Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFL201W49748824300.0
Kwal_23.350750248916150.0
KLLA0D09999g50148816140.0
CAGL0F07777g50449215330.0
YMR170C (ALD2)50649415010.0
Scas_669.950349014390.0
YMR169C (ALD3)50649414360.0
Kwal_23.350050349011281e-150
KLLA0D10021g50348510591e-140
Kwal_23.59115384889701e-126
CAGL0J03212g5174859391e-122
YER073W (ALD5)5204829401e-122
KLLA0C07777g5144769291e-120
Sklu_2369.55144889281e-120
Sklu_2315.35014859261e-120
KLLA0E23144g5074899211e-119
YOR374W (ALD4)5194869091e-117
Kwal_26.67525224809031e-116
CAGL0H05137g4974858981e-116
Scas_701.145154918931e-115
CAGL0D06688g5244838931e-115
Kwal_27.119765264928911e-114
ADR417W5074898881e-114
KLLA0F00440g5224848851e-113
ACL044W5134928781e-112
Sklu_2427.25184838721e-112
Scas_663.45204838681e-111
Scas_664.244994858331e-106
YPL061W (ALD6)5004868041e-101
KLLA0F12628g5043996384e-77
Sklu_2087.35064036062e-72
AER007W4954705895e-70
KLLA0E17545g4974815722e-67
Kwal_56.231064954575712e-67
YBR006W (UGA2)4974545643e-66
Scas_716.634944505601e-65
CAGL0C04191g4914545555e-65
AAL075W6375063981e-41
KLLA0C10615g6404773653e-37
Kwal_23.56996414703611e-36
YHR039C (MSC7)6444093531e-35
CAGL0F08965g6394363522e-35
Scas_690.266514793301e-32
Kwal_26.75955243403243e-32
Scas_717.745223213164e-31
CAGL0K03509g5273253093e-30
KLLA0B12540g5213382917e-28
KLLA0C10549g5763482882e-27
AAL071C5733442705e-25
YMR110C5323262643e-24
CAGL0D03982g5743442625e-24
Kwal_23.57145763512474e-22
Scas_690.415813442403e-21
YHR037W (PUT2)5753442351e-20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFL201W
         (488 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C (...   940   0.0  
Kwal_23.3507                                                          626   0.0  
KLLA0D09999g complement(844368..845873) highly similar to sp|P47...   626   0.0  
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...   595   0.0  
YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde ...   582   0.0  
Scas_669.9                                                            558   0.0  
YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasm...   557   0.0  
Kwal_23.3500                                                          439   e-150
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...   412   e-140
Kwal_23.5911                                                          378   e-126
CAGL0J03212g 307754..309307 highly similar to sp|P40047 Saccharo...   366   e-122
YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehy...   366   e-122
KLLA0C07777g complement(682962..684506) highly similar to sp|P40...   362   e-120
Sklu_2369.5 YER073W, Contig c2369 5264-6808                           362   e-120
Sklu_2315.3 YPL061W, Contig c2315 5950-7455                           361   e-120
KLLA0E23144g complement(2052418..2053941) highly similar to sp|P...   359   e-119
YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial ald...   354   e-117
Kwal_26.6752                                                          352   e-116
CAGL0H05137g complement(495715..497208) highly similar to sp|P54...   350   e-116
Scas_701.14                                                           348   e-115
CAGL0D06688g 639883..641457 highly similar to sp|P46367 Saccharo...   348   e-115
Kwal_27.11976                                                         347   e-114
ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH] complement(...   346   e-114
KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomy...   345   e-113
ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH] complement(...   342   e-112
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                           340   e-112
Scas_663.4                                                            338   e-111
Scas_664.24                                                           325   e-106
YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldeh...   314   e-101
KLLA0F12628g complement(1170396..1171910) similar to sp|P38067 S...   250   4e-77
Sklu_2087.3 , Contig c2087 4336-5856                                  238   2e-72
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...   231   5e-70
KLLA0E17545g 1553982..1555475 highly similar to sp|P38067 Saccha...   224   2e-67
Kwal_56.23106                                                         224   2e-67
YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyd...   221   3e-66
Scas_716.63                                                           220   1e-65
CAGL0C04191g complement(409544..411019) highly similar to sp|P38...   218   5e-65
AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH] complement(2...   157   1e-41
KLLA0C10615g complement(912077..913999) similar to sp|P38694 Sac...   145   3e-37
Kwal_23.5699                                                          143   1e-36
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...   140   1e-35
CAGL0F08965g complement(880296..882215) highly similar to sp|P38...   140   2e-35
Scas_690.26                                                           131   1e-32
Kwal_26.7595                                                          129   3e-32
Scas_717.74                                                           126   4e-31
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...   123   3e-30
KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces...   116   7e-28
KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1 Kluyverom...   115   2e-27
AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH] (223170..224...   108   5e-25
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...   106   3e-24
CAGL0D03982g 397039..398763 highly similar to sp|P07275 Saccharo...   105   5e-24
Kwal_23.5714                                                          100   4e-22
Scas_690.41                                                            97   3e-21
YHR037W (PUT2) [2324] chr8 (181969..183696) Delta-1-pyrroline-5-...    95   1e-20

>AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C
           (ALD3) - SH] complement(58424..59917) [1494 bp, 497 aa]
          Length = 497

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/488 (93%), Positives = 457/488 (93%)

Query: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXX 60
           MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFY       
Sbjct: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYAAGAADV 60

Query: 61  XXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                     YEERWRHTS              VDEEREVLAGIETLDSGKPYHTNALAD
Sbjct: 61  DAAVAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGIETLDSGKPYHTNALAD 120

Query: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ
Sbjct: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
           GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK
Sbjct: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ
Sbjct: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYIN 360
           NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYIN
Sbjct: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYIN 360

Query: 361 HGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420
           HGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY
Sbjct: 361 HGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420

Query: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480
           ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK
Sbjct: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480

Query: 481 AGLQTYLQ 488
           AGLQTYLQ
Sbjct: 481 AGLQTYLQ 488

>Kwal_23.3507
          Length = 502

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 362/489 (74%), Gaps = 4/489 (0%)

Query: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXX 63
           L  EI++P+   TY QPLGL+I+NEFVA   G  +++ NPA G+ +A+F           
Sbjct: 3   LSTEIHIPQLDLTYQQPLGLYINNEFVASSDGGSIESVNPATGKPVASFQAATDADVDRA 62

Query: 64  XXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQ 123
                  Y+  WRHTS              V++ERE+LA IETLDSGKP+HTNA  DLDQ
Sbjct: 63  VAAARKAYQSHWRHTSAEQRSALLAKLAELVEQERELLAAIETLDSGKPFHTNAKGDLDQ 122

Query: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183
           +  +T+YYAGGADK ++G    +   K AYT++ PYGVVAQ+VPWNYPLAMASWK QGCL
Sbjct: 123 IVQLTKYYAGGADKFNKGQHIPVGPDKYAYTVQAPYGVVAQVVPWNYPLAMASWKMQGCL 182

Query: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243
           AAGN VVIKP+ENTSLSLLYFA L  RAGFP GV NV+PG G   G RLA H  VDKIAF
Sbjct: 183 AAGNTVVIKPAENTSLSLLYFAQLFERAGFPAGVVNVVPGHGAVAGSRLAAHMDVDKIAF 242

Query: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303
           TGSTAVGQKVM  AA SNLK VTLECGGKSPAVIFADADLD AV + AAGI+YNSGQNCT
Sbjct: 243 TGSTAVGQKVMGLAAASNLKAVTLECGGKSPAVIFADADLDQAVEWTAAGIYYNSGQNCT 302

Query: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGYINH 361
           ANSR+YVQE+VYD F+ KF A+V  T+ FG+    F  +C +GPV+S+ QYDR+ GYI H
Sbjct: 303 ANSRLYVQESVYDEFVAKFCAYVEKTWKFGAKHDPFDPECTVGPVVSQVQYDRIRGYIEH 362

Query: 362 G-INEKLAYEQFGSVP-EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIR 419
           G  +E+L   Q G      G++IPPT+F DVPQ S+L REEIFGPVAV+AKFKDYD+A+ 
Sbjct: 363 GKSSEQLGIRQIGVADVAPGFFIPPTLFTDVPQDSKLSREEIFGPVAVIAKFKDYDDALA 422

Query: 420 YANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELG 479
            ANDTNYGLA+ VFTE++R A+ F RD+ +GTVW+NSSNDEEV VPFGGFKMSGIGRELG
Sbjct: 423 RANDTNYGLAAAVFTEDVRKANHFARDIDAGTVWINSSNDEEVSVPFGGFKMSGIGRELG 482

Query: 480 KAGLQTYLQ 488
           ++G+  Y Q
Sbjct: 483 QSGMDVYTQ 491

>KLLA0D09999g complement(844368..845873) highly similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 aldehyde
           dehydrogenase 2 (NAD+), start by similarity
          Length = 501

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/488 (59%), Positives = 360/488 (73%), Gaps = 3/488 (0%)

Query: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXX 63
           L+E +N+P+   TY QPLGLFI+NEFV    G ++++ NP+  E I +F+          
Sbjct: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62

Query: 64  XXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQ 123
                  +E  W  TS              ++ ++ +LA IETLDSGKPYH+N+LADL+Q
Sbjct: 63  VTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQ 122

Query: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183
           +  +TRYYAGGADK   G+   L+  K AYT++VPYGVVAQIVPWNYPLAMASWK Q CL
Sbjct: 123 ILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCL 182

Query: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243
           AAGN +VIKP+ENTSLSLLYFA LV+ AGFPPGV N+LPG G   G  +A H  +DKIAF
Sbjct: 183 AAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAF 242

Query: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303
           TGSTAVGQKVM+ AA SNLK VTLECGGKSP +IFADA+LD A+ +VA GIFYNSGQNCT
Sbjct: 243 TGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCT 302

Query: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGYINH 361
           ANSRIYV E +Y+ FL KF  + +S + FG+    F KDC +GPVISK QYDR+  Y+ H
Sbjct: 303 ANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEH 362

Query: 362 G-INEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420
           G  +EKL +++F   P KGY+IPPTIF DVP SS+L +EEIFGPV VVA F  Y+EAI+ 
Sbjct: 363 GKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKL 422

Query: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480
           AND++YGLASCVF+EN R   +F RD+++GTVW+NSSNDEE+ VPFGGFKMSGIGRELG+
Sbjct: 423 ANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGR 482

Query: 481 AGLQTYLQ 488
            G+ +YLQ
Sbjct: 483 NGVDSYLQ 490

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/492 (56%), Positives = 349/492 (70%), Gaps = 4/492 (0%)

Query: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXX 60
           M E+FEEIN+P+ G +Y QP+G+FIDNEFV    G +++T NPA  E+I +FY       
Sbjct: 1   MPEVFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDV 60

Query: 61  XXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                     YE  W   S              ++EE+ +LA +ETLD+GKPYHTNA+ D
Sbjct: 61  DKAVKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDD 120

Query: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           +DQ+ ++T+Y+AG  DK  QG    + H K  YTL+ PYGV   I+PWNYPLAMASWK Q
Sbjct: 121 IDQIIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQ 180

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
           GCLAAGN +VIKP+ENTSLSLLY A L ++AGFP GV NV+PG G  VG  L  H  VDK
Sbjct: 181 GCLAAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVPGKGSVVGNSLGLHMDVDK 240

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           I+FTGST VG  ++  A  SN+KDVTLECGGKSPAV+F DAD+D+A+ Y+A GIFYNSGQ
Sbjct: 241 ISFTGSTKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDADIDNAIEYIANGIFYNSGQ 300

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGY 358
           NCTANSR+YVQE +YD F+ +F  H +  + FGS    F KDC +GPV+S+ Q++ V  Y
Sbjct: 301 NCTANSRVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFDKDCTVGPVVSEKQFETVNDY 360

Query: 359 INHGINEK--LAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDE 416
           I HG  E+    ++       KGY+I PTIF DVPQ S+L +EEIFGPV VVAKFKDY E
Sbjct: 361 IRHGKEEENLQIHQTVEKCDCKGYFISPTIFTDVPQGSKLMKEEIFGPVVVVAKFKDYKE 420

Query: 417 AIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGR 476
           AI+ ANDTNYGLAS VFT+NI VA+ F RD++SGTVW+NSSN+E+  VPFGGFK SGIGR
Sbjct: 421 AIKLANDTNYGLASMVFTKNISVANWFARDIKSGTVWINSSNEEDPTVPFGGFKQSGIGR 480

Query: 477 ELGKAGLQTYLQ 488
           ELG+ G+++Y+Q
Sbjct: 481 ELGETGVESYMQ 492

>YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde
           dehydrogenase (NAD(P)+), likely cytosolic [1521 bp, 506
           aa]
          Length = 506

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/494 (55%), Positives = 352/494 (71%), Gaps = 6/494 (1%)

Query: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXX 60
           M  L+ +I +P+   +  QPLGLFI+NEF     G  ++T NPA GE I +F        
Sbjct: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV 60

Query: 61  XXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                     ++  W  TS              ++EE++ LA +ETLD+GKPYH+NA  D
Sbjct: 61  DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGD 120

Query: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           L Q+  +TRY+AG ADK  +G    L+  K AYTL+VP+GVVAQIVPWNYPLAMA WK Q
Sbjct: 121 LAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQ 180

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
           G LAAGN V+IKP+ENTSLSLLYFA+L+++AGFPPGV N++PG G  VGQ LA H  +DK
Sbjct: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDK 240

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           I+FTGST VG  V+ A+  SNLKDVTLECGGKSPA++F DADLD A++++AAGIFYNSGQ
Sbjct: 241 ISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQ 300

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGY 358
           NCTANSR+YVQ ++YD F++KF+   +  +        F + C +GPVIS TQYDR+  Y
Sbjct: 301 NCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360

Query: 359 INHGIN-EKLAYEQFGSVP---EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDY 414
           I  G   EKL   Q    P    KGY+IPPTIF DVPQ+S+L ++EIFGPV VV+KF +Y
Sbjct: 361 IERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNY 420

Query: 415 DEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGI 474
           D+A++ ANDT YGLAS VFT++++ AH F RD+++GTVW+NSSNDE+V VPFGGFKMSGI
Sbjct: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGI 480

Query: 475 GRELGKAGLQTYLQ 488
           GRELG++G+ TYLQ
Sbjct: 481 GRELGQSGVDTYLQ 494

>Scas_669.9
          Length = 503

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/490 (53%), Positives = 339/490 (69%), Gaps = 5/490 (1%)

Query: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXX 63
           +F+ I +P+   +  QP+GLFI NEFV    G+Q+ T NPA  E + +FY          
Sbjct: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60

Query: 64  XXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQ 123
                  Y + W  TS              V+ ++E+LA IET DSGKPY+TNAL D+D 
Sbjct: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120

Query: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183
           +  +T+Y+AG  DK   G+   + H   AYTL+VP+GVVAQIVPWNYPLAMASWK Q CL
Sbjct: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180

Query: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243
           AAGN VVIKPSEN+SLSLLYFA L+  AGFPPGV N++PG G  VG  L+ H  VDKI+F
Sbjct: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240

Query: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303
           TGST VG  V+  +  SNLKDVTLECGGKSPAVIF DA+L+ AV + + GIF+NSGQNCT
Sbjct: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300

Query: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGYINH 361
           ANSRI VQ  ++D F+ KF+ + +  ++FGS    F KDC +GPVIS+ QY+++  Y+  
Sbjct: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360

Query: 362 GINEKLAYEQFGSVPE---KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAI 418
                +        P     GY+IPPTI+ +VPQ S+ C+EEIFGP  V+++F+DYDEA+
Sbjct: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420

Query: 419 RYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGREL 478
             ANDT+YGLA+ VFTENIR+AH F RD+ +GTVWVN+SN E+V +PFGGFKMSGIGREL
Sbjct: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL 480

Query: 479 GKAGLQTYLQ 488
           G+ G+++++Q
Sbjct: 481 GRTGVESFMQ 490

>YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasmic,
           stress inducible aldehyde dehydrogenase, probable
           isoform of Ald2p [1521 bp, 506 aa]
          Length = 506

