Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFL073W33532914880.0
KLLA0E19437g3421593991e-45
Scas_611.33891423882e-43
YPL193W (RSA1)3811523706e-41
Kwal_56.239673421493485e-38
CAGL0G09218g3791593313e-35
ABL205C451190691.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFL073W
         (329 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH] complement(...   577   0.0  
KLLA0E19437g complement(1721747..1722775) some similarities with...   158   1e-45
Scas_611.3                                                            154   2e-43
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...   147   6e-41
Kwal_56.23967                                                         138   5e-38
CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces c...   132   3e-35
ABL205C [387] [Homologous to ScYNL240C (NAR1) - SH] (22832..2418...    31   1.3  

>AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH]
           complement(298718..299725) [1008 bp, 335 aa]
          Length = 335

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/329 (87%), Positives = 289/329 (87%)

Query: 1   MQNTSGNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAPFPQQAPGYSNASLPLY 60
           MQNTSGNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAPFPQQAPGYSNASLPLY
Sbjct: 1   MQNTSGNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAPFPQQAPGYSNASLPLY 60

Query: 61  GGASAAYAGQWQQPVXXXXXXXXXXXXXXXXXXXXXXXXYQTSVVGGRKPDXXXXXXXXX 120
           GGASAAYAGQWQQPV                        YQTSVVGGRKPD         
Sbjct: 61  GGASAAYAGQWQQPVLYTAQPYYQPPPPAGAPHLLPLEPYQTSVVGGRKPDARRGGARQA 120

Query: 121 XXXXXXXPRAAYSGEKRKASHGGAQGTTVTQAEGSGDEGDEQAETGSEAGPTVDGAIAGT 180
                  PRAAYSGEKRKASHGGAQGTTVTQAEGSGDEGDEQAETGSEAGPTVDGAIAGT
Sbjct: 121 AGRVRKAPRAAYSGEKRKASHGGAQGTTVTQAEGSGDEGDEQAETGSEAGPTVDGAIAGT 180

Query: 181 SIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELRCSPLVQGRKDKKFISG 240
           SIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELRCSPLVQGRKDKKFISG
Sbjct: 181 SIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELRCSPLVQGRKDKKFISG 240

Query: 241 IQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKEALFGKAM 300
           IQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKEALFGKAM
Sbjct: 241 IQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKEALFGKAM 300

Query: 301 RAAENRKQFAGRSFTSQNDGRGRPPTRQP 329
           RAAENRKQFAGRSFTSQNDGRGRPPTRQP
Sbjct: 301 RAAENRKQFAGRSFTSQNDGRGRPPTRQP 329

>KLLA0E19437g complement(1721747..1722775) some similarities with
           sp|Q08932 Saccharomyces cerevisiae YPL193w RSA1
           nucleoplasmic protein involved in assembly of 60S
           ribosomal subunits singleton, hypothetical start
          Length = 342

 Score =  158 bits (399), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 81/159 (50%), Positives = 104/159 (65%), Gaps = 8/159 (5%)

Query: 174 DGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELRCSPLVQGRK 233
           D  I GTSIVL T EDI KW+ ERRKMWL+KISN+KE + E+  V +++L  +PL + RK
Sbjct: 180 DLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNRNPLQESRK 239

Query: 234 DKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKE 293
           ++ FI  IQ+ V RF  K NL++GL QR +  EN KIL FIKELGDAN L++ LTE+EKE
Sbjct: 240 ERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANYLKYELTEEEKE 299

Query: 294 ALF-GKAMRAAENR-------KQFAGRSFTSQNDGRGRP 324
            LF GK  +  +NR       +Q   R    +N  R RP
Sbjct: 300 VLFGGKDHKNDQNRRSNRRYDRQLNQRDTQYRNHSRKRP 338

>Scas_611.3
          Length = 389

 Score =  154 bits (388), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 5/142 (3%)

Query: 158 EGDEQAETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELG 217
           + DE+     +  P V   + GTSI L T EDI KWR ERRKMWLLKISN K+KHMEE+G
Sbjct: 201 DSDEETNIEDDKKPIV---VPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMG 257

Query: 218 VSEQELRC--SPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIK 275
           + E++++   S LV+ RK  +FI  IQ+ V RF  K NL++ L+QR M ++N+K+L FI 
Sbjct: 258 LKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFIT 317

Query: 276 ELGDANLLEHVLTEKEKEALFG 297
            LGDA LLE+ LT+ EK+ LFG
Sbjct: 318 NLGDAGLLEYELTQDEKDKLFG 339

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 6  GNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAPFPQQAPGYSNASLPLYGGASA 65
           +LPKPTFSGTL   S++  +     ++   A+QSY    PQQ  GY    +P       
Sbjct: 20 AHLPKPTFSGTLGQDSSENGQTMSNHNDNLRASQSYPQYPPQQ--GYPYYPVP------- 70

