Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFL202C48147223960.0
Sklu_2101.449149612561e-170
Kwal_23.349446642910971e-146
KLLA0D10043g48839210191e-134
YDL106C (PHO2)5593518171e-103
Scas_613.114933118021e-102
CAGL0L07436g5152106524e-79
KLLA0B01584g464571381e-08
Kwal_47.18450370781226e-07
AFR643C102711111e-06
ADL394C102711101e-06
YML027W (YOX1)385911191e-06
Sklu_797.1386901192e-06
AER314W431821139e-06
AER456W57531001e-05
YDR451C (YHP1)353461121e-05
Kwal_33.1299191751003e-05
CAGL0G07249g345571057e-05
Scas_641.1241357995e-04
KLLA0C03135g22858965e-04
KLLA0B14553g22858965e-04
Scas_720.112389720.27
AFL049C25771740.38
Kwal_33.1299511070680.70
YKL098W35782711.1
YFR023W (PES4)611116692.2
YCR097W (HMRA1)12655652.2
Kwal_47.1663843351682.3
YGL096W (TOS8)27681673.0
Sklu_2443.2034338673.2
CAGL0M10395g1665148674.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFL202C
         (472 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   927   0.0  
Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        488   e-170
Kwal_23.3494                                                          427   e-146
KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   397   e-134
YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   319   e-103
Scas_613.11                                                           313   e-102
CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   255   4e-79
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    58   1e-08
Kwal_47.18450                                                          52   6e-07
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    47   1e-06
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    47   1e-06
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    50   1e-06
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            50   2e-06
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    48   9e-06
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    43   1e-05
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    48   1e-05
Kwal_33.12991                                                          43   3e-05
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    45   7e-05
Scas_641.12                                                            43   5e-04
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    42   5e-04
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    42   5e-04
Scas_720.1                                                             32   0.27 
AFL049C [3144] [Homologous to ScYPL177C (CUP9) - SH; ScYGL096W (...    33   0.38 
Kwal_33.12995                                                          31   0.70 
YKL098W (YKL098W) [3164] chr11 (256415..257488) Protein of unkno...    32   1.1  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    31   2.2  
YCR097W (HMRA1) [619] chr3 (293831..293935,293990..294235,294288...    30   2.2  
Kwal_47.16638                                                          31   2.3  
YGL096W (TOS8) [1887] chr7 (325332..326162) Protein with weak si...    30   3.0  
Sklu_2443.20 YIR029W, Contig c2443 40304-41335                         30   3.2  
CAGL0M10395g 1038860..1043857 no similarity, hypothetical start        30   4.4  

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/472 (95%), Positives = 450/472 (95%)

Query: 1   MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGHGELAEAADGGKP 60
           MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGHGELAEAADGGKP
Sbjct: 1   MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGHGELAEAADGGKP 60

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR 120
           KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR
Sbjct: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR 120

Query: 121 TFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESL 180
           TFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESL
Sbjct: 121 TFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESL 180

Query: 181 SNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVL 240
           SNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVL
Sbjct: 181 SNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVL 240

Query: 241 NCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSN 300
           NCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSN
Sbjct: 241 NCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSN 300

Query: 301 QWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVVXXXXXXXX 360
           QWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVV        
Sbjct: 301 QWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVVPHAQPQPH 360

Query: 361 XXXXXXXXXXXXXXIVLQPEPHSLAQSAFFRNYGPHSTDDILDIQDPDQYETAQTANTEF 420
                         IVLQPEPHSLAQSAFFRNYGPHSTDDILDIQDPDQYETAQTANTEF
Sbjct: 361 PHSHPHHSSDPAQAIVLQPEPHSLAQSAFFRNYGPHSTDDILDIQDPDQYETAQTANTEF 420

Query: 421 PSTSTAAGSHFLTAHLADTQIPKTPEFLNQHTDLHNDDQHGLNNLLNFNDQP 472
           PSTSTAAGSHFLTAHLADTQIPKTPEFLNQHTDLHNDDQHGLNNLLNFNDQP
Sbjct: 421 PSTSTAAGSHFLTAHLADTQIPKTPEFLNQHTDLHNDDQHGLNNLLNFNDQP 472

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  488 bits (1256), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 334/496 (67%), Gaps = 43/496 (8%)

Query: 1   MDNFEYPGGEF-GRFNQEFGSPEEMLNNG---HGELRSDN---GEATGNSKSPGHGELAE 53
           M+NFEY   +F   FN +F  P+E + +    +    SD+   G  +  S S  + +   
Sbjct: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANSDDQTTGTTSATSFSSNYNDQKS 60