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/494 (53%), Positives = 340/494 (68%), Gaps = 6/494 (1%)

Query: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXX 60
           M  L+ +I +P+   +  QPLGLFI+NEF     G  ++T NPA GE I +F        
Sbjct: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV 60

Query: 61  XXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                     ++  W  TS              ++EE++ LA +ETLD+GKP+H+NA  D
Sbjct: 61  DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120

Query: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           L Q+  +TRYYAG  DK + G+   L+  K AYTL+VP+GVVAQIVPWNYPLAMA  K Q
Sbjct: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
           G LAAGN V+IKP+ENTSLSLLYFA+L+++AGFPPGV NV+PG G  VG+ L  H  +DK
Sbjct: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           I+FTGST VG  V+ A+  SNLKD+TLECGGKSPA++F DADLD A+ +VA GIF+NSGQ
Sbjct: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGY 358
            CTANSR+YVQ ++YD F++KF+   +  +        F + C +GPVIS TQYDR+  Y
Sbjct: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360

Query: 359 INHGIN-EKLAYEQFGSVP---EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDY 414
           I  G   EKL   Q    P    KGY+IPPTIF DVP++S+L R+EIFGPV VV+KF +Y
Sbjct: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420

Query: 415 DEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGI 474
           D+A++ ANDT YGLAS VFT++++ AH F RD+++GTVW+N +N EE  VPFGGFKMSGI
Sbjct: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480

Query: 475 GRELGKAGLQTYLQ 488
           GRE G  G+  YLQ
Sbjct: 481 GRESGDTGVDNYLQ 494

>Kwal_23.3500
          Length = 503

 Score =  439 bits (1128), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 231/490 (47%), Positives = 305/490 (62%), Gaps = 15/490 (3%)

Query: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXX 66
           ++ +P  G +Y QPLGLFI+NE+V      ++++ + A GE+IA                
Sbjct: 5   QVQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEVIAAVQAADASVDVDLAVS 63

Query: 67  XXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126
                   WR T               V+EE+E+LA +E+LDSGKP  +NA+ D++ +A 
Sbjct: 64  AARAAFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123

Query: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186
           + +YYAG  DK  QG ++A S  +  YTL  P GVV  I+P+NYPL M +WK    +A G
Sbjct: 124 ILKYYAGWVDKA-QGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATG 181

Query: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246
           N  V K +E T LS+LYFA LV RAGFPPGVFNVL G G  VG  +A H G+DKIAFTGS
Sbjct: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241

Query: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306
           T+VGQ++   AA+ NLK +TLECGGKSPA++FADAD + AV + AAGIFYN GQ C+  S
Sbjct: 242 TSVGQQIQRTAAV-NLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300

Query: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366
           R YV++++YD F+D   AHV  TY  G    S    +GP +S+TQ +RV  YI  G+ E 
Sbjct: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQST-TRVGPQVSRTQQERVQNYIRKGVEEG 359

Query: 367 LAYEQFGS-VPE---------KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDE 416
                 G  +PE          G+Y+ PTI  DV QS  + REEIFGPV  V+KF DYDE
Sbjct: 360 ARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDE 419

Query: 417 AIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGR 476
           A+R AND+ YGL S +FT ++  AH+F  +V+SG  ++NSSN+ +   PFGG KMSG GR
Sbjct: 420 ALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGR 479

Query: 477 ELGKAGLQTY 486
           ELG+ GL  +
Sbjct: 480 ELGEYGLANF 489

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
           albicans aldehyde dehydrogenase, mitochondrial (by
           homology), start by similarity
          Length = 503

 Score =  412 bits (1059), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 227/485 (46%), Positives = 296/485 (61%), Gaps = 18/485 (3%)

Query: 14  GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEE 73
           G  Y QPLGLFI+NE+V   G   L + NP++GE I                        
Sbjct: 11  GTEYQQPLGLFINNEYVEAHGSETLTSYNPSSGEEICKVQCADPKIDVDLAVKAARDAFP 70

Query: 74  RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAG 133
            W+ T               ++ + ++L+ IE+LD+GKP   NA  D+ +V  V +YYAG
Sbjct: 71  GWKATPAIEKRDLFYKLAGLLERDIDILSKIESLDTGKPIANNAKYDILEVVEVLKYYAG 130

Query: 134 GADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKP 193
             DK   G +FA S  K AYTL  P GVV  I+P+NYPLAM SWK    +A GN  V K 
Sbjct: 131 WIDKAG-GQSFAPSSEKLAYTLHQPLGVVGCIIPFNYPLAMMSWKWTA-IATGNTTVFKS 188

Query: 194 SENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKV 253
           ++ T LS+LYFA LV+ AGFP GVFNVL G G  VG  + +H GVDKIAFTGSTAVGQ +
Sbjct: 189 ADQTPLSILYFAKLVKEAGFPAGVFNVLSGTGASVGSAIVKHTGVDKIAFTGSTAVGQII 248

Query: 254 MAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEA 313
              +A+ NLK +TLECGGKS  +IF D DL+ AV + A GIF N GQ C+  SR++VQE+
Sbjct: 249 QQQSAV-NLKPITLECGGKSANMIFEDCDLEQAVKWSAWGIFNNMGQICSGTSRVFVQES 307

Query: 314 VYDAFLDKFRAHVRSTYSFGSGLFSKDCNM-GPVISKTQYDRVMGYINHGINE--KLAYE 370
           +Y+ F+ +   HV+ TY  G+   S D  + GP +SK Q +RV+ YI  GI E  K+   
Sbjct: 308 IYEEFVAQLADHVKKTYIVGAP--SDDAVIVGPQVSKKQQERVLEYIKIGIEEGCKVPLG 365

Query: 371 QFGSVPE---------KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYA 421
             G+ PE          GYY+ PTI  DV  S R+ +EEIFGPV VV  FKDY EA+  A
Sbjct: 366 GLGA-PEPIANDPALANGYYVKPTILADVKASYRIAKEEIFGPVIVVGSFKDYKEALDIA 424

Query: 422 NDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKA 481
           ND++YGL S +F+++I   H+F +DV++G VW+NSSND ++ VPFGG KMSG GRELG+ 
Sbjct: 425 NDSDYGLGSAIFSKDIVTCHKFAQDVEAGMVWINSSNDVDINVPFGGVKMSGHGRELGEY 484

Query: 482 GLQTY 486
           GL  +
Sbjct: 485 GLANF 489

>Kwal_23.5911
          Length = 538

 Score =  378 bits (970), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/488 (43%), Positives = 280/488 (57%), Gaps = 19/488 (3%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P +G TY QP GLFI+ EFV        +  NP+  + IA  Y              
Sbjct: 50  ITLP-SGVTYDQPTGLFINGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAIAAA 108

Query: 68  XXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYV 127
              +E++W                  VD+  E+LAGIE+LD+GK    +   D+D VA  
Sbjct: 109 KRAFEDKWSTADPEFRSRCLYKLADLVDQHAEILAGIESLDNGKSLLCSR-TDVDLVAKY 167

Query: 128 TRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGN 187
            R  AG ADK+  G          +YTL  P GV AQI+PWN+PL M SWK    LA GN
Sbjct: 168 LRSCAGWADKIF-GRTIDTGSGHFSYTLREPLGVCAQIIPWNFPLLMWSWKLGPALATGN 226

Query: 188 CVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGST 247
            VV+KP+E T LS LY + LV+ AG P GV N+LPG G  +G+RL  HK V KIAFTGST
Sbjct: 227 TVVLKPAEATPLSALYASQLVQEAGIPAGVVNILPGFGKLLGERLCTHKDVKKIAFTGST 286

Query: 248 AVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSR 307
           A G+ +M  AA   +K VTLE GGKSP ++FADADL+ AV  +A GIF+NSG+ C A SR
Sbjct: 287 ATGRHIMRTAA-GTIKKVTLELGGKSPNIVFADADLEKAVRNIAFGIFFNSGEVCCAGSR 345

Query: 308 IYVQEAVYDAFLDKFRAHVRSTY---SFGSGLFSKDCNMGPVISKTQYDRVMGYINHGIN 364
           +YVQ+ VY+  L+KF+A+  +      F  G+F      G   S+ Q D+++ Y+  G  
Sbjct: 346 VYVQDTVYEEVLEKFKAYTETLKVGDPFQEGVFQ-----GSQTSQMQIDKILDYVQVGTA 400

Query: 365 EKLAY----EQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420
           E        E+ G   +KGY++ PTIF DV +  R+ +EEIFGP+  ++KF   DE I  
Sbjct: 401 EGARVITGGERHG---DKGYFVKPTIFADVTEDMRIVKEEIFGPIVTISKFSTVDEVIEM 457

Query: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480
           AND+ YGLA+ + T+++  A      V++GTVW+N+ N+    VPFGGF  SGIGRE+G 
Sbjct: 458 ANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQSVPFGGFGQSGIGREMGA 517

Query: 481 AGLQTYLQ 488
             L  Y Q
Sbjct: 518 EALDNYTQ 525

>CAGL0J03212g 307754..309307 highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 or sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4, start by
           similarity
          Length = 517

 Score =  366 bits (939), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 199/485 (41%), Positives = 273/485 (56%), Gaps = 9/485 (1%)

Query: 8   INVPET---GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXX 64
           + VP T   G  Y+QP GLFI+ EFV    G      NP+  E IAT Y           
Sbjct: 25  LEVPVTLPNGIKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAV 84

Query: 65  XXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQV 124
                 +E  W                  V+   E LAGI++LD+GK    +  AD+  V
Sbjct: 85  KAAKEAFENHWSREDPEVRARALFNLADLVEANLETLAGIDSLDNGKSLLCSR-ADVALV 143

Query: 125 AYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLA 184
           A   R   G ADK++ GD      +   Y+++ P GV  QI+PWN+PL M SWK    LA
Sbjct: 144 AKYLRSCGGWADKIY-GDVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALA 202

Query: 185 AGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFT 244
            GN VV+KP+E T LS L+ + L + AG P GV N++PG G  VG+R+  H  + K+AFT
Sbjct: 203 TGNTVVLKPAELTPLSALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFT 262

Query: 245 GSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTA 304
           GSTA G ++M  AA S +K VTLE GGKSP ++FADADL+ AV  +A GIF+NSG+ C A
Sbjct: 263 GSTATGSRIMKTAADS-IKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCA 321

Query: 305 NSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGIN 364
            SRIYVQ+  YD  LD+ + +  S    G+  F  +   G   S+ Q D+++ Y++ G  
Sbjct: 322 GSRIYVQDKCYDEVLDRLKKYTES-LKVGNP-FGDNTYQGSQTSQQQLDKILEYVDIGKQ 379

Query: 365 EKLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAND 423
           E       G  + EKGY+  PT+F DV ++ R+ ++EIFGP+  V++F   DE I  AND
Sbjct: 380 EGARIVTGGERIGEKGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMAND 439

Query: 424 TNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGL 483
           + YGLA+ + T ++  A      +++GT+W+N+ N     VPFGGF  SGIGRE+G A L
Sbjct: 440 SQYGLAAGIHTNDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAAL 499

Query: 484 QTYLQ 488
             Y Q
Sbjct: 500 DNYTQ 504

>YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehyde
           dehydrogenase [1563 bp, 520 aa]
          Length = 520

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/482 (41%), Positives = 272/482 (56%), Gaps = 7/482 (1%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  GFTY QP GLFI+ EFVA          NP+N E I T Y              
Sbjct: 32  ITLP-NGFTYEQPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAA 90

Query: 68  XXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYV 127
              +E +W                  V++ +E LA IE++D+GK     A  D+  V+  
Sbjct: 91  KKAFETKWSIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFC-ARGDVALVSKY 149

Query: 128 TRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGN 187
            R   G ADK++ G+          Y+++ P GV  QI+PWN+PL M SWK    LA GN
Sbjct: 150 LRSCGGWADKIY-GNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGN 208

Query: 188 CVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGST 247
            VV+KP+E T LS L+ + L + AG P GV N+LPG G  VG+RL+ H  V KIAFTGST
Sbjct: 209 TVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGST 268

Query: 248 AVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSR 307
           A G+ +M  AA   +K VTLE GGKSP ++FADADLD AV  +A GIFYNSG+ C A SR
Sbjct: 269 ATGRHIMKVAA-DTVKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSR 327

Query: 308 IYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKL 367
           IY+Q+ VY+  L K + +  S    G   F ++   G   S  Q  +++ Y++   +E  
Sbjct: 328 IYIQDTVYEEVLQKLKDYTES-LKVGDP-FDEEVFQGAQTSDKQLHKILDYVDVAKSEGA 385

Query: 368 AYEQFGSVP-EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNY 426
                G+    KGY++ PT+F DV    R+ +EE+FGP+  V+KF   DE I  AND+ Y
Sbjct: 386 RLVTGGARHGSKGYFVKPTVFADVKGDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQY 445

Query: 427 GLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
           GLA+ + T +I  A    + V++GTVW+N+ N+    VPFGGF  SGIGRE+G+A L  Y
Sbjct: 446 GLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNY 505

Query: 487 LQ 488
            Q
Sbjct: 506 TQ 507

>KLLA0C07777g complement(682962..684506) highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 aldehyde
           dehydrogenase (NAD+), mitochondrial, start by similarity
          Length = 514

 Score =  362 bits (929), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/476 (41%), Positives = 264/476 (55%), Gaps = 6/476 (1%)

Query: 14  GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEE 73
           G TY QP GLFI+ EFV        +  NP+N E I   Y                 +  
Sbjct: 31  GITYEQPTGLFINGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIAVAAAKKAFNN 90

Query: 74  RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAG 133
            W                  +D+  E LA IE+LD+GK     +  D+  VA   R  AG
Sbjct: 91  GWSTAEPEDRAKCLLKLADLIDQHAETLASIESLDNGKSLFC-SRGDVALVAKYLRSCAG 149

Query: 134 GADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKP 193
            ADK++ G          +YT   P GV  QI+PWN+PL M SWK    LA GN VV+KP
Sbjct: 150 WADKIY-GKVIDTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPALATGNTVVLKP 208

Query: 194 SENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKV 253
           +E T LS LY   LV+ AG P GV N++PG G  VG+R+  H  + K+AFTGSTA G+ +
Sbjct: 209 AEATPLSALYACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAFTGSTATGRHI 268

Query: 254 MAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEA 313
           M   A S +K VTLE GGKSP ++F DADLD AV  +A GIFYNSG+ C A SRIYVQ+ 
Sbjct: 269 MKTCADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEVCCAGSRIYVQDT 327

Query: 314 VYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFG 373
           VY+  L+KF+ +  S        F ++   G   S+ Q D+++ Y++ G +E       G
Sbjct: 328 VYEEVLEKFKQYAESLKV--GNPFEENVFQGAQTSQMQIDKILSYVDVGTSEGARVITGG 385

Query: 374 S-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCV 432
             +  KGY+I PTIF DV +  ++ +EEIFGPV  V+KF   DE +  AND+ YGLA+ +
Sbjct: 386 ERIGNKGYFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEVVAKANDSEYGLAAGI 445

Query: 433 FTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTYLQ 488
            T+++  A      V++GTVW+N+ N+    VPFGGF  SGIGRE+G   L  Y Q
Sbjct: 446 HTKDVNKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGAEALDNYTQ 501

>Sklu_2369.5 YER073W, Contig c2369 5264-6808
          Length = 514

 Score =  362 bits (928), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/488 (41%), Positives = 268/488 (54%), Gaps = 15/488 (3%)

Query: 8   INVPET---GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXX 64
           + VP T   G TY QP GLFI+ EFV        +  NP+N E +   Y           
Sbjct: 22  LRVPVTLPNGITYEQPTGLFINGEFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVDIAV 81

Query: 65  XXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQV 124
                 ++  W                  +++  E LAGIE+LD+GK    +   D+  V
Sbjct: 82  AAAKKAFDNGWSTAEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFCSR-GDVALV 140

