+ + +  LH+  +++RD+KP N LI  P +        NK  ++  DFG+ K
Sbjct: 814 FQITSGVNHLHSMKIVHRDLKPQNILIAPPKRYLSLHASKNKFRVLISDFGLCK 867

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 14/100 (14%)

Query: 131 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIYRD 188
           F  + L+++ +V++ +  ++  L     RR FS+ T+  +  Q++  I+ +H HD  +RD
Sbjct: 133 FIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSLPTLRSILFQILAGIKHIHDHDFFHRD 192

Query: 189 IKPDNFLIG------------RPDQPDANKVHLIDFGMAK 216
           IKP+N LI               +  D   V L D+G+A+
Sbjct: 193 IKPENILISPSHRYFSKKWLEDDNYSDNYVVKLADYGLAR 232

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 68  HFKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLKDEYRTYKILAGTS 123
           ++K  +K+GEG++GV+++  ++ +   V     I+ E      P       +        
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 124 GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLH 180
            + + Y       H + LV + L   L+   +   +   +    + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 240
           AH +I+RD+KP N LI R    D N + L DFG+A+ +        +P R       T  
Sbjct: 126 AHRIIHRDLKPQNLLINR----DGN-LKLGDFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDVWSIGCIF 199

>Kwal_26.7276
          Length = 646

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 12/71 (16%)

Query: 158 RRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQ------------PDAN 205
           R FS+ ++  +  Q+IT I  +H+H+  +RD+KP+N LI   +              D  
Sbjct: 178 RVFSLPSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNY 237

Query: 206 KVHLIDFGMAK 216
            V + D+G+A+
Sbjct: 238 VVKIADYGLAR 248

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,167,101
Number of extensions: 574985
Number of successful extensions: 2152
Number of sequences better than 10.0: 548
Number of HSP's gapped: 1906
Number of HSP's successfully gapped: 558
Length of query: 537
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 431
Effective length of database: 12,926,601
Effective search space: 5571365031
Effective search space used: 5571365031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)