Query: 54  A----ADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQ 109
           A     + GKPK+KRTRATGEAL +LK+EFD+NPNPNAQNRKRIS+ T LPEKNVRIWFQ
Sbjct: 61  AHLQQGNDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQ 120

Query: 110 NRRAKYRKSDRTFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWKR 169
           NRRAK+RKS R  N R +A DMN  GS+S+TV++D+IPLNIN+NYYF+D +SLTVGSWKR
Sbjct: 121 NRRAKFRKSGRQ-NPRPSALDMNGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKR 179

Query: 170 LKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNTKIL 229
           LKSGNL +ESL NIK LSNLSP SIN IMSN+TDLMVLISKKNFE+NYFFSAIANNTKIL
Sbjct: 180 LKSGNLDKESLPNIKDLSNLSPISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKIL 239

Query: 230 FRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNFAVY 289
           FRIFFPINSV+NCSL   A+  +K+ +D +   Q+     +E+ CELKL VSK P FAVY
Sbjct: 240 FRIFFPINSVVNCSLSFEADSIRKENEDQDEQDQD----PSEKTCELKLTVSKSPKFAVY 295

Query: 290 FSDMNDELTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTT 349
           FSD  +  TSNQWSICEDFSEGRQVSDA+VGGSN PHVL GLE SLKFM+SLILDYNST 
Sbjct: 296 FSDAVEHFTSNQWSICEDFSEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTN 355

Query: 350 HVVXXXXXXXXXXXXXXXXXXXXXXIVLQPEPHSL--AQSAFFRNYGPHSTDDILDIQDP 407
            ++                      ++LQPEP      Q  FF ++   +    L  Q+ 
Sbjct: 356 QII-------PPPTVTQPHAVSQQSMILQPEPRPAEQGQQQFFDDFDAQNAILGLPHQEH 408

Query: 408 DQYETAQTANTEFPSTSTAAGSHF-----------LTAHL-ADTQIPKTPEFLNQHTDLH 455
           DQ  T Q     F S ++A   HF           L  +L  + QIP TPEFL+  TDL 
Sbjct: 409 DQLTTQQ-----FVSPNSAQSHHFTDDNNTVSQANLLPNLNQEAQIPNTPEFLST-TDLT 462

Query: 456 NDDQHGLNNLLNFNDQ 471
           ++D +G+++LL F  Q
Sbjct: 463 SEDHNGISDLLTFESQ 478

>Kwal_23.3494
          Length = 466

 Score =  427 bits (1097), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 285/429 (66%), Gaps = 44/429 (10%)

Query: 59  KPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKS 118
           +P++KRTRATGEAL +LK+EFD NPNPNAQNRKRISE TGLPEKNVRIWFQNRRAK+RKS
Sbjct: 52  RPRTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRKS 111

Query: 119 DRTFNQRTAATDM--NTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLH 176
           DR   + +A TD+     G+I   +++D+IPL+ N NY FID  SLTVGSWKRLKSGNL 
Sbjct: 112 DRGGTRGSATTDVAGEPTGAIPA-LDFDRIPLDSNSNYCFIDVKSLTVGSWKRLKSGNLK 170

Query: 177 RESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPI 236
           ++ L  ++ LSNLSP SIN IM+NATDLMVLISKKN E+NYFFSAIANNTKILFRIFFPI
Sbjct: 171 QDDLPTVQRLSNLSPVSINEIMANATDLMVLISKKNHEINYFFSAIANNTKILFRIFFPI 230

Query: 237 NSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDE 296
            + ++C+L    +G +    DA+N           ++CEL+LN+SK P FAVYFSD  D+
Sbjct: 231 TTTVDCALSATTDGAESVRSDAHN-----------KLCELRLNLSKAPTFAVYFSDGADQ 279

Query: 297 LTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVVXXXX 356
            +SNQWSICEDFSE RQVS+A++GG N PH+LTGLE+SL FM S I D+NS  HV+    
Sbjct: 280 FSSNQWSICEDFSEERQVSEAFIGGLNIPHILTGLESSLSFMCSSIQDHNSGAHVL---- 335