Query: 125 AYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLA 184
           +   R  AG +DK+  G          AYT   P GV  QI+PWN+PL M SWK    LA
Sbjct: 141 SKYLRSCAGWSDKLF-GKVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKIGPALA 199

Query: 185 AGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFT 244
            GN VV+KP+E T LS LY + L + AG P GV N++PG G  VG+RL  H  V K+AFT
Sbjct: 200 TGNTVVLKPAEATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVGERLCTHPEVKKVAFT 259

Query: 245 GSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTA 304
           GSTA G+ +M  AA S +K VTLE GGKSP ++F DADLD AV  +A GIF+NSG+ C A
Sbjct: 260 GSTATGRHIMKTAADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFFNSGEVCCA 318

Query: 305 NSRIYVQEAVYDAFLDKFRAHVRSTY---SFGSGLFSKDCNMGPVISKTQYDRVMGYINH 361
            SR+YVQ+ VY+  L KF+ +  S      F  G+F      G   SK Q D+++ Y++ 
Sbjct: 319 GSRVYVQDTVYEEVLQKFKEYTESLKVGNPFEDGVFQ-----GAQTSKMQIDKILSYVDI 373

Query: 362 GINEKLAYEQFGSVP-EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420
           G  E       G    EKGY+I PTIF DV +  R+ +EEIFGP+  V+KF   DE I  
Sbjct: 374 GTKEGARIITGGEKKGEKGYFIKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVIAM 433

Query: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480
           AND+ YGLA+ + T+++  A      +++GT+W+N+ N     VPFGGF  SGIGRE+G 
Sbjct: 434 ANDSEYGLAAGIHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREMGA 493

Query: 481 AGLQTYLQ 488
             L  Y Q
Sbjct: 494 EALDNYTQ 501

>Sklu_2315.3 YPL061W, Contig c2315 5950-7455
          Length = 501

 Score =  361 bits (926), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/485 (40%), Positives = 274/485 (56%), Gaps = 9/485 (1%)

Query: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXX 66
           +I +P  G +Y QP GLFI+NEF+       L+  NP+  E++A  Y             
Sbjct: 14  KITLP-NGLSYEQPTGLFINNEFIKSQDQKTLKVENPSTEEIVAEVYSATKDDVEYAVEC 72

Query: 67  XXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALA--DLDQV 124
               +   W                  V+E +E+++ IE LD+GK   T ALA  D+  V
Sbjct: 73  ADKAFNSSWSTCDPRIRASYLFKLANLVEERKELISSIEALDNGK---TLALARGDVGLV 129

Query: 125 AYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLA 184
               +  AG ADK+  G           YTL  P GV  QI+PWN+PL M SWK    LA
Sbjct: 130 VDYLKIAAGYADKLG-GRTINTGEGYVNYTLREPVGVCGQIIPWNFPLMMLSWKIAPALA 188

Query: 185 AGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFT 244
           AGN VV+KP+  T L+ LYFASL +  G P GV N++PG G  VG  +  H  + KIAFT
Sbjct: 189 AGNTVVLKPASPTPLNALYFASLCKEVGIPDGVVNIVPGPGRSVGDTITNHPKIRKIAFT 248

Query: 245 GSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTA 304
           GST +G+ V   AA SNLK VTLE GGKS  ++F D  L+  +  +  GIF N+GQ C++
Sbjct: 249 GSTEIGRDVAIKAAASNLKKVTLELGGKSAHLVFDDCKLEKTLQNLVNGIFKNAGQICSS 308

Query: 305 NSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGIN 364
            SRIYVQE ++D  L  F+ ++ +    GS  F +    G + +K+Q+D V+ YIN G  
Sbjct: 309 GSRIYVQEGIHDRLLAAFKEYLENNIKVGSP-FDESNYQGAINNKSQFDTVINYINIGKE 367

Query: 365 EKLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAND 423
           E       G  V +KGY+I PT+F DV +  R+ +EEIFGPV  ++KFKD ++ +  AND
Sbjct: 368 EGAKLLTGGERVGDKGYFIRPTVFYDVKEDMRIVKEEIFGPVVTISKFKDIEDGVAMAND 427

Query: 424 TNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGL 483
           + +GL + + TEN+  A +  + +++GTVWVN+ ND +  VPFGG K SG GRE+G+   
Sbjct: 428 SEFGLGAGIETENLSTALKVSKMLKAGTVWVNTYNDFDASVPFGGCKQSGYGREMGEEVF 487

Query: 484 QTYLQ 488
           + Y Q
Sbjct: 488 EAYTQ 492

>KLLA0E23144g complement(2052418..2053941) highly similar to
           sp|P54115 Saccharomyces cerevisiae YPL061w ALD6 aldehyde
           dehydrogenase, cytosolic, start by similarity
          Length = 507

 Score =  359 bits (921), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 191/489 (39%), Positives = 278/489 (56%), Gaps = 19/489 (3%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G TY QP GLFI+N+F+    G  L+  NP+  E+I                  
Sbjct: 21  ITLP-NGLTYQQPTGLFINNQFIKSQDGKTLKVENPSTEEIIVEVQSATSQDVEYAVEAA 79

Query: 68  XXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALA--DLDQVA 125
              +   W                  ++ ++E++A IE+ D+GK   T ALA  D+  V 
Sbjct: 80  DAAFNSEWSTMDPKKRGSLLFKLADLIEAQKELIASIESADNGK---TLALARGDVGLVI 136

Query: 126 YVTRYYAGGADKM-----HQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
              R  AG ADK+     + GD +A       +T + P GV  QI+PWN+PL M SWK  
Sbjct: 137 DYIRSAAGYADKLGGRTINTGDGYA------NFTYKEPLGVCGQIIPWNFPLMMLSWKIA 190

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
             L AGN V++KP+  T L+ L+FASL + AG P GV N++PG G  VG  +  H  + K
Sbjct: 191 PALVAGNTVILKPASPTPLNALFFASLCKEAGIPAGVVNIVPGPGRSVGDTITNHPKIRK 250

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           IAFTGST +G+ V   AA SNLK VTLE GGKS  ++F DA++   +  +  GIF N+GQ
Sbjct: 251 IAFTGSTDIGRDVAIKAAQSNLKKVTLELGGKSAHLVFEDANIKKTIPNLVNGIFKNAGQ 310

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYIN 360
            C++ SRIYVQ+ +YD  L +F+ ++ +    GS  F +      + +K Q++ ++ YI+
Sbjct: 311 ICSSGSRIYVQDTIYDQLLSEFKTYLETEIKVGSP-FDESNFQAAINNKAQFETILNYID 369

Query: 361 HGINEKLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIR 419
            G  E  +    G  V  KGY+I PT+F +V +  R+ +EEIFGPV  ++KF   DEA+ 
Sbjct: 370 IGKKEGASILTGGERVGNKGYFIKPTVFYNVKEDMRIVKEEIFGPVVTISKFSTVDEAVA 429

Query: 420 YANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELG 479
            AND+ +GL + + TENI VA +  + +++GTVW+N+ ND +  VPFGG+K SG GRE+G
Sbjct: 430 LANDSEFGLGAGIETENISVALKVAKRLKAGTVWINTYNDFDAAVPFGGYKQSGYGREMG 489

Query: 480 KAGLQTYLQ 488
           +   ++Y Q
Sbjct: 490 EEAFESYTQ 498

>YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial
           aldehyde dehydrogenase [1560 bp, 519 aa]
          Length = 519

 Score =  354 bits (909), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/486 (40%), Positives = 272/486 (55%), Gaps = 14/486 (2%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G  Y QP GLFI+N+FV        +  NP+  E I   Y              
Sbjct: 33  IKLP-NGLEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAA 91

Query: 68  XXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126
              +    W                  ++++++V+A IETLD+GK   +++  D+D V  
Sbjct: 92  DRAFSNGSWNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAI-SSSRGDVDLVIN 150

Query: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186
             +  AG ADK+  G       T  +YT   P GV  QI+PWN+PL M +WK    L  G
Sbjct: 151 YLKSSAGFADKI-DGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTG 209

Query: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246
           N VV+K +E+T LS LY +  + +AG PPGV N++ G G  VG+ +  H  + K+AFTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGS 269

Query: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306
           TA G+ +  +AA + LK VTLE GGKSP ++FADA+L  AV  +  GI+YNSG+ C A S
Sbjct: 270 TATGRHIYQSAA-AGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGS 328

Query: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366
           R+YV+E++YD F+++F+A   S        F +    G   S+ Q ++++ Y++ G NE 
Sbjct: 329 RVYVEESIYDKFIEEFKAASESIKV--GDPFDESTFQGAQTSQMQLNKILKYVDIGKNEG 386

Query: 367 LAY----EQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAN 422
                  E+ GS   KGY+I PT+F DV +  R+ +EEIFGPV  V KFK  DE I  AN
Sbjct: 387 ATLITGGERLGS---KGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMAN 443

Query: 423 DTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAG 482
           D+ YGLA+ + T NI  A +    V +GTVW+N+ ND    VPFGGF  SG+GRE+    
Sbjct: 444 DSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDA 503

Query: 483 LQTYLQ 488
           LQ YLQ
Sbjct: 504 LQNYLQ 509

>Kwal_26.6752
          Length = 522

 Score =  352 bits (903), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 265/480 (55%), Gaps = 13/480 (2%)

Query: 14  GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEE 73
           G  Y QP GLFI+N+FV    G   +  +PA  E I   Y                 ++ 
Sbjct: 38  GIEYEQPTGLFINNKFVRAKQGKTFEVISPATEEEITHVYEAREDDVEDAIAAADQAFKS 97

Query: 74  -RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYA 132
             W                  ++++ E +A IETLD+GK   T+A  D+  VA   R  A
Sbjct: 98  GVWSQVDPLVRAKALNKLAELIEDDLETIASIETLDNGKAI-TSARGDVQLVANYLRSCA 156

Query: 133 GGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIK 192
           G  DK+  G       T  +YT+  P GV  QI+PWN+PL M +WK    LA GN VV+K
Sbjct: 157 GWCDKV-DGRLINTGSTHFSYTVRQPLGVCGQIIPWNFPLLMWAWKVGPALATGNTVVLK 215

Query: 193 PSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQK 252
            +E+T LS LY +  + +AG PPGV N++ G G  +G+ L  H  + KIAFTGSTA G+ 
Sbjct: 216 TAESTPLSALYVSQFISKAGIPPGVVNIISGFGKIIGEALTTHPKIKKIAFTGSTATGRH 275

Query: 253 VMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQE 312
           +   A  SNLK VTLE GGKSP ++F DADL  AV  +  GI+YNSG+ C A SR+YV+E
Sbjct: 276 IYQNAG-SNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGEVCCAGSRVYVEE 334

Query: 313 AVYDAFLDKFRA---HVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAY 369
           +VYD FL++F+A   +V+    F    F      G   S+ Q  +++ Y+  G  E    
Sbjct: 335 SVYDQFLEEFKAAAENVKVGDPFDDATFQ-----GAQTSQMQLSKILKYVEIGKEEGATL 389

Query: 370 EQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGL 428
              G  +  KG++I PTIF +V +  R+ +EEIFGPV  V+KFK  DE I  AND+ YGL
Sbjct: 390 VTGGERIGNKGFFIKPTIFGNVEEDMRIVKEEIFGPVVTVSKFKTIDELIEKANDSEYGL 449

Query: 429 ASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTYLQ 488
           A+ V T +I  A      V +GTVWVN+ ND    VPFGGF  SGIGRE+G   L +Y Q
Sbjct: 450 AAGVHTSDINKALEVSNRVNAGTVWVNTFNDFHHCVPFGGFNASGIGREMGSEALDSYTQ 509

>CAGL0H05137g complement(495715..497208) highly similar to sp|P54115
           Saccharomyces cerevisiae YPL061w ALD6, hypothetical
           start
          Length = 497

 Score =  350 bits (898), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 273/485 (56%), Gaps = 10/485 (2%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G TY QP GLFI+NEFV    G  +   NP+  E I   +              
Sbjct: 11  IKLP-NGLTYEQPTGLFINNEFVESSDGKTMTIENPSTQEPIVDVFSATKEDVDYAVDCA 69

Query: 68  XXXYEER-WRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALA--DLDQV 124
              +E+  W                  ++E+ E++A IETLD+GK   T AL+  D+   
Sbjct: 70  ERAFEKSDWATQDPKVRARYLSKLADLMEEQLELIASIETLDNGK---TIALSRGDVQLS 126

Query: 125 AYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLA 184
               R  A  ADK+  G +         YT+  P GV AQI+PWN+PL M SWK    LA
Sbjct: 127 INCIRDAASYADKV-DGRSIDTGDGYMNYTIREPIGVCAQIIPWNFPLMMLSWKVGPALA 185

Query: 185 AGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFT 244
            GNC+V+KP+  T L+ LYF+SL ++ G P GV N++PG G  VG  L  H  V K+AFT
Sbjct: 186 MGNCIVLKPASATPLNALYFSSLCKQVGIPAGVVNIIPGPGGMVGTALTTHPKVRKVAFT 245

Query: 245 GSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTA 304
           GST +G+ +   A+ SNLK +TLE GGKS  ++F DA+L+  +  +  GIF N+GQ C++
Sbjct: 246 GSTDIGKDIAVKASASNLKKITLELGGKSAHLVFNDANLEKTLPNLVNGIFKNAGQICSS 305

Query: 305 NSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGIN 364
            SRIY Q  +YD  L +F+A++      G+  F +    G + +K QY+ ++ YIN G  
Sbjct: 306 GSRIYAQAGIYDRLLKEFKAYIEKNIKVGNP-FDESNFQGAITNKEQYNTILKYINIGKE 364

Query: 365 EKLAYEQFG-SVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAND 423
           E       G +  EKGY+I PT+F DV +  R+ +EEIFGP   ++KF++ ++ +  AND
Sbjct: 365 EGAKVLTGGETAAEKGYFIKPTVFYDVKEDMRVVKEEIFGPCVTISKFEEIEDGVAMAND 424

Query: 424 TNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGL 483
           + +GL + + TEN+  A +  + + SGTVW+N+ ND +  VPFGG+K SG GRE+G    
Sbjct: 425 SEFGLGAGIETENLSTALKVAKMLHSGTVWINTYNDFDSRVPFGGYKQSGYGREMGSEVY 484

Query: 484 QTYLQ 488
           + Y Q
Sbjct: 485 ECYTQ 489

>Scas_701.14
          Length = 515

 Score =  348 bits (893), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/491 (40%), Positives = 271/491 (55%), Gaps = 22/491 (4%)

Query: 8   INVPET---GFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXX 64
           + VP T   G  Y QP GLFI+ +FV        +  NP+  E+I   Y           
Sbjct: 24  LRVPVTLPNGLKYEQPTGLFINGDFVPSKQNKIFEVINPSTEEVITPVYEAMEDDVDIAV 83

Query: 65  XXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQV 124
                 ++  W                  V++  E+LA IET D+GK    + L     V
Sbjct: 84  AAAKKAFKS-WSIADPEVRASALFKLANLVEKNAELLASIETADNGK----SLLCSRGDV 138

Query: 125 AYVTRYY---AGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQG 181
           A V++Y     G ADK++ G+         AYT   P GV  QI+PWN+PL M SWK   
Sbjct: 139 ALVSKYLRSCGGWADKIN-GNVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKIGP 197

Query: 182 CLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKI 241
            LA GN VV+KP+E T LS L+ + L   AG P GV N++PG G  VG++L +H  V KI
Sbjct: 198 ALATGNTVVLKPAETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVGEKLCKHPDVKKI 257

Query: 242 AFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQN 301
           AFTGST  G  +M  AA   +K VTLE GGKSP ++FADADLD A+  +A GIFYNSG+ 
Sbjct: 258 AFTGSTKTGSHIMKTAA-DTVKKVTLELGGKSPNIVFADADLDKAIENIAFGIFYNSGEV 316

