Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFL071C35134517490.0
Kwal_56.239543773388571e-113
KLLA0E19371g3483287881e-103
YGL082W3813367225e-93
Scas_720.144033467184e-92
CAGL0H03289g3853346088e-76
YPL191C3603185971e-74
Scas_611.4*2992665861e-73
CAGL0G09251g3632705284e-64
Sklu_1768.3185110710.40
KLLA0F20317g78685701.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFL071C
         (345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...   678   0.0  
Kwal_56.23954                                                         334   e-113
KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces...   308   e-103
YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF...   282   5e-93
Scas_720.14                                                           281   4e-92
CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces c...   238   8e-76
YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member...   234   1e-74
Scas_611.4*                                                           230   1e-73
CAGL0G09251g complement(882028..883119) similar to sp|Q08930 Sac...   207   4e-64
Sklu_1768.3 YGL018C, Contig c1768 3648-4205                            32   0.40 
KLLA0F20317g 1888803..1891163 similar to sgd|S0005691 Saccharomy...    32   1.2  

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/345 (96%), Positives = 333/345 (96%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAPTVT 60
           MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAPTVT
Sbjct: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAPTVT 60

Query: 61  LRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQ 120
           LRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQ
Sbjct: 61  LRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQ 120

Query: 121 VGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILR 180
           VGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILR
Sbjct: 121 VGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILR 180

Query: 181 SFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRHD 240
           SFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRHD
Sbjct: 181 SFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRHD 240

Query: 241 IVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDSA 300
           IVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDSA
Sbjct: 241 IVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDSA 300

Query: 301 FLTDEELARHLQQEEDGLYVRSLQRQQERXXXXXXXXXXXXQRIS 345
           FLTDEELARHLQQEEDGLYVRSLQRQQER            QRIS
Sbjct: 301 FLTDEELARHLQQEEDGLYVRSLQRQQERSPSPPCAGPSCAQRIS 345

>Kwal_56.23954
          Length = 377

 Score =  334 bits (857), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 229/338 (67%), Gaps = 11/338 (3%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNL-AQAPTV 59
           MSL F  KG+ +NG   RILLQNENGPCALIAL NVLLLSP  A     L  L A    V
Sbjct: 1   MSLMFVVKGVDINGCSHRILLQNENGPCALIALCNVLLLSPQCARYAGPLTQLVANKSEV 60

Query: 60  TLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMF 119
            LR+L+ +LA+I +Q+   +  D+DR+L+ LP+L TGL I+P FNG+F +GDEMALFR+F
Sbjct: 61  ALRELITILANIGVQIPQGAQMDVDRLLQSLPQLHTGLSINPIFNGSFEDGDEMALFRLF 120

Query: 120 QVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVA------SEKADQLL 173
            V +VH W+ D +  P  Y  +S+ SYEEAQ++L+EAYDIQ GS +         A+Q+L
Sbjct: 121 NVSIVHGWIADYADDPAQYEHVSKYSYEEAQKVLIEAYDIQHGSGSPASPNPGHSAEQVL 180

Query: 174 QDAHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDL 233
           +DA  ++SFL+RSATQ+T YGL  L+ +L E ++AVLFRNDHF+TI K + EL+ LVTDL
Sbjct: 181 EDAGYIKSFLARSATQLTEYGLHQLRELLIENSFAVLFRNDHFSTIVKHKNELYALVTDL 240

Query: 234 GYQYRHDIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAG---EDPFADKNATF 290
           GY+   +IVW+SL   +GS+DTFYTG F+P  ++  ++      +G    +PF+D   T 
Sbjct: 241 GYKDDENIVWESLKSVNGSQDTFYTGRFIPATMQKTNTQVTSLTSGSRANNPFSDP-FTS 299

Query: 291 SAPSLPPDSAFLTDEELARHLQQEEDGLYVRSLQRQQE 328
           SA     +S  L+DE+ AR LQ+EED    R++QRQ E
Sbjct: 300 SAHERSENSNGLSDEQYARQLQEEEDARVARNIQRQYE 337

>KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 348

 Score =  308 bits (788), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 223/328 (67%), Gaps = 14/328 (4%)

Query: 3   LTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAP-TVTL 61
           + F TK I V+G    ILLQNENGPCAL+AL+NVL+LSP +    ++L  L  +   VTL
Sbjct: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60

Query: 62  RDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQV 121
            DL+  LA+I + +      D++ +L+LLP+L TGL ++PAFNGTF++   +ALFR+FQV
Sbjct: 61  EDLITTLANIGVMMDNGQSEDVNELLQLLPQLHTGLNVNPAFNGTFQDDQALALFRLFQV 120

Query: 122 GLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILRS 181
            LVH W++D ++  Q Y  +S  SY++AQ LLV AYDIQ   +  E ++Q+LQDA  L+S
Sbjct: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS 180

Query: 182 FLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRHDI 241
           FL+RSATQ+T YG+QHL+++L E +Y+V FRNDHF+TI K  G L++LVTDLG++   +I
Sbjct: 181 FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI 240

Query: 242 VWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDSAF 301
           VWQSL    G++D+F+T +F+ T LE        TA+G DP  + N +      P     
Sbjct: 241 VWQSLKSVKGNQDSFFTSEFLLTTLE------QATASGLDP--NSNGSQLDEETP----- 287

Query: 302 LTDEELARHLQQEEDGLYVRSLQRQQER 329
           +TDE+LAR LQ+EED   VR ++ +Q+R
Sbjct: 288 MTDEQLARLLQEEEDARAVRGIRSRQDR 315

>YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF544
           protein of unknown function family, has moderate
           similarity to uncharacterized S. cerevisiae Ypl191p
           [1146 bp, 381 aa]
          Length = 381

 Score =  282 bits (722), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 218/336 (64%), Gaps = 16/336 (4%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAP-TV 59
           M +TF TK + +NG   +ILLQN  G CALIAL+NVLL+SP +A    ++  L +   TV
Sbjct: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60

Query: 60  TLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMF 119
           TL +LV  LAD+ +Q    +  D  ++L++LP+L +GL I+P FNG+F +G EM++FR++
Sbjct: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120

Query: 120 QVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHIL 179
            VG+VH W++D    P  Y  +S+ SY  AQ++LV++Y+IQ+ +   E ++Q+  DA  L
Sbjct: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL 180

Query: 180 RSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRH 239
           +SFL+RSATQ+T YGL HL+ +L E +YAVLFRNDHF T+ K  GELF LVTD  Y+ R 
Sbjct: 181 KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240

Query: 240 DIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGE------DPFADKNATFSAP 293
           DI WQSL   +GS+D++YTG+F+PT LE   +    TA G+      +PF+D+N      
Sbjct: 241 DINWQSLKSVNGSQDSYYTGNFIPTSLERTET----TATGQNESYISNPFSDQNTGHVTS 296

Query: 294 SLPPDSA-----FLTDEELARHLQQEEDGLYVRSLQ 324
           +     A        DEELAR LQ++ED     ++Q
Sbjct: 297 NQVNSGASGVQQIEDDEELARRLQEQEDMRAANNMQ 332

>Scas_720.14
          Length = 403

 Score =  281 bits (718), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 222/346 (64%), Gaps = 22/346 (6%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTS---QLRNLAQAP 57
           MS  F TK + +NG   +ILL+NE GP AL+AL+NVLLLSP   +T     QL N A   
Sbjct: 1   MSQGFQTKTVDINGTQHKILLENEQGPTALVALTNVLLLSPGLQQTAYELIQLVNNASNN 60

Query: 58  TVTLRDLVAVLADIAMQLGG-DSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALF 116
            V+  +L+ VL+ + +Q     S+ + +++++ LP+LQ+GL ++P FNG+F +G EM+LF
Sbjct: 61  FVSWNELLQVLSRVGLQNHNYVSNLNNEQLVQYLPQLQSGLNVNPGFNGSFEDGIEMSLF 120