Query: 357 XXXXXXXXXXXXXXXXXXIVLQPEPHSLA--QSAFFRNYGPHSTDDILDIQDPDQYETAQ 414
                             IV+ PEPH+L   Q  FF ++  H           D Y   +
Sbjct: 336 -SHKSHLRDSVGAPEAHNIVINPEPHALGTRQQPFFDDFNDHQ----------DIYAIGE 384

Query: 415 TANTEFPSTSTAAGSHFLTAH-------------LADTQIPKTPEFLNQHTDLHNDDQHG 461
               +F +++T   SH  + H              +++ +PKTP+FL  H ++  ++Q G
Sbjct: 385 HNTPQFAASNTTTQSHSFSQHSPEPSGNEHTSPQYSESGVPKTPDFLRSHAEMGVEEQSG 444

Query: 462 LNNLLNFND 470
           LNNLL F+D
Sbjct: 445 LNNLLIFDD 453

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/392 (56%), Positives = 264/392 (67%), Gaps = 48/392 (12%)

Query: 1   MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGH-GELAEAADG-- 57
           MDNF+Y   +F  F  EF      L  G  E   D   ++G S      G L  A+DG  
Sbjct: 1   MDNFDYNQPDFPHFQPEFDPSNTFL--GDQEQLQDKRISSGESGYGNQSGTLMNASDGVE 58

Query: 58  ---GKPKS---------------------------------KRTRATGEALELLKKEFDI 81
              G P +                                 KRTRATGEALE+LK+EF +
Sbjct: 59  MFQGIPSTLANEHNTQVEHDDDHDSNHETHHSSSSSSKPKSKRTRATGEALEILKREFQL 118

Query: 82  NPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDRTFNQRTAATDMNTFGSISVTV 141
           NP+PNAQNRKRISE TGLPEKNVRIWFQNRR+KYRKSD+  N    ATD  T  S   + 
Sbjct: 119 NPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNG-PGATDNTTLVS---SF 174

Query: 142 EYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNA 201
           E+DKIPL IN +YYFID +SLTVGSWKRLKSGNL  +SL  I+ LSNLSP SIN IM+NA
Sbjct: 175 EFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANA 234

Query: 202 TDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVLNCSLLL-HAEGGKKDEDDAN- 259
           TDLMVLISKKNFE+NYFFSAIANNTKILFRIFFPIN+V+NCSL L + E  K D  ++N 
Sbjct: 235 TDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNS 294

Query: 260 -NVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAY 318
            + +       + ++ EL+L++SK P FAVYFS+  D+ +SNQWSICEDFSEGRQV+DA+
Sbjct: 295 PSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAF 354

Query: 319 VGGSNFPHVLTGLEASLKFMSSLILDYNSTTH 350
           +GGSN PHVLTGL+ SLKFM+SLILD NST H
Sbjct: 355 IGGSNIPHVLTGLDESLKFMNSLILDMNSTEH 386

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/351 (49%), Positives = 221/351 (62%), Gaps = 53/351 (15%)

Query: 52  AEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNR 111
           + A+D G  + KRTRA GEAL++LK++F+INP P+   RK+IS+  G+PEKNVRIWFQNR
Sbjct: 69  SNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNR 128

Query: 112 RAKYRKSDRTFNQRT---------------AATDMNTFGSISVT--------VEYDKIPL 148
           RAK RK     N+ T                +TD N   + S +          +D+IPL
Sbjct: 129 RAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPL 188

Query: 149 NINDNYYFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLI 208
           N N+NYYF D  S+TVGSW R+KSG L R +  +IK L NLSP  IN IMSNATDLMVLI
Sbjct: 189 NSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLI 248

Query: 209 SKKNFEVNYFFSAIANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAP 268
           SKKN E+NYFFSA+ANNTKILFRIFFP++SV NCSL L  +    D  ++NN   +  + 
Sbjct: 249 SKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETDD---DIINSNNTSDKNNSN 305

Query: 269 ------------------------AAEQVCELKLNVSKPPNFAVYF---SDMNDELTSNQ 301
                                   A +   ELKL V++ P FAVYF   +   D   +NQ
Sbjct: 306 TNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQ 365

Query: 302 WSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVV 352
           WSIC+DFSEGRQV+DA+VGGSN PH L GL+ SL+FM+SLILDY S+  ++
Sbjct: 366 WSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEIL 416

>Scas_613.11
          Length = 493

 Score =  313 bits (802), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 216/311 (69%), Gaps = 29/311 (9%)

Query: 60  PKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK-- 117
           PKS+R RA GE L +LK  F++NPNP+ + RK+IS   G+PEK+VRIWFQNRRAK +K  
Sbjct: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVKKHN 152