Query: 302 CTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINH 361
           C A SRIYVQ+ VYD  L+KF+ +  +    G   F +    G   SK Q  +++ Y+  
Sbjct: 317 CCAGSRIYVQDTVYDTVLNKFKKYTEN-LKVGDP-FDESTFQGAQTSKAQLTKILKYVKV 374

Query: 362 GINEKLAY----EQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEA 417
           G +E        E+FG+   KGY++ PTIF DV +  ++ +EE+FGP+  ++KF   DE 
Sbjct: 375 GTDEGARVVTGGERFGN---KGYFVKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEV 431

Query: 418 IRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRE 477
           I  AND+ YGLA+ + T+++  A    + +Q+GTVW+N+ N     VPFGGF  SGIGRE
Sbjct: 432 IDMANDSQYGLAAGIHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGRE 491

Query: 478 LGKAGLQTYLQ 488
           +G A L  Y Q
Sbjct: 492 MGAAALDNYTQ 502

>CAGL0D06688g 639883..641457 highly similar to sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4 or sp|P40047
           Saccharomyces cerevisiae YER073w ALD5, hypothetical
           start
          Length = 524

 Score =  348 bits (893), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/483 (39%), Positives = 268/483 (55%), Gaps = 8/483 (1%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G  Y QP GLFI+N+FV        +  NP+  E I   Y              
Sbjct: 39  IKLP-NGLEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQAA 97

Query: 68  XXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126
              ++   W                  +++++E++A IE+LD+GK  ++ A  D+  V  
Sbjct: 98  DTAFKNGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINS-ARGDVQLVIN 156

Query: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186
             +  AG ADK+  G           Y  + P GV  QI+PWN+PL M +WK    L  G
Sbjct: 157 YLKSSAGVADKI-DGRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTG 215

Query: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246
           N VV+K +E+T LS LY +  + +AG PPGV N++ G G  VG+ L  H  + KIAFTGS
Sbjct: 216 NTVVLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIAFTGS 275

Query: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306
           TA G+ + ++AA + LK VTLE GGKSP ++FADADL  AV  +  GI+YNSG+ C A S
Sbjct: 276 TATGKHIYSSAAQT-LKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVCCAGS 334

Query: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366
           R+YV+E++YD F  +F+         G+  F +    G   S+ Q D+++ Y+  G  E 
Sbjct: 335 RVYVEESIYDEFAQEFKT-ASEALKVGNP-FDESTFQGAQTSQMQLDKILSYVEIGKKEG 392

Query: 367 LAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTN 425
                 G  + EKGY+I PTIF DV +  R+ +EEIFGPV  V KFKD D  ++ AND+ 
Sbjct: 393 ATLITGGERIGEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHVVQMANDSE 452

Query: 426 YGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQT 485
           YGLA+ + T NI  A +    +++GTVWVN+ ND    +PFGGF  SG+GRE+ K  L  
Sbjct: 453 YGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGREMSKEALDG 512

Query: 486 YLQ 488
           YLQ
Sbjct: 513 YLQ 515

>Kwal_27.11976
          Length = 526

 Score =  347 bits (891), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/492 (38%), Positives = 271/492 (55%), Gaps = 15/492 (3%)

Query: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXX 60
           M   F ++  P  G TY QP GLFI+NEFV    G+ +   +PA  + I           
Sbjct: 33  MKADFVKVTTP-NGLTYEQPTGLFINNEFVKSHNGATIAVEDPATEKKIVEVQSGTKEDV 91

Query: 61  XXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                     +   W                  +++ +E+++ IE +D+GK     A  D
Sbjct: 92  EYAVECAEKAFNSSWSTGDPRVRARALLKLADLIEQRKELISSIECMDNGKALFL-AKND 150

Query: 121 LDQVAYVTRYYAGGADKM-----HQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMA 175
           +  V    R  AG ADK+     + GD +        YTL  P GV  QI+PWN+PL M 
Sbjct: 151 VRIVIDYIRSSAGFADKLDGRTINTGDGYV------NYTLREPVGVCGQIIPWNFPLLML 204

Query: 176 SWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEH 235
           SWK    LAAGN V++KP+  T L+ LYFASL + AG P GV N++PG G +VG+ L  H
Sbjct: 205 SWKIAPALAAGNTVILKPASPTPLNALYFASLCKEAGIPAGVVNIIPGPGRDVGETLTTH 264

Query: 236 KGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIF 295
             + KIAFTGST  G+ +   AA SNLK VTLE GGKS  ++F DA+L+  +  +  GIF
Sbjct: 265 PKIRKIAFTGSTGTGKGIAVKAAQSNLKKVTLELGGKSAHMVFNDANLEKTIPNLVNGIF 324

Query: 296 YNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRV 355
            N+GQ C++ SRIYVQE +YD  L  F+ +V    + GS  F +    G + +K Q+D +
Sbjct: 325 LNAGQICSSGSRIYVQEGIYDKLLPAFKKYVEEVITVGSP-FDESNFQGAINNKAQFDTI 383

Query: 356 MGYINHGINEKLAYEQFGSVP-EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDY 414
           M Y+  G  E       G    ++GY+I PTIF DV +  R+ +EEIFGPV  ++KFK+ 
Sbjct: 384 MNYVGIGKEEGAKVLTGGKRSGDQGYFIRPTIFYDVNEDMRIVKEEIFGPVVTISKFKEI 443

Query: 415 DEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGI 474
           ++ +  AN++ +GL + + TE++  A +  + +++GTVWVN+ ND +  VPFGG K SG 
Sbjct: 444 EDGVAMANNSEFGLGAGIQTESVSTALKVSKMLKAGTVWVNTYNDFDSSVPFGGCKQSGY 503

Query: 475 GRELGKAGLQTY 486
           G E+G     +Y
Sbjct: 504 GSEMGIEAFDSY 515

>ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH]
           complement(1457469..1458992) [1524 bp, 507 aa]
          Length = 507

 Score =  346 bits (888), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/489 (40%), Positives = 273/489 (55%), Gaps = 8/489 (1%)

Query: 2   SELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXX 61
           S+L   I +P  G  Y QP GLFI+NEFV    G  ++   PA  E++   Y        
Sbjct: 16  SDLSVTIKLP-NGVEYEQPTGLFINNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVD 74

Query: 62  XXXXXXXXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD 120
                    ++  +W                  ++E+ EV+A IE LD+GK + ++A  D
Sbjct: 75  IAVSAAQKAFKSGKWFGADPMVRVKALSKLADLIEEDLEVIASIEFLDNGKVF-SHARFD 133

Query: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           +  V    R  AG ADK+  G +     +   YT   P GV  QI+PWN+PL M +WK  
Sbjct: 134 IGMVVNYLRCCAGLADKV-DGRSIDTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVG 192

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
             LA GN VV+K +E T LS LY ++ VR+AG P GV N++ G G  VG+ +  H GV K
Sbjct: 193 PALATGNTVVLKTAEFTPLSALYVSNHVRKAGIPAGVVNIISGYGKTVGEAIIRHPGVKK 252

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           IAFTGSTA G+ +   AA  +LK V+LE GGKSP +IFADADL  A   V   IF+N G+
Sbjct: 253 IAFTGSTATGRHIYEVAA-KDLKKVSLELGGKSPNIIFADADLKKAAQNVLNSIFFNGGE 311

Query: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYIN 360
            C A SR+Y++E +Y+ FL + +A V  +   G   + KD   G   S+ Q D+++ YI 
Sbjct: 312 VCCAGSRMYIEEPIYEEFLQEIKA-VAESVKVGDPSW-KDTFQGAQTSQMQLDKILSYIE 369

Query: 361 HGINEKLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIR 419
            G  E       G  + EKGYY+ PTIF DV +  R+ +EEIFGPV  V KF + D+ + 
Sbjct: 370 IGKQEGARVVTGGERLGEKGYYVKPTIFADVREDMRIVKEEIFGPVVTVTKFTNIDDLLE 429

Query: 420 YANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELG 479
            ANDT YGLA+ V++ +++ A      + +GTVW+N+ ND    VPFGG+K SG GRE+G
Sbjct: 430 MANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINTYNDFHCSVPFGGYKGSGFGREMG 489

Query: 480 KAGLQTYLQ 488
              ++ Y Q
Sbjct: 490 AEVVENYTQ 498

>KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomyces
           cerevisiae YOR374w ALD4 aldehyde dehydrogenase,
           mitochondrial, start by similarity
          Length = 522

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/484 (39%), Positives = 270/484 (55%), Gaps = 8/484 (1%)

Query: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXX 66
           ++++P  G +Y QP GLFI+N+FV    G   +  +P+  E I   Y             
Sbjct: 36  KVDLP-NGISYEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEA 94

Query: 67  XXXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVA 125
               ++   W                  ++++ + +A IE+LD+GK   ++A  D+  V 
Sbjct: 95  ADKAFKSGVWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAI-SSAKGDVQLVV 153

Query: 126 YVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAA 185
              R  AG ADK+  G       T  +YT+  P GV  QI+PWN+PL M +WK    LA 
Sbjct: 154 NYLRSAAGYADKV-DGRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALAT 212

Query: 186 GNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTG 245
           GN VV+K +E+T LS LY +  + +AG P GV N++ G G  VG+ +  H  + K+AFTG
Sbjct: 213 GNTVVLKTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVAFTG 272

Query: 246 STAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTAN 305
           STA G+ +   A + NLK VTLE GGKSP V+FADA+L SAV     GI+YNSG+ C A 
Sbjct: 273 STATGRHIYQNAGV-NLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGEVCCAG 331

Query: 306 SRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINE 365
           SR+YV+E++YD FL + ++        G   F  +   G   S+ Q D+++ Y+  G NE
Sbjct: 332 SRLYVEESIYDDFLKEIKS-ASEALKVGDP-FDAETFQGAQTSQNQLDKILKYVEIGKNE 389

Query: 366 KLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDT 424
                  G  + +KGY++ PTIF DV +S R+ +EEIFGPV  V KFK  DE I  AND+
Sbjct: 390 GATLITGGERIGDKGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDELIEKANDS 449

Query: 425 NYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQ 484
            YGLA+ + T NI  A +    + +GTVW+N+ ND    VPFGGF  SGIGRE+G   L 
Sbjct: 450 EYGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGREMGSEALD 509

Query: 485 TYLQ 488
            Y Q
Sbjct: 510 NYTQ 513

>ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH]
           complement(286308..287849) [1542 bp, 513 aa]
          Length = 513

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/492 (39%), Positives = 269/492 (54%), Gaps = 20/492 (4%)

Query: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXX 63
           L  ++ +P  G +Y QP GLFID +FV        +  +P   E I   Y          
Sbjct: 22  LTVQVRLP-NGNSYEQPTGLFIDGKFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVDAA 80

Query: 64  XXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQ 123
                  +   W                  +++ +E LA IE+LD+GK    + L     
Sbjct: 81  VAAAKRAFLP-WSRADPEVRAQCLFKLADLIEKHQETLANIESLDNGK----SLLCSRGD 135

Query: 124 VAYVTRYY---AGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180
           VA V RY     G ADK++ G+         +YT   P GV  QI+PWN+PL M SWK  
Sbjct: 136 VALVARYLRTCGGWADKIY-GNVMETGPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIG 194

Query: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240
             LA GN VV+KP+E+T LS LY  +L   AG P GV N++PG G  VG+ L  H  V K
Sbjct: 195 PALATGNTVVLKPAESTPLSALYVCNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKK 254

Query: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300
           +AFTGSTA G+ +M   A   +K VTLE GGKSP ++FADAD+D AV  +  GIFYN+G+
Sbjct: 255 VAFTGSTATGRHIMRTCA-ETVKKVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGE 313

Query: 301 NCTANSRIYVQEAVYDAFLDKFRA---HVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMG 357
            C A SR+YVQ++VYD  L+KF+    +++    F  G+F      G   S+ Q D+++ 
Sbjct: 314 VCCAGSRVYVQDSVYDEVLEKFKQFSENLKVGNPFEEGVFQ-----GAQTSQMQVDKILS 368

Query: 358 YINHGINEKLAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDE 416
           Y++ G+ E       G  +  KG++I PTIF DV ++ R+ ++EIFGPV  V+KF   DE
Sbjct: 369 YVDIGVKEGARIVAGGERLGRKGFFIKPTIFADVNENMRVVKDEIFGPVVTVSKFSTVDE 428

Query: 417 AIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGR 476
            I  AN++ YGLA+ + T +I  A      +++GTVWVN+ ND    VPFGGF  SGIG 
Sbjct: 429 VIAMANNSQYGLAAGIHTTDINKAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFGQSGIGS 488

Query: 477 ELGKAGLQTYLQ 488
           E+G   L  Y Q
Sbjct: 489 EMGVQALDNYTQ 500

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score =  340 bits (872), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/483 (39%), Positives = 266/483 (55%), Gaps = 8/483 (1%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G  Y QP GLFI+N+FV    G   +  +P+  E I   Y              
Sbjct: 33  IKLP-NGIEYEQPTGLFINNKFVPSKQGKTFEVISPSTEEEICHIYEGREEDVDLAVEAA 91

Query: 68  XXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126
              ++   W                  +++++E +A IE+LD+GK   T+A  D+  V  
Sbjct: 92  DKAFKNGSWSTVDPLVRANALNKLADLIEKDKETIASIESLDNGKAI-TSARGDISLVVN 150

Query: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186
             R  AG ADK+  G       T  +YT   P  V  QI+PWN+PL M +WK    LA G
Sbjct: 151 YLRSSAGYADKI-DGRLINTGSTHFSYTRREPLCVCGQIIPWNFPLLMWAWKIAPALATG 209

Query: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246
           N VV+K +E+T LS LY +  + +AG PPGV N++ G G  VG+ +  H  + K+AFTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSQYIPKAGIPPGVVNIVSGFGKIVGEAITTHPKIKKVAFTGS 269

Query: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306
           TA G+ +   A + NLK VTLE GGKSP +IFADA+L  AV  V  GI++NSG+ C A S
Sbjct: 270 TATGRHIYQNAGV-NLKKVTLELGGKSPNIIFADANLKEAVKNVILGIYFNSGEVCCAGS 328

Query: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366
           R+YV+E++YD  +++ +A   +        F +    G   S+ Q D+++ Y+  G  E 
Sbjct: 329 RVYVEESIYDKAVEEIKAASEAVKV--GDPFDESTFQGAQTSQNQLDKILKYVEIGRKEG 386

Query: 367 LAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTN 425
                 G  + +KGY+I PTIF DV ++ R+ +EEIFGPV  + KFKD ++ +  AND+ 
Sbjct: 387 ATLVTGGERLGDKGYFIKPTIFSDVEENMRIVKEEIFGPVVTITKFKDVEDLVEKANDSE 446

Query: 426 YGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQT 485
           YGLA+ + T NI  A      + +GTVW+N+ ND    VPFGGF  SGIGRE+G   L  
Sbjct: 447 YGLAAGIHTSNINNAINVSNRLNAGTVWINTFNDFHHSVPFGGFNASGIGREMGSEALDN 506

Query: 486 YLQ 488
           Y Q
Sbjct: 507 YTQ 509

>Scas_663.4
          Length = 520

 Score =  338 bits (868), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/483 (38%), Positives = 267/483 (55%), Gaps = 8/483 (1%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G  + QP GLFI+N+ V    G   +  NP+  + I   Y              
Sbjct: 34  IKLP-NGLEFEQPTGLFINNKNVPSKQGKTFEVINPSTEDEICHIYEGREDDVDIAVKAA 92

Query: 68  XXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126
              +    W                  +++++E++A IE+LD+GK  ++ A  D++ V  
Sbjct: 93  SDAFNNGSWSTIDPIYRGQALYKLAELIEKDKEIIASIESLDNGKAINS-ARGDVELVVN 151

Query: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186
             +  AG A+K+  G           YT   P GV  QI+PWN+PL M +WK    L  G
Sbjct: 152 YLKSSAGMANKL-DGRLIDSGSNYFNYTKREPLGVCGQIIPWNFPLLMWAWKIAPALITG 210