Query: 66 AYAGQWQQP 74
           Y   +QQP
Sbjct: 71 KYQAPYQQP 79

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score =  147 bits (370), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 5/152 (3%)

Query: 157 DEGDEQAETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEEL 216
           D+ DEQ E+    G  V   + GTSI L T ED++KWR ER+KMWLLKISN K+KHM+E+
Sbjct: 212 DDRDEQLESEG-LGKVV--LVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEM 268

Query: 217 GVSEQELRCSPLV--QGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFI 274
           G+ E EL+  P +  + RK+K+FI  IQ+ V R   K +L++ L+QR  A EN+++L FI
Sbjct: 269 GIKEDELKSQPSIFKESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFI 328

Query: 275 KELGDANLLEHVLTEKEKEALFGKAMRAAENR 306
           +ELGD  LLE+ L+++EK+ LFG +    +N 
Sbjct: 329 RELGDVGLLEYELSQQEKDVLFGSSEDNNKNH 360

>Kwal_56.23967
          Length = 342

 Score =  138 bits (348), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 97/149 (65%), Gaps = 1/149 (0%)

Query: 176 AIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQE-LRCSPLVQGRKD 234
           AI GTSI L + EDI+KWR ERRKMWL+KISNQ+EKH +ELGV E+E        Q +KD
Sbjct: 179 AIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKD 238

Query: 235 KKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKEA 294
           K+FI  IQ+ + R     NLS+ L+QRTMA EN  +L FI+ELGDA LLE+ LTE+EK  
Sbjct: 239 KQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKLLEYELTEEEKNV 298

Query: 295 LFGKAMRAAENRKQFAGRSFTSQNDGRGR 323
           LFG   +  + R  F  +      DG  R
Sbjct: 299 LFGNTFKRNKPRADFNRKRPNFTRDGPSR 327

>CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces
           cerevisiae YPL193w RSA1, start by similarity
          Length = 379

 Score =  132 bits (331), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/159 (50%), Positives = 105/159 (66%), Gaps = 5/159 (3%)

Query: 157 DEGDEQAETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEEL 216
           D+ DE +   SE G  V   I GTSI L T EDI+KW+ ERRKMWLL+ISN K++HME++
Sbjct: 186 DDDDELSIPKSEEGAKV--LIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKM 243

Query: 217 GVSEQELR--CSPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFI 274
           G  +++L+   + L + RKDK FI  IQS + R     NL+  LVQR MA ENAK+L FI
Sbjct: 244 GYKDEDLKKETNVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFI 303

Query: 275 KELGDANLLEHVLTEKEKEALF-GKAMRAAENRKQFAGR 312
            ELG+   LE+ LTE+EKE LF G +   + NRK + GR
Sbjct: 304 VELGECGFLEYELTEEEKEKLFGGYSNNFSNNRKNYHGR 342

>ABL205C [387] [Homologous to ScYNL240C (NAR1) - SH] (22832..24187)
           [1356 bp, 451 aa]
          Length = 451

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 77/190 (40%), Gaps = 30/190 (15%)

Query: 143 GAQGTTV--TQAEGSGDEGDEQAETGSE------AGPTVDGAIAGTSIVLSTTED----- 189
           GAQ   V  T+   + DEGDE  E G E         ++   +A    + S+ E      
Sbjct: 15  GAQVACVKPTRTLHTADEGDEALEVGKEPQEATKVSISLQDCLACAGCITSSEEILLSRQ 74

Query: 190 -----IEKWRSERRKMWLLKISNQKEKHM-EELGVSEQEL-RCSPLVQGRK-DKKFISGI 241
                +E WRS   K   + ++ Q    + +  G+S  EL +C   V G     K++ G 
Sbjct: 75  SHGVFLEAWRSLAPKALAVSVAPQSRLSLAQHFGLSVAELDQCLSGVLGSYFGAKYVVGT 134

Query: 242 QSHVMRFTSKQNLSVGLVQRTMAAENAKIL-----GFI--KELGDANLLEHVLTEKEKEA 294
           Q  + R  S Q  +  LV+R        +L     GF+   E     L+ ++L  K  + 
Sbjct: 135 Q--LGRELSVQQTNARLVERKQQGVQGPLLCSVCPGFVLYAEKTKPGLVPYMLDVKSPQQ 192

Query: 295 LFGKAMRAAE 304
           + G  + AA+
Sbjct: 193 ITGALLHAAD 202

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,270,549
Number of extensions: 356041
Number of successful extensions: 1142
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1136
Number of HSP's successfully gapped: 17
Length of query: 329
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 227
Effective length of database: 13,065,073
Effective search space: 2965771571
Effective search space used: 2965771571
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)