Query: 118 ------------SDRTFNQRTAA-TDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTV 164
                       +D  FN  T+  TD N          +D+IP+ IN NY FID  S+TV
Sbjct: 153 NLKNRNNANMDSNDEDFNDETSPNTDSNNAKF------FDRIPVRINKNYNFIDVCSITV 206

Query: 165 GSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAIAN 224
           GSW R K G+L  E L  ++ LSNLSP S+N IMSN+TDL+VL SKKN E+NYFFSA+AN
Sbjct: 207 GSWNRKKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMAN 266

Query: 225 NTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVSKPP 284
           +TKILFRIFFPI+SV NCSL L       D+D   N     ++  +E++ ELKL ++KPP
Sbjct: 267 DTKILFRIFFPISSVKNCSLSLET-----DDDIITNNNVTNSSDTSERLGELKLILTKPP 321

Query: 285 NFAVYF--SDMNDELTS-NQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSSL 341
            FAVYF  SD N+ + S NQWSICEDFSEG+QV+DA++GGSN PHVL+GL+ SLKF++S 
Sbjct: 322 TFAVYFIKSDENETVPSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKFLNSH 381

Query: 342 ILDYNSTTHVV 352
           IL+Y ST  ++
Sbjct: 382 ILEYKSTNEIL 392

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  255 bits (652), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 130/210 (61%), Positives = 160/210 (76%), Gaps = 10/210 (4%)

Query: 143 YDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNAT 202
           +DK+PLNIN+NYYFID  S+TVGSW R+KSG+L   SL  +K L NLSP S+N +MS+AT
Sbjct: 128 FDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMSDAT 187

Query: 203 DLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVV 262
           DLMV+ISKKNFE+NYFFSA+ANNTKILFRIFF IN+V +CSL       K DE+     +
Sbjct: 188 DLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSF----DKTDEE-----I 238

Query: 263 QETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAYVGGS 322
              T PA +Q  ELKL V+KPP FAVYF +  +   +NQW +CEDFSEG+QV+DA+VGGS
Sbjct: 239 NNRTDPANKQ-AELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVNDAFVGGS 297

Query: 323 NFPHVLTGLEASLKFMSSLILDYNSTTHVV 352
           N PHVL GLE+SLK ++SLILDY ST   +
Sbjct: 298 NVPHVLKGLESSLKILNSLILDYISTNDTI 327

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%)

Query: 58  GKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           G  KSKRTRA GE+L++LK  F +NPNP+ Q R RISE TG+PEKNVRIWFQNRRAK RK
Sbjct: 3   GHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVRK 62

Query: 118 SDR 120
             +
Sbjct: 63  KGK 65

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (64%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           + KR R +    ++LKKEF++NP P+ + R  +S    + EK V++WFQNRR  +RK
Sbjct: 210 RRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRRQNFRK 266

>Kwal_47.18450
          Length = 370

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR 120
           + KR R +   L +L+ EF++ P P+   R  +SE+  + EK ++IWFQN+R   ++  +
Sbjct: 160 RRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVKRQQK 219

Query: 121 TFNQRTAATDMNTFGSIS 138
                T  +D +   +++
Sbjct: 220 AVTDTTLPSDNSAIHTLT 237

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
           (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 36/71 (50%)

Query: 52  AEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNR 111
           A A   G  + +RT    E  E L+  F+    PNA+ R+ I+E+ GL    +RIWF N+
Sbjct: 32  ASALLTGDKQRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNK 91

Query: 112 RAKYRKSDRTF 122
           R + +     F
Sbjct: 92  RMRSKTRGARF 102

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
           (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 36/71 (50%)

Query: 52  AEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNR 111
           A A   G  + +RT    E  E L+  F+    PNA+ R+ I+E+ GL    +RIWF N+
Sbjct: 32  ASALLTGDNQRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNK 91

Query: 112 RAKYRKSDRTF 122
           R + +     F
Sbjct: 92  RMRSKTRGARF 102

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR 120
           + KR R + + L +L+ EF+  P P+ + R  ++E   + EK V+IWFQN+R   ++   
Sbjct: 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR--- 233

Query: 121 TFNQRTAATDMNTFGSISVTVEYDKIPLNIN 151
              QR A +   T   I  TV     PL+++
Sbjct: 234 ---QRIATSKSTT---IIQTVSPPSPPLDVH 258