Query: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246
           N VV+K +E+T LS LY A  +  AG PPGV N++ G G  VG+ +  H  + KIAFTGS
Sbjct: 211 NTVVLKTAESTPLSALYAAKYIPEAGIPPGVVNIVSGFGKIVGEAMTSHPLIKKIAFTGS 270

Query: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306
           TA G+ +   AA S LK VTLE GGKSP +IFADA+L  AV  V  GI+YNSG+ C A S
Sbjct: 271 TATGKHIYQNAAAS-LKKVTLELGGKSPNIIFADANLKKAVQNVITGIYYNSGEVCCAGS 329

Query: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366
           R+YVQE++YD  +++ +A   +        F +    G   S+ Q ++++ Y+  G NE 
Sbjct: 330 RVYVQESIYDELIEEIKAASEAVKV--GDPFDETTFQGAQTSQMQLNKILKYVEIGKNEG 387

Query: 367 LAYEQFGS-VPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTN 425
                 G  V +KGY++ PTIF  V +  R+ +EEIFGPV  ++KFK  DE ++ AND+ 
Sbjct: 388 AQLITGGERVGKKGYFVKPTIFGGVQEDMRIVKEEIFGPVVTISKFKTLDEVVQMANDSE 447

Query: 426 YGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQT 485
           YGLA+ + T NI  A +    +++GTVW+N+ ND    VPFGGF  SG+GRE+G   L+ 
Sbjct: 448 YGLAAGIHTSNINTATKVADRLKAGTVWINTYNDFHCNVPFGGFNASGLGREMGTEALEN 507

Query: 486 YLQ 488
           YLQ
Sbjct: 508 YLQ 510

>Scas_664.24
          Length = 499

 Score =  325 bits (833), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/485 (37%), Positives = 267/485 (55%), Gaps = 11/485 (2%)

Query: 8   INVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXX 67
           I +P  G TY QP GLFI+NEF+       ++  NPA  E++                  
Sbjct: 14  ITLP-NGITYNQPTGLFINNEFMKSQDYKTIKVENPATAEIVCEVSSGTSEDVEYAVESA 72

Query: 68  XXXYEER-WRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALA--DLDQV 124
              + +  W                  ++E  E++A IETLD+GK   T AL+  D+   
Sbjct: 73  EHAFNDTDWATQDPKIRGRYLSKLADLMEENLELMASIETLDNGK---TLALSRGDVGLA 129

Query: 125 AYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLA 184
               R  A  ADK++ G           +T++ P GV  QI+PWN+PL M SWK    LA
Sbjct: 130 INCIRDAASYADKIN-GRTINSGDGYMNFTVKEPIGVCGQIIPWNFPLMMLSWKIAPALA 188

Query: 185 AGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFT 244
            GN +++KP+  T L+ L+FASL ++ G P GV N++PG G  VG  +  H  + K AFT
Sbjct: 189 MGNVIILKPASATPLNALFFASLCKKVGIPAGVVNIIPGPGRTVGNAITTHPRIRKAAFT 248

Query: 245 GSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTA 304
           GST +G+ +   A+ SNLK +TLE GGKS  ++F DA+++  +  +  GIF N+GQ C++
Sbjct: 249 GSTEIGKDIAIKASGSNLKKITLELGGKSAHLVFDDANIEKTLPNLVNGIFKNAGQICSS 308

Query: 305 NSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGIN 364
            SRIYVQE +YD  +  F+ +V +    G   F +    G + ++ QY+ ++ YI  G  
Sbjct: 309 GSRIYVQEGIYDKLMPAFKKYVEN-LKVGDP-FDESNFQGAITNREQYETILKYIKIGKE 366

Query: 365 EKLAYEQFG-SVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAND 423
           E       G ++  KGY+I PTIF DV +   + REEIFGPV  V+KFKD ++ +  AN 
Sbjct: 367 EGAKILTGGETIGNKGYFIKPTIFYDVKEDMEIVREEIFGPVVTVSKFKDIEDGVAMANA 426

Query: 424 TNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGL 483
           + +GL + + TEN+  A +  + ++SGTVW+N+ ND +  VPFGG K SG GRE+G+   
Sbjct: 427 SEFGLGAGIETENLSTALKVAKMLKSGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVY 486

Query: 484 QTYLQ 488
             Y +
Sbjct: 487 DCYTE 491

>YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldehyde
           dehydrogenase [1503 bp, 500 aa]
          Length = 500

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/486 (36%), Positives = 262/486 (53%), Gaps = 10/486 (2%)

Query: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXX 66
           +I +P  G TY QP GLFI+N+F+    G      +P+    +                 
Sbjct: 13  KITLP-NGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIEC 71

Query: 67  XXXXYEE-RWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALA--DLDQ 123
               + +  W                  ++ + ++++ IE LD+GK   T ALA  D+  
Sbjct: 72  ADRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGK---TLALARGDVTI 128

Query: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183
                R  A  ADK++ G           +T   P GV  QI+PWN+P+ M +WK    L
Sbjct: 129 AINCLRDAAAYADKVN-GRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPAL 187

Query: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243
           A GN  ++KP+  T L+ LYFASL ++ G P GV N++PG G  VG  L     + K+AF
Sbjct: 188 AMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAF 247

Query: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303
           TGST VG+ V   ++ SNLK +TLE GGKS  ++F DA++   +  +  GIF N+GQ C+
Sbjct: 248 TGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICS 307

Query: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGI 363
           + SRIYVQE +YD  L  F+A++ +    G+  F K    G + ++ Q+D +M YI+ G 
Sbjct: 308 SGSRIYVQEGIYDELLAAFKAYLETEIKVGNP-FDKANFQGAITNRQQFDTIMNYIDIGK 366

Query: 364 NEKLAYEQFG-SVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYAN 422
            E       G  V +KGY+I PT+F DV +  R+ +EEIFGPV  VAKFK  +E +  AN
Sbjct: 367 KEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEEGVEMAN 426

Query: 423 DTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAG 482
            + +GL S + TE++    +  + +++GTVW+N+ ND +  VPFGG K SG GRE+G+  
Sbjct: 427 SSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEV 486

Query: 483 LQTYLQ 488
              Y +
Sbjct: 487 YHAYTE 492

>KLLA0F12628g complement(1170396..1171910) similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase P9.1.f7. 1, start by
           similarity
          Length = 504

 Score =  250 bits (638), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 217/399 (54%), Gaps = 9/399 (2%)

Query: 96  EEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAF--ALSHTKQAY 153
           E ++ LA I TL++GKPY  ++L ++   A   +++A  A +++ GD    A+S  ++ +
Sbjct: 101 ENKQDLAKILTLENGKPYK-DSLGEIVYSAMFFKWFAEEAPRIY-GDIIPSAVSSDQKIF 158

Query: 154 TLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGF 213
           T+  P GV+  + PWN+P AM + K    +A GN  VIKP+  T LS L    +  +AG 
Sbjct: 159 TIRQPLGVIGILTPWNFPSAMIARKLAPVIATGNTCVIKPAHETPLSALALGVIAEKAGL 218

Query: 214 PPGVFNVLP-GLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAM-SNLKDVTLECGG 271
           P GV N+LP     E+G+ + EH+ V KI FTGST +GQ +M  ++   N+K  ++E GG
Sbjct: 219 PAGVCNILPTNHTSEIGEYVCEHELVKKITFTGSTKIGQLLMGQSSKGKNIKKFSMELGG 278

Query: 272 KSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYS 331
            +P ++F DADLD A++ +    F  SGQ C   +RI+V E +YD F  +    +  T+ 
Sbjct: 279 NAPYIVFKDADLDRALDGIIGCKFRQSGQTCICANRIFVHEDLYDEFSKRLVDKIDKTFK 338

Query: 332 FGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIPPTIFLD 389
            G G F      GP+I     D+V   +     +       GS        +  PT+  +
Sbjct: 339 LGDG-FQDGVTHGPLIHDKSIDKVASLVQDAKTKGADVLIGGSRASSLGPLFYQPTVLGN 397

Query: 390 VPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQS 449
           V +S  +  EEIFGPVA + KFKD DE I+ ANDT+ GLA   +++NI         +  
Sbjct: 398 VTESMDIFYEEIFGPVAPLIKFKDVDEVIKRANDTDVGLAGYFYSQNISTIFDAAEKLNV 457

Query: 450 GTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTYLQ 488
           G V VN+    E  VPFGG K SG+G+E  K G+  Y +
Sbjct: 458 GMVGVNTGEISEPAVPFGGVKNSGLGKEGSKYGIDDYTE 496

>Sklu_2087.3 , Contig c2087 4336-5856
          Length = 506

 Score =  238 bits (606), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/403 (34%), Positives = 218/403 (54%), Gaps = 12/403 (2%)

Query: 94  VDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAF--ALSHTKQ 151
           + E ++ LA + TL++GKP   ++L +++  A   R++A  A +++ G+    + S  KQ
Sbjct: 100 IQEHKKDLARLITLENGKPIK-DSLGEIEYSASYFRWFAEEAPRIY-GNIIPSSGSSKKQ 157

Query: 152 AYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRA 211
            +T+  P GVV  + PWN+P AM + K   C+A GN  VIKP+  T LS L F  LV +A
Sbjct: 158 IFTIRQPLGVVGILTPWNFPSAMIARKLAPCIATGNSCVIKPAHETPLSALAFGWLVEQA 217

Query: 212 GFPPGVFNVLPGLGPEV-GQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSN--LKDVTLE 268
           G   G+ N+LP     V G+ +  H  + K+ FTGSTAVG+ +M      +  +K +++E
Sbjct: 218 GLAAGLCNILPTTYTSVTGEYICSHDLIRKVTFTGSTAVGKALMGQCLKDSKVIKKISME 277

Query: 269 CGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRS 328
            GG +P ++F DADL  +++ +    F  SGQ C   +RI+V E +YD F  K    + +
Sbjct: 278 LGGNAPFIVFKDADLMRSIDGLIGCKFRQSGQTCICANRIFVHEDIYDEFAKKLVERIET 337

Query: 329 TYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGY---YIPPT 385
           +++ G G F      GP+I ++  D+V+  + H    K A    G          +  PT
Sbjct: 338 SFTLGDG-FDPKVTHGPLIHESAVDKVVKLV-HDAKTKGAQVLTGGTRASSLGPLFYRPT 395

Query: 386 IFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVR 445
           +   V +S  +   EIFGPVA + KFK  DE I  AN T+ GLA   ++ N++       
Sbjct: 396 VLSGVNESMDIFHTEIFGPVASLVKFKSVDEVIERANATDVGLAGYFYSSNLQTVFDVAT 455

Query: 446 DVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTYLQ 488
            ++ G V VNSS   +  +PFGG K SGIGRE    G++ Y +
Sbjct: 456 RLEVGMVGVNSSAISDAAMPFGGIKNSGIGREGSMFGIEDYTE 498

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score =  231 bits (589), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 160/470 (34%), Positives = 230/470 (48%), Gaps = 12/470 (2%)

Query: 22  GLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXX 81
           G +I+ E++     S    T+PA  ++IA                    ++  ++ TS  
Sbjct: 19  GAYINGEWITSAKES-FNVTDPATDQVIAELPDFDSGEAEAALKAAHASFQS-YKKTSPT 76

Query: 82  XXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQG 141
                       + E  E LA I T ++GK     AL ++   A   ++++  A +++  
Sbjct: 77  QRSEWLRNLYDLIMENAEDLAAIVTWENGKSLR-EALVEIRYGATFFKWFSEEALRLYGT 135

Query: 142 DAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSL 201
                +   +A+T+  P GV A I PWN+P AM S KA   LAAG  V+IKP   T LS 
Sbjct: 136 TIQPSNPGNRAFTIRQPVGVCALICPWNFPNAMISRKAAPALAAGCTVIIKPDPQTPLSS 195

Query: 202 LYFASLVRRAGFPPGVFNVLP--GLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAM 259
           L  A L  +AGFPPGV NV+P      ++G  L E   V K++FTGSTAVG+ +M  AA 
Sbjct: 196 LALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTGSTAVGKILMQQAA- 254

Query: 260 SNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFL 319
           S +K V+ E GG +P +I  DAD++  V  V A  F   GQ C   +R+YV  ++ D F 
Sbjct: 255 STVKKVSFELGGNAPVIIMGDADMEKTVEEVLATKFRGMGQTCICANRLYVHRSIIDDFS 314

Query: 320 DKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQF--GSVPE 377
            +    V      G+G F +    G +I+    ++V  +    I E+ A      G  PE
Sbjct: 315 SRLVKKVEG-LKLGNG-FQEGVTHGSLINNAAIEKVERHAKDAI-ERGAKVLLPGGRAPE 371

Query: 378 KG-YYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTEN 436
            G ++  PT+  DV   S L REE FGP+  +  F   +E + YANDT YGLAS VF+EN
Sbjct: 372 LGPHFYSPTVLSDVKPDSVLTREETFGPLCAMIPFDTVEEVVGYANDTQYGLASYVFSEN 431

Query: 437 IRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
           I+  +     +  G V  N+    +  VPFGG K SG G E    G+  Y
Sbjct: 432 IKTVYSIAEALDFGMVACNTGLFSDSMVPFGGIKESGFGIEGSLHGINDY 481

>KLLA0E17545g 1553982..1555475 highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, start by similarity
          Length = 497

 Score =  224 bits (572), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 161/481 (33%), Positives = 238/481 (49%), Gaps = 12/481 (2%)

Query: 11  PETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXX 70
           PE   + L   G F+D +++          T+PA  E+IAT                   
Sbjct: 9   PEFKNSDLIRKGAFVDGQWLE-TASETFNVTDPATLEVIATLPDQSIEVIHEAIDSAAEA 67

Query: 71  YEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRY 130
           +   ++ T+              + E  + LA I T ++GK   + A  ++   A    +
Sbjct: 68  FR-LFKKTTPKTRSTWLRNLYNLMMENVDDLAKIITWENGKAL-SEAQGEVKYAASYFEW 125

Query: 131 YAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVV 190
           YA  A +M+       + + +A+T+  P GV   I PWN+P AM + KA   LAAG  VV
Sbjct: 126 YAEEAVRMYGTTIQPNNGSNRAFTVRQPVGVCGIICPWNFPSAMITRKAGAALAAGCTVV 185

Query: 191 IKPSENTSLSLLYFASLVRRAGFPPGVFNVL--PGLGPEVGQRLAEHKGVDKIAFTGSTA 248
           +KP   T LS L  A L  +AGFP GVFNV+      PE G  L E   V KI+FTGST 
Sbjct: 186 VKPDSQTPLSALALAHLAEKAGFPKGVFNVVLTATRTPEFGLALCESPKVKKISFTGSTN 245

Query: 249 VGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRI 308
           VG+ +M  +A S +K ++ E GG +P ++F DADL+ AV       F   GQ C   +RI
Sbjct: 246 VGKILMKQSA-STMKKLSFELGGNAPVIVFDDADLEQAVTQTILSKFRGLGQTCVCANRI 304

Query: 309 YVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLA 368
           YVQ  + D+F +K    V   +  G GL SK  + G +I++    +V  ++   + EK A
Sbjct: 305 YVQRTIIDSFAEKLAKQVNE-FVIGHGLDSKTTH-GCLINENAIKKVEAHVKDAL-EKGA 361

Query: 369 YEQF--GSVPEKG-YYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTN 425
                 G +PE G  +  PT+   VP ++ + ++E FGP+  +  F   +E + YANDT 
Sbjct: 362 KTVVAGGRLPELGPNFYAPTVLSHVPSTAVVNKDETFGPLCALIPFDTMEEVVGYANDTE 421

Query: 426 YGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQT 485
            GLAS VF++NI   +     +++G V  N+    E  +PFGG K SG GRE    G++ 
Sbjct: 422 LGLASYVFSKNIDTVYTVAEALETGMVSCNTGLFSECTIPFGGVKESGFGREGSLHGIED 481

Query: 486 Y 486
           Y
Sbjct: 482 Y 482

>Kwal_56.23106
          Length = 495

 Score =  224 bits (571), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/457 (33%), Positives = 230/457 (50%), Gaps = 11/457 (2%)