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDR 120
           + KR R +   L +L+ EF+    P+ Q R  ++++  + EK V+IWFQN+R   +K  R
Sbjct: 170 RRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVKKHKR 229

Query: 121 TFNQRTAATDMNTFGSISVTVEYDKIPLNI 150
                T+   ++    I+ +      PL++
Sbjct: 230 IATTVTSNPVVDAVAPINTSGPQPTTPLSV 259

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRR--AKYRKS 118
           + KR R +   L +L++EFD    P+ + R  ++ +  + EK V+IWFQN+R   K ++ 
Sbjct: 198 RRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKRQSMKKKRK 257

Query: 119 DRTFNQRTAATDMNTFGSISVT 140
           +R F  R  +T  +    + VT
Sbjct: 258 ERDFADRLPSTPESYVKLMQVT 279

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
           complement(1512285..1512285,1512359..1512531) [174 bp,
           57 aa]
          Length = 57

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 70  EALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDRTF 122
           E  E L+  F+    PNA+ R+ I+E+ GL    +RIWF N+R + +     F
Sbjct: 5   ETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGARF 57

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 72  LELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           L +L+  FD  P PN   R  +SEQ  + EK+V+IWFQN+R   +K
Sbjct: 185 LGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 230

>Kwal_33.12991
          Length = 91

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%)

Query: 38  EATGNSKSPGHGELAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQT 97
           +A G    P      E  D      +RT  + +    L+  F+   +PN++ RK I+++ 
Sbjct: 15  KACGALLEPDVERRQEVCDKITVGQRRTLFSKDTRLFLESVFEKKKSPNSRERKAIADKC 74

Query: 98  GLPEKNVRIWFQNRR 112
           GL    VR+WF NRR
Sbjct: 75  GLTPVQVRVWFTNRR 89

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 34/57 (59%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           + KR R + + L +L+ EF     P+ Q R  ++++  + EK V++WFQN+R   ++
Sbjct: 155 RRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMKR 211

>Scas_641.12
          Length = 413

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 34/57 (59%)

Query: 61  KSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           + KR R +   L +L+ EF+    P+ Q R  ++++  + +K V+IWFQN+R   ++
Sbjct: 184 RRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMKR 240

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 60  PKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           P  KR+    E+  +L+K F +   PN   R  I+++  L    VRIWF N+R + +K
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKK 212

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 60  PKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRK 117
           P  KR+    E+  +L+K F +   PN   R  I+++  L    VRIWF N+R + +K
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKK 212

>Scas_720.1
          Length = 123

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 7/89 (7%)

Query: 33  RSDNGEATGNSKSPGHGELAEAADGGKPKSKRT-------RATGEALELLKKEFDINPNP 85
           R DN +  G S+ P     +    G K + + +       R T E L     E   NP P
Sbjct: 15  RMDNTKILGVSQHPLSNNNSSNISGKKLRRRGSGRRSSLPRGTVEVLNGWLLEHLNNPYP 74

Query: 86  NAQNRKRISEQTGLPEKNVRIWFQNRRAK 114
           N Q +K + E TGL +  +  WF N R +
Sbjct: 75  NVQEKKLLLELTGLTKVQLSNWFINVRRR 103

>AFL049C [3144] [Homologous to ScYPL177C (CUP9) - SH; ScYGL096W
           (TOS8) - SH] (346546..347319) [774 bp, 257 aa]
          Length = 257

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 54  AADGGKPKSKRTRATGEALELLKKEFDI----------NPNPNAQNRKRISEQTGLPEKN 103
           A DG K K K T+       L K+  DI          NP P+ Q +K + +QTGL    
Sbjct: 118 APDGTKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQ 177

Query: 104 VRIWFQNRRAK 114
           +  WF N R +
Sbjct: 178 LSNWFINVRRR 188

>Kwal_33.12995
          Length = 110

 Score = 30.8 bits (68), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 51  LAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRIS---EQTGLPEKNVRIW 107
           L  AA G +  SK        LE     F +N +     RK+IS   E+T L  K +R W
Sbjct: 26  LNSAARGNQKVSKYPHNISMHLE---NWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNW 82

Query: 108 FQNRRAKYRK 117
             NRR K +K
Sbjct: 83  MSNRRRKSKK 92

>YKL098W (YKL098W) [3164] chr11 (256415..257488) Protein of unknown
           function [1074 bp, 357 aa]
          Length = 357

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 12/82 (14%)

Query: 272 QVCELKLNVSKPPNFAVYFSDM--NDELTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLT 329
           Q C LK +V+   +F   + D    ++L S+  S C D    R ++DAY GG     VL 
Sbjct: 10  QTC-LKFSVTAKKSFLCMYRDSVSKEKLASSMPSTC-DIQLKRAINDAYPGGGIKVTVLN 67

Query: 330 GLEASLKFMSSLILDYNSTTHV 351
              AS        LD  +TTHV
Sbjct: 68  STTAS--------LDSLATTHV 81

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 14/116 (12%)

Query: 210 KKNFEVNYFFSAIANN-----TKILFRIFFPINSVLNCSLLLHAEGG---KKDEDDANNV 261
           +KNF  N FFS +  N     T++ +  F     +L+C L    + G    +DE  A NV
Sbjct: 174 RKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDSRKDIGFVYFEDEKTARNV 233

Query: 262 VQ---ETTAPAAEQVCELKLN--VSKPPNFAVYFSDMNDE-LTSNQWSICEDFSEG 311
           ++    T+    + +C +  +  V   PNF    S ++ E +   + S+ E  S+G
Sbjct: 234 IKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKG 289

>YCR097W (HMRA1) [619] chr3
           (293831..293935,293990..294235,294288..294317)
           Homeodomain regulatory protein that acts with Alpha2p to
           repress transcription of haploid-specific genes in
           diploids [381 bp, 126 aa]
          Length = 126

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 60  PKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAK 114
           PK K +  + +A   L++ F    + N++ ++ ++++ G+    VR+WF N+R +
Sbjct: 71  PKGKSS-ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMR 124

>Kwal_47.16638
          Length = 433

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 15  NQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGHGELAEAADGGKPKSKRT 65
           +Q FGS + +L  G G   SD  E T  S++PGH + A     GK  SK T
Sbjct: 301 DQHFGSADNLLLPGRGHDMSDGWETT-RSRAPGHVDWA-IVQLGKRTSKIT 349

>YGL096W (TOS8) [1887] chr7 (325332..326162) Protein with weak
           similarity to Cup9p, contains a homeodomain [831 bp, 276
           aa]
          Length = 276

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 10/81 (12%)

Query: 34  SDNGEATGNSKSPGHGELAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRI 93
           S+NG +    K   HG+          +S   +AT   L     E   NP P  Q ++ +
Sbjct: 181 SNNGYSAKEKKHKAHGK----------RSNLPKATVSILNKWLHEHVNNPYPTVQEKREL 230

Query: 94  SEQTGLPEKNVRIWFQNRRAK 114
             +TGL +  +  WF N R +
Sbjct: 231 LAKTGLTKLQISNWFINARRR 251

>Sklu_2443.20 YIR029W, Contig c2443 40304-41335
          Length = 343

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 15  NQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGHGELA 52
           +Q FGS + +L  G G   SD  E T  S++PGH + A
Sbjct: 214 DQHFGSADNLLLPGRGHDMSDGWETT-RSRTPGHVDWA 250

>CAGL0M10395g 1038860..1043857 no similarity, hypothetical start
          Length = 1665

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 62/148 (41%), Gaps = 31/148 (20%)

Query: 59  KPKSKRTRATGEALELLKKEFDI----NPNPNAQNRKRI------SEQTGLPEKNVRIWF 108
           K + KR RA  + L     + D     NP P     K +       E T LP    RIW 
Sbjct: 93  KEQPKRKRAWYQVLSWSVDDLDDYLKNNPQPPENPIKAMVKSWFEKEPTKLPP---RIWM 149

Query: 109 QNRRAKYRKSDRTFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLTVGSWK 168
            N+ +    SD T N++T  +D +     +  +E + +   IN N +    +SL      
Sbjct: 150 LNKDSSQEFSDSTINRKTLTSDTD-----AKVIEPEAVD-GINGNDHCNSDSSL------ 197

Query: 169 RLKSGNLHRESLSNIKYLSNLSPTSINM 196
                 L  E+L ++ Y+SN S  SIN+
Sbjct: 198 ------LAMEALVSLDYISNSSTYSINV 219

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,614,353
Number of extensions: 741704
Number of successful extensions: 1858
Number of sequences better than 10.0: 59
Number of HSP's gapped: 1840
Number of HSP's successfully gapped: 60
Length of query: 472
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 367
Effective length of database: 12,961,219
Effective search space: 4756767373
Effective search space used: 4756767373
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)