Query: 35  GSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXV 94
           G++ + T+PANGE+IA                    ++  ++ T+              +
Sbjct: 30  GAEFEVTDPANGEVIAKLPDQDVGIVDEAIDAAYEAFQS-FKKTTGRERATLLRKMHSLM 88

Query: 95  DEEREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYT 154
            E  E L  I + ++GKP     + ++   A    +YA  A +++     +   T + +T
Sbjct: 89  LENVEDLGKILSWENGKPL-AEGIGEIKYAASFYEWYAEEAPRINGTTINSAISTNRVFT 147

Query: 155 LEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFP 214
              P GV   I PWN+P AM + K    LAAG  VVIKP   T LS L  A L  +AG P
Sbjct: 148 ERQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVIKPDSQTPLSALALAHLAEKAGVP 207

Query: 215 PGVFNVLPG--LGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGK 272
            GVFNV+      PE G +L E   V K++FTGST VG+ +M  +A S +K ++ E GG 
Sbjct: 208 AGVFNVVLSHTKTPEFGLKLCESPKVKKVSFTGSTNVGKILMKQSA-STMKKLSFELGGN 266

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
           +P ++F DADLD AV    A  F   GQ C   +R+YVQ+++ D F  +F   V + +  
Sbjct: 267 APFIVFEDADLDKAVEQAIACKFRGLGQTCVCANRLYVQKSILDEFETRFAEKV-NQFVI 325

Query: 333 GSGLFSKDCNMGPVISKTQYDRVMGYINHGINE--KLAYEQFGSVPEKG-YYIPPTIFLD 389
           G   F +    G +I+    ++V  +    I +  K+  E  G +P+ G  +  PT+   
Sbjct: 326 GHA-FKEGVTHGCLINPKAIEKVEAHTKDAIEKGAKVVVEG-GRLPDLGPSFYAPTVVSQ 383

Query: 390 VPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQS 449
           VPQ + +  +E FGP+  +  F+  +E +R+ANDT  GLA+ VF++NI   +     +++
Sbjct: 384 VPQDAIVASQETFGPLCAIIPFETTEEVVRWANDTEVGLAAYVFSKNIDTIYTVSEALET 443

Query: 450 GTVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
           G V  N+    E  VPFGG K SG GRE    G++ Y
Sbjct: 444 GMVSCNTGVFSECAVPFGGVKESGFGREGSLHGIEDY 480

>YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyde
           dehydrogenase (4-Aminobutyrate catabolic enzyme) [1494
           bp, 497 aa]
          Length = 497

 Score =  221 bits (564), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 226/454 (49%), Gaps = 11/454 (2%)

Query: 38  LQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEE 97
            +  +PA+GE+IA                    ++  +++T+              + E 
Sbjct: 35  FEVVDPASGEIIARVPEQPVSVVEEAIDVAYETFK-TYKNTTPRERAKWLRNMYNLMLEN 93

Query: 98  REVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEV 157
            + LA I TL++GK     A  ++   A    +YA  A +++      L+   + +T+  
Sbjct: 94  LDDLATIITLENGKALG-EAKGEIKYAASYFEWYAEEAPRLYGATIQPLNPHNRVFTIRQ 152

Query: 158 PYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGV 217
           P GV   I PWN+P AM + KA   LA G  VVIKP   T LS L  A L  +AGFP G 
Sbjct: 153 PVGVCGIICPWNFPSAMITRKAAAALAVGCTVVIKPDSQTPLSALAMAYLAEKAGFPKGS 212

Query: 218 FNVLPGLG--PEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           FNV+      P++G+ L E   V K+ FTGST VG K++   + S LK ++ E GG +P 
Sbjct: 213 FNVILSHANTPKLGKTLCESPKVKKVTFTGSTNVG-KILMKQSSSTLKKLSFELGGNAPF 271

Query: 276 VIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSG 335
           ++F DADLD A+    A  F   GQ C   +R+YV  ++ D F       V+  +  G G
Sbjct: 272 IVFEDADLDQALEQAMACKFRGLGQTCVCANRLYVHSSIIDKFAKLLAERVKK-FVIGHG 330

Query: 336 LFSKDCNMGPVISKTQYDRVMGYINHGINE--KLAYEQFGSVPEKG-YYIPPTIFLDVPQ 392
           L  K  + G VI+ +  ++V  +    I++  K+  E  G + E G  +  P I   VP 
Sbjct: 331 LDPKTTH-GCVINSSAIEKVERHKQDAIDKGAKVVLEG-GRLTELGPNFYAPVILSHVPS 388

Query: 393 SSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTV 452
           ++ + +EE FGP+  +  F   +E + YANDT +GLA+ VF++N+   +     +++G V
Sbjct: 389 TAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLAAYVFSKNVNTLYTVSEALETGMV 448

Query: 453 WVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
             N+    +  +PFGG K SG GRE    G++ Y
Sbjct: 449 SCNTGVFSDCSIPFGGVKESGFGREGSLYGIEDY 482

>Scas_716.63
          Length = 494

 Score =  220 bits (560), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/450 (31%), Positives = 224/450 (49%), Gaps = 9/450 (2%)

Query: 41  TNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREV 100
           T+PA+G  IAT                   ++  +++T+              + E  E 
Sbjct: 35  TDPASGSKIATLPEQTSSDVEQAIDAAAKAFK-TYKNTTPRQRAQWLRNMFNLMMENLED 93

Query: 101 LAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYG 160
           LA + + ++GK   + +  ++   A    +YA  A +++       + + + +TL  P G
Sbjct: 94  LAKLISWENGKAL-SESRGEIKYAASFFEWYAEEAPRIYGTTIQTATASNRVFTLRQPVG 152

Query: 161 VVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNV 220
           V   I PWN+P AM + K    L AG  V++KP   T LS L    L+  AGFP GV NV
Sbjct: 153 VCGIICPWNFPSAMITRKVAAALTAGCTVIVKPDSQTPLSGLALGYLLEEAGFPEGVCNV 212

Query: 221 LPGLG--PEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIF 278
           +      P  G  L E   V KI+FTGST+VG+ +M  +A S LK ++ E GG +P ++F
Sbjct: 213 ILSHKNTPACGLTLCESPVVKKISFTGSTSVGKILMKQSA-STLKKLSFELGGNAPVIVF 271

Query: 279 ADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFS 338
            DADL+ AV    A  F   GQ C  ++RIYV  ++ D F +   A VR  ++ G GL S
Sbjct: 272 EDADLEVAVEQTIASKFRGLGQTCVCSNRIYVHSSIIDKFAELVAAKVRK-FTIGPGL-S 329

Query: 339 KDCNMGPVISKTQYDRVMGYINHGINE-KLAYEQFGSVPEKG-YYIPPTIFLDVPQSSRL 396
                G +I+    ++V  ++N  I +     E+ G +P  G  +  P +   V + + +
Sbjct: 330 DGVTHGCIINGKAIEKVESHVNDAITKGAQIIEKGGLIPSLGPNFYAPVVLSHVTKDALV 389

Query: 397 CREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNS 456
            +EE FGP+  +  F   +E I YANDT +GLA+ +F+++I   +     +++G V  N+
Sbjct: 390 AKEETFGPLCPIFSFDTLEEVIGYANDTEFGLAAYIFSKDIDTVYTAAEALEAGMVSCNT 449

Query: 457 SNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
               +  +PFGG K SG GRE    G++ Y
Sbjct: 450 GIFSDCAMPFGGVKESGFGREGSLHGIEDY 479

>CAGL0C04191g complement(409544..411019) highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, hypothetical start
          Length = 491

 Score =  218 bits (555), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 227/454 (50%), Gaps = 11/454 (2%)

Query: 38  LQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDEE 97
            +  +P+ GE+IA                    ++ ++++T               + E 
Sbjct: 29  FEVDDPSTGEIIAKLPEHDIAVVDRAVDAAYDAFQ-KYKNTLPRQRATWLRNLFNLMTEN 87

Query: 98  REVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEV 157
            E LA I T ++GK    ++ A++   A    +YA  A +++           +  T   
Sbjct: 88  AEDLAKIITWENGKSL-PDSRAEIKYAASYYEWYAEEAPRIYGATIQPSIPNNRVITKRQ 146

Query: 158 PYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGV 217
           P GV   I PWN+P AM + K    LAAG  VV+KP  +T LS L    LV +AGFP GV
Sbjct: 147 PVGVCGIICPWNFPSAMITRKVGAALAAGCTVVVKPDSHTPLSALAMTVLVEKAGFPKGV 206

Query: 218 FNVLPGL--GPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           FNV+      P++G+RL EH  V K+ FTGST +G+ +M  A+ S LK  + E GG +P 
Sbjct: 207 FNVVLSQHNTPKLGKRLCEHPKVKKVTFTGSTRIGKTLMEQAS-STLKKCSFELGGNAPF 265

Query: 276 VIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSG 335
           ++F DADLD AV+   A  F   GQ C   +R YVQ+ + D F +K    V+  +  G G
Sbjct: 266 IVFDDADLDLAVDQAIASKFRGMGQTCVCTNRFYVQDTIADEFAEKLVTKVKQ-FKIGDG 324

Query: 336 LFSKDCNMGPVISKTQYDRVMGYINHGINE--KLAYEQFGSVPEKGY-YIPPTIFLDVPQ 392
           +  +    G + +  Q D+V  +    I +  K+  E  G +P+ G  +  P +  +VPQ
Sbjct: 325 M-KEGVTHGCLTNAKQADKVDEHKKDAIEKGAKVLLEG-GRMPDLGKNFYAPVVLKNVPQ 382

Query: 393 SSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTV 452
           S+ + +EE FGP+  +  FK  +E + YANDT  GLAS VFT+N+         +++G V
Sbjct: 383 SAMVAKEETFGPLCPIFTFKTVEEVLGYANDTELGLASYVFTKNVNTLFTVSEALEAGMV 442

Query: 453 WVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
             N+    +  VPFGG K SG GRE    G+  Y
Sbjct: 443 SCNTGLFSDSSVPFGGVKESGFGREGSLYGIDDY 476

>AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH]
           complement(213684..215597) [1914 bp, 637 aa]
          Length = 637

 Score =  157 bits (398), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 141/506 (27%), Positives = 216/506 (42%), Gaps = 40/506 (7%)

Query: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXX 66
           E+ VPE    + +   LF  + +  P     +Q   PA G+ + +F              
Sbjct: 77  ELAVPEAAQKHWKGKRLFSASVY-DPQQPGMIQNYCPATGQFLGSFRSMSKEDIDERFAA 135

Query: 67  XXXXYEERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD----LD 122
                +  W  TS              V E +E+LA +   DSGK     +L +    ++
Sbjct: 136 AAKA-QVSWAKTSFAQRRQVLKTMQKFVLENQEMLARVACRDSGKTMLDASLGEIMVTME 194

Query: 123 QVAYVTRY---------YAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLA 173
           ++ ++ ++          AG A+       F +   K       P GVV  +V WNY   
Sbjct: 195 KLQWMIKHGERTLRPSKRAGPAN-------FFMKLYKGGEVRYEPLGVVGAVVSWNYSFH 247

Query: 174 MASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRA----GFPPGVFNVL----PGLG 225
                      AGN VVIK SE    S  +F  L R +    G  P +  +     P   
Sbjct: 248 NTLGPIIASTFAGNGVVIKCSEQVVWSSEFFVKLARESLKVCGHDPELVQLCYCFPPSET 307

Query: 226 PEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADA-DLD 284
            +       H  +  + F GS  V   V+A AA S L  V +E GGK   V+   A DL+
Sbjct: 308 DDTANYFTSHPSLRHLTFIGSKPVAHHVLACAAKS-LTPVVVELGGKDALVVLDSAKDLE 366

Query: 285 SAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFS-KDCNM 343
           S  + +  G F ++GQNC    R+ V +  YDA + K   H  S    G+ + + +D ++
Sbjct: 367 SLSSIIMRGTFQSAGQNCIGIERVIVCQKNYDALV-KILEHRISELRVGADIDNLEDVDV 425

Query: 344 GPVISKTQYDRVMGYINHGINEKLAYEQFGSV---PE--KGYYIPPTIFLDVPQSSRLCR 398
           G +IS  ++D +   I   +++       GS    P+  +G+Y  PT+ +DV    R+ +
Sbjct: 426 GAMISDNRFDYMEELIQDAVSQGARLLHGGSRYTHPKYPQGHYFQPTLLVDVTTDMRISQ 485

Query: 399 EEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSN 458
            E+FGPV  V K KD ++ IR ANDT +GL   VF +N +  +     +  G V +N   
Sbjct: 486 NEVFGPVLTVMKAKDIEDCIRIANDTPFGLGGSVFGKNRKDCNYVANHMNVGNVAINDFA 545

Query: 459 DEEV-GVPFGGFKMSGIGRELGKAGL 483
              V  +PFGG   SG GR  G+ GL
Sbjct: 546 TYYVCQLPFGGIGSSGYGRFGGEEGL 571

>KLLA0C10615g complement(912077..913999) similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, start by similarity
          Length = 640

 Score =  145 bits (365), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 124/477 (25%), Positives = 200/477 (41%), Gaps = 31/477 (6%)

Query: 32  PMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXX 91
           P     +Q+  PA G+ + +F                   + +W  TS            
Sbjct: 104 PEQPHMIQSYCPATGQFLGSFKSMSDTDIDEIVLLAERA-QLQWAKTSLKERLQVLLSLK 162

Query: 92  XXVDEEREVLAGIETLDSGKPYHTNALAD----LDQVAYVTRYYAGGADKMHQG-----D 142
             + E +E +A +   DSGK     ++ +    L+++ ++  +   G D +         
Sbjct: 163 NFILENQEAIARVACRDSGKTMLDASMGEILVTLEKIQWIIEH---GEDVLKPSARPGPT 219

Query: 143 AFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLL 202
            F +   K A     P GVV  IV WNYP           +  GN VV+K SE    S  
Sbjct: 220 NFFMKWYKGAEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVWSSK 279

Query: 203 YFASLVRRA----GFPPGVFNVLPGLGP----EVGQRLAEHKGVDKIAFTGSTAVGQKVM 254
           +F  LV+ A    G  P +  +   L P    +       H     + F GS  V   V+
Sbjct: 280 FFTLLVQEALKACGHDPNLVQLCYCLPPTGNDDAANYFTSHPVFKHLTFIGSKPVAHHVL 339

Query: 255 AAAAMSNLKDVTLECGGKSPAVIFADA-DLDSAVNYVAAGIFYNSGQNCTANSRIYVQEA 313
            AAA S L  V +E GGK   ++     DL +  + +  G F ++GQNC    R+ V   
Sbjct: 340 KAAADS-LTPVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQSAGQNCIGIERVIVSAK 398

Query: 314 VYDAFLDKFRAHVRSTYSFGSGLFS-KDCNMGPVISKTQYDRVMGYINHGINEKLAYEQF 372
            YDA +      V      GS + + +D +MG +IS  ++ ++   I+  +++       
Sbjct: 399 NYDALVSILNDRV-GQLRLGSDIDNLEDVDMGAMISDNRFGQLENLISDALSKGAKLLHG 457

Query: 373 GSV---PE--KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYG 427
           GS    P   +G++  PT+ +DV +  ++   E+FGP+  V + KD D+ IR AN   +G
Sbjct: 458 GSRYNHPNYPQGHFFQPTLLVDVTEDMQISHNEVFGPILTVMRAKDTDDCIRLANAAPFG 517

Query: 428 LASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEV-GVPFGGFKMSGIGRELGKAGL 483
           L   +F  +    +R    + +G V +N      V  +PFGG   SG G+  G+ GL
Sbjct: 518 LGGSIFGADFGECNRVANSLTTGNVAINDFATFYVCQLPFGGLNGSGYGKFGGEEGL 574

>Kwal_23.5699
          Length = 641

 Score =  143 bits (361), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 120/470 (25%), Positives = 196/470 (41%), Gaps = 27/470 (5%)

Query: 37  QLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXXXXVDE 96
           ++Q   PA G+ + + Y                  + +W  T+              + E
Sbjct: 110 RIQCYCPATGQFLGS-YPSMNEDDIDQLVSKATEAQVKWAKTTLEERTRVLVSLQDYILE 168

Query: 97  EREVLAGIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDA------FALSHTK 150
            ++ +A +   DSGK     ++ ++       ++     +K  Q         F +   K
Sbjct: 169 NQDSIARVACRDSGKTMLDASMGEILVTLEKLQWIIKNGEKALQPSKRSGPTNFFMKWYK 228

Query: 151 QAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRR 210
            A     P GVV  +V WNYP           +  GN +VIK SE    S  +FAS+ ++
Sbjct: 229 GAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIFTGNAIVIKCSEQVVWSSEFFASMCKK 288

Query: 211 A----GFPPGVFNVL----PGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNL 262
                GF P +  +     P          + H G+  + F GS  V   V+AAA+ S L
Sbjct: 289 CLESNGFDPNLIQLCYCRPPSATDNAANHYSSHPGLKHLTFIGSKPVAHHVLAAASKS-L 347

Query: 263 KDVTLECGGKSPAVIFADA--DLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLD 320
             V +E GGK  A+I  D+  DL +  + +  G F +SGQNC    R+ V    YD  + 
Sbjct: 348 TPVVVELGGKD-ALIALDSVKDLPALSSIIMRGTFQSSGQNCIGIERVIVSAKNYDELVS 406

Query: 321 KFRAHVRSTYSFGSGLFS-KDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPE-- 377
                V      GS + + +D +MG +IS  +++ +   +   I +       GS  +  
Sbjct: 407 ILEKRV-GQLRLGSDIDNLEDVDMGAMISDNRFEELERMVQDAIKQGARLLHGGSRYKHP 465

Query: 378 ---KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFT 434
              +G+Y  PT+ +DV     + + E+FGP+  V + +D  + IR AN   +GL   VF 
Sbjct: 466 NYPQGHYFQPTLLVDVTPLMEIAQNEVFGPIMTVMRAEDTQDCIRLANSAPFGLGGSVFG 525

Query: 435 ENIRVAHRFVRDVQSGTVWVNSSNDEEV-GVPFGGFKMSGIGRELGKAGL 483
            +    +     + +G V +N      V  +PFGG   SG G+  G+ GL
Sbjct: 526 SDYAECNYVANHLTTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGL 575

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score =  140 bits (353), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 110/409 (26%), Positives = 186/409 (45%), Gaps = 24/409 (5%)

Query: 98  REVLAGIETLDSGKPYHTNALAD----LDQVAYVTRY--YAGGADKMHQGDAFALSHTKQ 151
           ++++A +   DSGK     ++ +    L+++ +  ++   A    +      F +   K 
Sbjct: 171 QDLIARVACRDSGKTMLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKWYKG 230

Query: 152 AYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRA 211
           A     P GV++ IV WNYP           L  GN +V+K SE    S  +F  L+R+ 
Sbjct: 231 AEIRYEPLGVISSIVSWNYPFHNLLGPIIAALFTGNAIVVKCSEQVVWSSEFFVELIRKC 290

Query: 212 ----GFPPGVFNVLPGLGP----EVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLK 263
                  P +  +   L P    +       H G   I F GS  V   ++  AA S L 
Sbjct: 291 LEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYILKCAAKS-LT 349

Query: 264 DVTLECGGKSPAVIFADA-DLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKF 322
            V +E GGK   ++   A +LD+  + +  G F +SGQNC    R+ V +  YD  +   
Sbjct: 350 PVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDDLVKIL 409

Query: 323 RAHVRST-YSFGSGL-FSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSV---PE 377
              + +     GS +   ++ +MG +IS  ++D +   +   + +     Q GS    P+
Sbjct: 410 NDRMTANPLRQGSDIDHLENVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFKHPK 469

Query: 378 --KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTE 435
             +G+Y  PT+ +DV    ++ + E+FGP+ V+ K K+ D  ++ AN   +GL   VF  
Sbjct: 470 YPQGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSVFGA 529

Query: 436 NIRVAHRFVRDVQSGTVWVNSSNDEEV-GVPFGGFKMSGIGRELGKAGL 483
           +I+  +     +Q+G V +N      V  +PFGG   SG G+  G+ GL
Sbjct: 530 DIKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGL 578

>CAGL0F08965g complement(880296..882215) highly similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, hypothetical start
          Length = 639

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/436 (25%), Positives = 192/436 (44%), Gaps = 26/436 (5%)

Query: 72  EERWRHTSXXXXXXXXXXXXXXVDEEREVLAGIETLDSGKPYHTNALAD----LDQVAYV 127
           + +W  +S              + E ++++A +   DSGK     ++ +    L+++ ++
Sbjct: 140 QMKWAESSIAKRLEVLATLQKFILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWI 199

Query: 128 TRYYAGGADKMHQG--DAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAA 185
            ++     +   +     F +   K A     P GV++ IV WNYP           +  
Sbjct: 200 LKHGPSTLEPSRRPGPTNFFMKFYKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFT 259

Query: 186 GNCVVIKPSENTSLSLLYFASLVRR--------AGFPPGVFNVLPGLGPEVGQRLAEHKG 237
           GN +++K SE    S  +F  +VR+        +      + + P    +       H G
Sbjct: 260 GNAIIVKCSEQVVWSSEFFIEMVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPG 319

Query: 238 VDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADA-DLDSAVNYVAAGIFY 296
           +  I F GS +V   ++  A+ S L  V +E GGK   ++     DLD+  + +  G F 
Sbjct: 320 IKHITFIGSQSVASHILNCASKS-LTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQ 378

Query: 297 NSGQNCTANSRIYVQEAVYDAFLDKFRAHVRST-YSFGSGLFSKDC-NMGPVISKTQYDR 354
           +SGQNC    R+ V E  YD  ++     ++ T    GS +   +  +MG +IS  ++  
Sbjct: 379 SSGQNCIGIERVIVSEKNYDQLVNILEKRMKETPLRQGSDIDHLEVVDMGAMISDNRFKT 438

Query: 355 VMGYINHGINE--KLAY--EQFGSVPE--KGYYIPPTIFLDVPQSSRLCREEIFGPVAVV 408
           +   I   +++  +L Y   Q+   P+  +G+Y  PT+ +DV     + + E+FGPV V+
Sbjct: 439 LEALIQDAVSKGARLLYGGSQYNH-PKYPQGHYFQPTLLVDVTPDMDIAQNEVFGPVLVM 497

Query: 409 AKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEV-GVPFG 467
            K KD    I  AN   +GL   VF  +    +     +++G V +N      V  +PFG
Sbjct: 498 MKAKDTSNCIELANAAPFGLGGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFG 557

Query: 468 GFKMSGIGRELGKAGL 483
           G   SG G+  G+ GL
Sbjct: 558 GINGSGYGKFGGEEGL 573

>Scas_690.26
          Length = 651

 Score =  131 bits (330), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/479 (24%), Positives = 196/479 (40%), Gaps = 29/479 (6%)

Query: 32  PMGGSQLQTTNPANGELIATFYXXXXXXXXXXXXXXXXXYEERWRHTSXXXXXXXXXXXX 91
           P   + +Q   PA G+ IA+F                   + +W  +S            
Sbjct: 109 PSNPNHIQCYCPATGQYIASFPSKTKTELDDMIQRAEIA-QSKWSTSSMERRLRVLTSLR 167

Query: 92  XXVDEEREVLAGIETLDSGKPYHTNALAD----LDQVAYVTRYYAG--GADKMHQGDAFA 145
             +   +E++A I   DSGK     ++ +    L+++ ++  +        +      F 
Sbjct: 168 EYILSNQEMIASIACRDSGKTKLDASMGEILVTLEKLQWLITHGPSVLKPSRRPGPTNFF 227

Query: 146 LSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFA 205
           +   K A     P GVV+ IV WNYP           L  GN +V+K SE    S   F 
Sbjct: 228 MKWYKGAEIRYEPLGVVSAIVSWNYPFHNLWGPIIDSLFTGNAIVMKCSEQVVWSSEIFV 287

Query: 206 SLVR----RAGFPPGVFNVLPGLGP--------EVGQRLAEHKGVDKIAFTGSTAVGQKV 253
            L+R    + G  P +  +   L P        E       HK    I F GS  V  ++
Sbjct: 288 QLLRECLIQCGEDPELIQLFYCLPPNLEEDSNEETANYFTSHKAFKSITFIGSQQVSHQI 347

Query: 254 MAAAAMSNLKDVTLECGGKSPAVIFADA-DLDSAVNYVAAGIFYNSGQNCTANSRIYVQE 312
           +  AA + +  V +E GGK   ++     DL S  + +  G F +SGQNC    R+ V E
Sbjct: 348 LRCAAEA-ITPVVVELGGKDAFIVLDSVKDLQSISSIILRGTFQSSGQNCIGIERVIVSE 406

Query: 313 AVYDAFLDKF--RAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYE 370
             Y   ++    R +              D ++G +IS  ++D +   +   +++     
Sbjct: 407 KNYATLVEILSNRMNASPMRQGSDIDSIDDIDVGAMISDNRFDELELLVKDAVSKGARLL 466

Query: 371 QFGSVPE-----KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRYANDTN 425
             GS  +     +G Y  PT+ +DV    ++ + E+FGP+ V+ +  D +  I+ AN   
Sbjct: 467 CGGSRFQHPKYPQGNYFQPTLLVDVTPDMKIAQNEVFGPILVMMRANDTEHCIKLANSAP 526

Query: 426 YGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEV-GVPFGGFKMSGIGRELGKAGL 483
           +GL   VF  N++  +    ++++G V +N      V  +PFGG   SG G+  G+ GL
Sbjct: 527 FGLGGSVFGSNMQECNYVANELKTGNVAINDFATFYVCQLPFGGIHGSGYGKFGGEEGL 585

>Kwal_26.7595
          Length = 524

 Score =  129 bits (324), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 102/340 (30%), Positives = 161/340 (47%), Gaps = 29/340 (8%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  I P+NYP+ ++     G +A GN VV KPSE    + +    +++ +       +
Sbjct: 124 GAVLVISPFNYPVLLSLDPIAGAIAGGNSVVWKPSELVPATSIILEQILKDS-LGSDWIS 182

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVI-- 277
           V+ G  PE   +L ++   DKI +TGSTAVG  ++A  A  NL   TLE GGKSP  I  
Sbjct: 183 VVQGAIPET-TKLIKNAQFDKIFYTGSTAVGS-IVALEAGKNLVPYTLELGGKSPVFITE 240

Query: 278 -FADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEA-------VYDAFLDKFRAHVRST 329
            F+ + + +A++ V  G F NSGQ C A+  + V  +       +    LD+F   +   
Sbjct: 241 HFSKSKIRAALSRVYFGAFSNSGQTCVASDYVLVHSSQEELVKQLTREILDEFWPQLDEN 300

Query: 330 YSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGYYIPPTIFLD 389
             + S           +I +  Y+  +  + +    K+     GS+PE+   IPPT+  D
Sbjct: 301 TEYTS-----------MIHERAYNNTVKKLENTNGIKILPSNVGSLPERC--IPPTVVFD 347

Query: 390 VPQSSRLCREEIFGPVAVVAKFKDYDEAI-RYANDTNYGLASCVFTENIRVAHRFVRDVQ 448
           V     L +EE F PV     + + D AI +     NY LA  +F++N R   + +  ++
Sbjct: 348 VDWDDALMKEENFAPVLPFVTYSNLDSAISKVVELHNYPLALYIFSDNRREIDQIMFQIK 407

Query: 449 SGTVWVNSS--NDEEVGVPFGGFKMSGIGRELGKAGLQTY 486
           SG   +  +  +   +  PFGG + SG G   GK    T+
Sbjct: 408 SGGCVIGDTVIHVAAMDAPFGGIRSSGSGNYHGKWSFSTF 447

>Scas_717.74
          Length = 522

 Score =  126 bits (316), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 154/321 (47%), Gaps = 18/321 (5%)

Query: 156 EVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPP 215
           ++  G V  I P+N+P+ +A       + AGN V++KPSE T+ + L    ++  AGFP 
Sbjct: 121 KIARGNVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEAGFPD 180

Query: 216 GVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           G+  V+ G   E  QRL   K +D I +TGS  VG  ++A  A  NL    LE GGKSP 
Sbjct: 181 GLVQVVQGAIDET-QRLITSKDLDMIFYTGSPTVGS-IIAQEAAKNLTPCVLELGGKSPT 238

Query: 276 VI---FADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
            I   F D +L +A+  +  G F NSGQ C +   + V E+ Y    +K  A  +     
Sbjct: 239 FITENFNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHESKY----NKVAALAKEVLIE 294

Query: 333 GSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQ 392
                +       +IS+T Y+  +  +     EK  ++    + +    +PPT+  +   
Sbjct: 295 MFPEVNDSTEFTHLISETAYNTTLKKLEATSGEK--FQAKSDLSDTNICVPPTLIFNCQW 352

Query: 393 SSRLCREEIFGPVAVVAKFKDYDEAI-RYANDTNYGLASCVFTE-NIRVAHRFVRDVQSG 450
                ++E F P+  V K+ + D+ + +     N  L   +F++ N  ++H  +R ++SG
Sbjct: 353 EDSTMQQENFAPILPVLKYSNLDDTLDKIIATHNNPLVQYIFSDSNEEISHILLR-LKSG 411

Query: 451 TVWVNSSNDEEVGV---PFGG 468
              +N +    VG+   PFGG
Sbjct: 412 DCVINDT-ILHVGIQDAPFGG 431

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score =  123 bits (309), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/325 (28%), Positives = 148/325 (45%), Gaps = 15/325 (4%)

Query: 156 EVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPP 215
           ++  G V  I P+N+P+ +A       L+AGN V++KPSE T    L    +V+    P 
Sbjct: 122 KISRGNVLVISPFNFPVLLALAPVACALSAGNTVILKPSEMTPHCALVLEDIVKSCQLPE 181

Query: 216 GVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           GV  ++ G G E   +L   + +D I +TGS  VG  ++A AA  NL    LE GGKSP 
Sbjct: 182 GVLQIVQG-GVEQTTKLINSESLDMIFYTGSPRVGS-IVAQAAAKNLVPCVLELGGKSPT 239

Query: 276 VI---FADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
            I       +L++A+  +  G F N+GQ C +   + V E++YD  + +    ++  Y  
Sbjct: 240 FITGSLQKKNLETALKRIFFGAFGNAGQICVSPDYLLVHESIYDDVVKESGKVMKELYPD 299

Query: 333 GSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKG-YYIPPTIFLDVP 391
                ++      +I K  YD+ +  +      K++          G   IPPTI  D  
Sbjct: 300 ----LNEHTEYTHMIHKASYDKTLEKLQKTKGRKVSAADVKIDNTSGKLMIPPTIVFDSD 355

Query: 392 QSSRLCREEIFGPVAVVAKFKDYDEAI-RYANDTNYGLASCVFTENIRVAHRFVRDVQSG 450
               L  EE F PV  V K+ D D  I +  +  +  L   +F+E  +     +  ++SG
Sbjct: 356 WDDALMEEENFAPVLPVIKYTDIDATIDKILSKHDTPLVQYIFSEKQKEIDHILARLRSG 415

Query: 451 TVWVNSSNDEEVGV---PFGGFKMS 472
              +  +    VG+   PFGG   S
Sbjct: 416 DCIICDTTI-HVGIKDAPFGGIGQS 439

>KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces
           cerevisiae YMR110c, start by similarity
          Length = 521

 Score =  116 bits (291), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 146/338 (43%), Gaps = 17/338 (5%)

Query: 156 EVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPP 215
           ++  G V  I P+N+P+ +A     G +A GN VV KPSE T         +   A F  
Sbjct: 121 KIALGTVLVISPFNFPILLALDPLAGAIAGGNSVVFKPSELTPACAEVMEEICNEA-FEK 179

Query: 216 GVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           G    + G G E    L E    DKI +TGST VG  ++A  A  +L    LE GGKSP 
Sbjct: 180 GQVETVQG-GAEETSALVESGKFDKIFYTGSTTVGT-IIAEKAAKSLTPCVLELGGKSPV 237

Query: 276 VI---FADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
            I      +  ++A+  +      N+GQ C A   +   +++YD F+D  +  +   Y  
Sbjct: 238 FISPNLPKSQWETAIRRIYYSSMGNAGQICVAADYVLCPDSIYDEFVDSCKKVLNEFYPS 297

Query: 333 GSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQ 392
                + D     +I +  Y+R+   I     +K   +   ++P     IPPTI  DV  
Sbjct: 298 ----VTSDTEYTHMIHERAYNRIQTVIETTKGQKTVAQHSDNLPP--LCIPPTIISDVSW 351

Query: 393 SSRLCREEIFGPVAVVAKFKDYDEAI-RYANDTNYGLASCVFTENIRVAHRFVRDVQSGT 451
                  E FGP+  + ++ D DE I       +  L   +FT +       +  ++SG 
Sbjct: 352 DDPSMTGENFGPILPIMRYTDLDETIDTLIKRFDTPLVQYIFTNSKDEIDHILTRIRSGA 411

Query: 452 VWVNSSNDEEVGV---PFGGFKMSGIGRELGKAGLQTY 486
             VN +    VG+   PFGG   SG G   G    +T+
Sbjct: 412 CVVNDTL-LHVGIEEAPFGGIGTSGYGNYHGPYTFKTF 448

>KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1
           Kluyveromyces lactis delta 1-pyrroline-5-carboxylate
           dehydrogenase, start by similarity
          Length = 576

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 158/348 (45%), Gaps = 28/348 (8%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  + P+N+  A+A          GN VV KPS+N +LS     +++  AG P GV N
Sbjct: 206 GFVYAVTPFNF-TAIAGNLIGAPALMGNTVVWKPSQNANLSNYLLLTVLEEAGLPNGVVN 264

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVG-------QKVMAAAAMSNLKDVTLECGGK 272
            +PG   EV + +        + FTGSTAV        QK +      +   +  E GGK
Sbjct: 265 FVPGNAVEVTKEVLSDSEFAALHFTGSTAVFKQLYGDIQKGVVNGLYRDYPRIVGETGGK 324

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAF---LDKFRAHVRST 329
           +  +I   A++  +V     G F   GQ C+A SR+Y+ E+  + F   L    + V+  
Sbjct: 325 NFHLIHPSANIPHSVLSTLRGAFEFQGQKCSATSRVYLPESKSEEFFRDLGGVLSEVQPV 384

Query: 330 YSFGSGLFSKDCN--MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPE--KGYYIPPT 385
            +  S +   D +  +GPVI +  +D++   I+   N+      FG   +  KGYYI PT
Sbjct: 385 NTSASKINGGDLHGFIGPVIHEGSFDKLAKVIDDAKNDPELEIVFGGFHDKSKGYYIQPT 444

Query: 386 IFLDVPQSSRLCREEIFGPVAVV-----AKFKDYDEAIRYANDTNYGLASCVFT---ENI 437
           I            +E FGP+  V     AKF+D  E +   + + YGL   +F    E I
Sbjct: 445 IIKTTNPRHPYLSQEFFGPILTVYEYPDAKFEDVCELVD--STSQYGLTGSIFARDREAI 502

Query: 438 RVAHRFVRDVQSGTVWVNSSNDEEVGVP--FGGFKMSGIGRELGKAGL 483
           ++A   ++   +G  ++N  +   V     FGG +MSG   + G   +
Sbjct: 503 KIADEKLK-YSAGNFYINDKSTGAVVAQQWFGGARMSGTNDKAGSGNI 549

>AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH]
           (223170..224891) [1722 bp, 573 aa]
          Length = 573

 Score =  108 bits (270), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 95/344 (27%), Positives = 156/344 (45%), Gaps = 28/344 (8%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  + P+N+  A+A          GN VV KPS+N +LS     +++  AG P GV N
Sbjct: 203 GFVYAVSPFNF-TAIAGNLVGAPALMGNTVVWKPSQNAALSNYLLLTVLEEAGLPRGVIN 261

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKV-------MAAAAMSNLKDVTLECGGK 272
            +PG   +V + +   K +  + FTGSTAV +++       + +    +   +  E GGK
Sbjct: 262 FVPGNPVDVTEEVLADKALGGLHFTGSTAVFKQLYGKIQQGVVSGLYRDYPRIVGETGGK 321

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFR---AHVRST 329
           +  ++   A+L  AV     G F   GQ C+A SR+Y+ ++  DAFL       A ++  
Sbjct: 322 NFHLVHPSANLPHAVLSTLRGAFEFQGQKCSAASRLYLPQSKADAFLADLAGTLAAIKPA 381

Query: 330 YSFGSGLFSKDCN--MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIPPT 385
            +  S +   D +  MGPVI +  +D++   I     +      +G    K  GY++ PT
Sbjct: 382 NTSASSINGGDLHAFMGPVIHEQSFDKLAAAIERARTDPELEILYGGDHSKSQGYFVGPT 441

Query: 386 IFLDVPQSSRLCREEIFGPVAVVAKFKD--YDEAIRYANDTN-YGLASCVFTENIRVAHR 442
           +             E FGP+  V ++ D  +D+     + T+ YGL   VF  +      
Sbjct: 442 VVRTSNPRHDFMTAEFFGPILTVYEYPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAA 501

Query: 443 FVRDVQ--SGTVWVNSSNDEEVGVP-----FGGFKMSGIGRELG 479
             R ++  +G  ++   ND+  G       FGG +MSG   + G
Sbjct: 502 ADRRLKYAAGNFYI---NDKATGAVVAQQWFGGARMSGTNDKAG 542

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score =  106 bits (264), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 156/326 (47%), Gaps = 16/326 (4%)

Query: 156 EVPYGVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPP 215
           ++  G V  I P+N+PL +A       LAAGN +V+KPSE T  + +   +L+  AGFP 
Sbjct: 126 KISRGSVLIIAPFNFPLLLAFAPLAAALAAGNTIVLKPSELTPHTAVVMENLLTTAGFPD 185

Query: 216 GVFNVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPA 275
           G+  V+ G   E   RL +    D I +TGS  VG  ++A  A  +L    LE GGKSP 
Sbjct: 186 GLIQVVQGAIDET-TRLLDCGKFDLIFYTGSPRVGS-IVAEKAAKSLTPCVLELGGKSPT 243

Query: 276 VI---FADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
            I   F  +++  A+  +  G F NSGQ C +   + V +++Y   + +  + +   Y  
Sbjct: 244 FITENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPKVIKECESVLNEFYP- 302

Query: 333 GSGLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQ--FGSVPEKGYYIPPTIFLDV 390
               F +  +   +I +  Y + +  IN     K+   +    S  E    +PPTI  ++
Sbjct: 303 ---SFDEQTDFTRMIHEPAYKKAVASINSTNGSKIVPSKISINSDTEDLCLVPPTIVYNI 359

Query: 391 PQSSRLCREEIFGPVAVVAKFKDYDEAI-RYANDTNYGLASCVFTENIRVAHRFVRDVQS 449
                L ++E F PV  + +++D DE I +   + +  L   +F+++    +R +  ++S
Sbjct: 360 GWDDPLMKQENFAPVLPIIEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRS 419

Query: 450 GTVWVNSSNDEEVGV---PFGGFKMS 472
           G   V  +    VG+   PFGG   S
Sbjct: 420 GDCVVGDTVI-HVGITDAPFGGIGTS 444

>CAGL0D03982g 397039..398763 highly similar to sp|P07275
           Saccharomyces cerevisiae YHR037w PUT2
           1-pyrroline-5-carboxylate dehydrogenase, start by
           similarity
          Length = 574

 Score =  105 bits (262), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 94/344 (27%), Positives = 157/344 (45%), Gaps = 26/344 (7%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  + P+N+    A+      L  GN VV KPS+  +LS     +++  AG P GV N
Sbjct: 202 GFVYAVSPFNFTAIAANLIGAPALM-GNTVVWKPSQTAALSNYLLLTVLEEAGLPKGVIN 260

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQ----KVMAAAAMSNLKD---VTLECGGK 272
            +PG   E+   +   +    + FTGSTAV +    K+ +  A +  +D   +  E GGK
Sbjct: 261 FVPGDPVEITDEVLASRDFSALHFTGSTAVFKQLYGKIQSGVAENKYRDYPRIVGETGGK 320

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFL-DKF----RAHVR 327
           +  ++   A++  AV     G F   GQ C+A SR+Y+ +++ + F  D F       V 
Sbjct: 321 NYHLVHPSANVPHAVFNTIRGAFEFQGQKCSATSRLYLPKSMSEEFFRDMFGTLSNNKVV 380

Query: 328 STYSFGSGLFSKDCN--MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIP 383
              +  S +   + +  MGPVI +  ++++   I     +      +G   +K  G+YI 
Sbjct: 381 PVNTSASAISGGNLHGFMGPVIHEQSFNKLSAAIEEAKKDPELEILYGGQYDKSQGWYIG 440

Query: 384 PTIFLDVPQSSRLCREEIFGPVAVVAKFKD--YDEAIRYANDT-NYGLASCVFTEN---I 437
           PTI      + +    E FGP+  V +++D  + +     N+T  YGL   +F+ +   I
Sbjct: 441 PTIIRTTNPNHKFLTTEFFGPILTVYEYQDSQFKDICELINETGEYGLTGSIFSRDRDAI 500

Query: 438 RVAHRFVRDVQSGTVWVNSSNDEEVGVP--FGGFKMSGIGRELG 479
             A   +R   +G  ++N      V     FGG +MSG   + G
Sbjct: 501 IYASEKLR-FSAGNFYINDKCTGAVVAQQWFGGARMSGTNDKAG 543

>Kwal_23.5714
          Length = 576

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 95/351 (27%), Positives = 151/351 (43%), Gaps = 34/351 (9%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  + P+N+     +      L  GN VV KPS+   LS     +++  AG P GV N
Sbjct: 203 GFVYAVTPFNFTAISGNLIGAPALM-GNTVVWKPSQAACLSNYLLLTVLEEAGLPHGVVN 261

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKD-------VTLECGGK 272
            +PG   EV   +   K    + FTGSTAV +++        + D       +  E GGK
Sbjct: 262 FIPGNPVEVTDAVLADKEFAALHFTGSTAVFKQLYGKIQQGVVNDLYRDYPRIVGETGGK 321

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRA---HVRST 329
           +  ++   A +  AV     G F   GQ C+A SR+Y+  +    FL+        VR+ 
Sbjct: 322 NFHLVHPSASIPHAVLSTLRGAFEYQGQKCSAASRLYLPASRSAEFLEDLAGTLKEVRTV 381

Query: 330 YSFGSGLFSKDCN--MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIPPT 385
            +  S L   D +  MGPVI +  ++++   +    N+       G   +K  G++I PT
Sbjct: 382 NTSASKLNGGDLHGFMGPVIHQQSFEKLANALEEAKNDPELEIICGGECDKSNGWFIEPT 441

Query: 386 IFLDVPQSSRLCREEIFGPVAVVAKFKDYD-----EAIRYANDTNYGLASCVFTEN---I 437
           +        +    E FGP+  V ++ D +     E I     T+YGL   VF  +   I
Sbjct: 442 VVKTTNPLHKFMSTEFFGPLLTVCEYPDAEFTQVCETID--KTTSYGLTGAVFARDRDAI 499

Query: 438 RVAHRFVRDVQSGTVWVNSSNDEEVGVP-----FGGFKMSGIGRELGKAGL 483
            +A   ++   +G  ++   ND+  G       FGG +MSG   + G   +
Sbjct: 500 AIADEKLK-YSAGNFYI---NDKCTGAVVGQQWFGGARMSGTDDKAGSGNI 546

>Scas_690.41
          Length = 581

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/344 (26%), Positives = 151/344 (43%), Gaps = 26/344 (7%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G +  + P+N+    A+      L  GN V+ KPS++ +LS     +++  AG P GV N
Sbjct: 210 GFIYAVSPFNFTAIAANLIGAPALM-GNTVIWKPSQSAALSNYLLLTVLEEAGLPKGVIN 268

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQ----KVMAAAAMSNLKD---VTLECGGK 272
            +PG    V  +L   K    + FTGST V +    K+         +D   +  E GGK
Sbjct: 269 FVPGDPILVTDQLLASKEFGGLHFTGSTQVFKQLYGKIQTGVVNGLYRDYPRIVGETGGK 328

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKF-----RAHVR 327
           +  +I   A++ +AV     G F   GQ C+A SR+Y+ ++  + F         +  V 
Sbjct: 329 NFHLIHKSANIPNAVFSTIRGAFEFQGQKCSATSRLYIPQSKSEEFFRDLIGTLQQQKVT 388

Query: 328 STYSFGSGLFSKDCN--MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIP 383
              +  S +   D +  MGPVI +  Y++++  I     +      +G   +K  G+++ 
Sbjct: 389 PVNTAASPISGGDLHGFMGPVIHEQSYNKLIKVIEEAKTDPELEIIYGGQYDKGEGWFVG 448

Query: 384 PTIFLDVPQSSRLCREEIFGPVAVVAKFKD--YDEAIRYANDTN-YGLASCVFT---ENI 437
           PTI        +    E FGP+  V ++ D  + E     + T+ YGL   VF    E I
Sbjct: 449 PTIIKCKDPKHKFMTTEFFGPILSVYEYPDNKFSETCDLIDQTSMYGLTGSVFAKDREAI 508

Query: 438 RVAHRFVRDVQSGTVWVNSSNDEEVGVP--FGGFKMSGIGRELG 479
            +A   ++    G  ++N      V     FGG +MSG   + G
Sbjct: 509 NLADEKLK-FSCGNFYINDKCTGAVVAQQWFGGARMSGTDDKSG 551

>YHR037W (PUT2) [2324] chr8 (181969..183696)
           Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C
           dehydrogenase), carries out the second step in proline
           degradation, allows proline to be used as a nitrogen
           source [1728 bp, 575 aa]
          Length = 575

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/344 (25%), Positives = 151/344 (43%), Gaps = 26/344 (7%)

Query: 160 GVVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFN 219
           G V  + P+N+    A+      L  GN VV KPS+  +LS     +++  AG P GV N
Sbjct: 203 GFVYAVSPFNFTAIAANLIGAPALM-GNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVIN 261

Query: 220 VLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQ----KVMAAAAMSNLKD---VTLECGGK 272
            +PG   +V  ++   K    + FTGST V +    K+ +       +D   +  E GGK
Sbjct: 262 FIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGK 321

Query: 273 SPAVIFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSF 332
           +  ++   A++  AV     G F   GQ C+A SR+Y+ E+  + FL      ++S    
Sbjct: 322 NFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVV 381

Query: 333 GSGLFSKDCN-------MGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEK--GYYIP 383
                +   +       MGPVI +  +D+++  I     +      +G   +K  G+++ 
Sbjct: 382 PMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVG 441

Query: 384 PTIFLDVPQSSRLCREEIFGPVAVVAKFKD--YDEAIRYANDTN-YGLASCVFTENIRVA 440
           PT+             E FGP+  V ++ D  ++E     ++T+ Y L   +F ++ R A
Sbjct: 442 PTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNTSQYALTGAIFAKD-RKA 500

Query: 441 HRFVRD---VQSGTVWVNSSNDEEVGVP--FGGFKMSGIGRELG 479
             +  +     +G  ++N      V     FGG +MSG   + G
Sbjct: 501 IEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAG 544

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,222,416
Number of extensions: 623863
Number of successful extensions: 1398
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1223
Number of HSP's successfully gapped: 55
Length of query: 488
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 382
Effective length of database: 12,926,601
Effective search space: 4937961582
Effective search space used: 4937961582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)