Query: 117 RMFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDA 176
           R+F VG+VH W++D    P  Y  +++ +YE AQRLLV++YDI++ ++  +  D +L+DA
Sbjct: 121 RLFNVGIVHGWIIDGDNDPVAYDHVARYTYESAQRLLVQSYDIKKNNLQVDNKDLILEDA 180

Query: 177 HILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQ 236
           + ++SFL+RSATQ+T YGL+HLK +L E  +AVLFRN+ + T+ K  G+L+ LVTDL ++
Sbjct: 181 NYIKSFLARSATQLTEYGLKHLKEILVERGFAVLFRNEVYVTLYKNNGQLYTLVTDLQHR 240

Query: 237 YRHDIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAG----------EDPFADK 286
              DI+WQSL   +G++D++YTG+F+ T LE  +   P  AA            +PF+D+
Sbjct: 241 NDTDIIWQSLKSVNGTQDSYYTGNFISTSLERTNGYGPPQAAALQNPQIESVVSNPFSDQ 300

Query: 287 NATFSAPSLPPDS--------AFLTDEELARHLQQEEDGLYVRSLQ 324
           N T    + P ++           TDEELAR LQ EED     ++Q
Sbjct: 301 NQTSRQRTQPVETFHEDTRGQQLETDEELARRLQDEEDSRAADNMQ 346

>CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 385

 Score =  238 bits (608), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 199/334 (59%), Gaps = 24/334 (7%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNL-AQAPTV 59
           M   ++ K I   G   RILL  +    AL+AL+N L+LS  +   TSQL+++      +
Sbjct: 1   MDDYYSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNRVTSQLKSIFDNCNEI 60

Query: 60  TLRDLVAVLADIAMQLGGDSH--RDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFR 117
            + DL+  LA+I +QLG  S+  +D ++++  L + + GL I+P FNG+F +  E ++F 
Sbjct: 61  AVEDLLDELANIGLQLGVMSNYGQDKEQLIATLKEFRKGLHINPKFNGSFTDSLETSVFS 120

Query: 118 MFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDI---QQGSVASEKADQLLQ 174
            F V LVH W++D  + P  Y  LS+ SYEEAQR+LV+AY+I   Q G   +  A Q+L 
Sbjct: 121 GFNVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLD 180

Query: 175 DAHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLG 234
           D+  ++SFL+RSATQ+T YGLQHLK +L E ++AVLFRND + T+ K  GELFILVT+  
Sbjct: 181 DSAYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRYFTLYKNAGELFILVTNPS 240

Query: 235 YQYRHDIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGE-DPFA--------- 284
               ++IVWQSL   +G+ D +Y G FV    ++D + F D    + +PF+         
Sbjct: 241 QSRNNNIVWQSLHSVNGARDLYYNGVFVEINPDNDQNTFDDVVVPQSNPFSDPQTNQEFQ 300

Query: 285 --DKNATFSAPSLPPDSAFLTDEELARHLQQEED 316
             D+N TF A  +        DE LAR LQ+EED
Sbjct: 301 NIDRNDTFDAQQVED------DELLARQLQEEED 328

>YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member of
           the DUF544 protein of unknown function family, has
           moderate similarity to uncharacterized S. cerevisiae
           Ygl082p [1083 bp, 360 aa]
          Length = 360

 Score =  234 bits (597), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/318 (41%), Positives = 195/318 (61%), Gaps = 14/318 (4%)

Query: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQL-RNLAQAPTV 59
           M L+F TK + +NG+  RILLQNENGPCAL+AL+N+L+LSP++   +++L R + +   +
Sbjct: 1   MDLSFTTKSVKINGQNHRILLQNENGPCALLALANILILSPDHTRFSNELIRLVNKGSQI 60

Query: 60  TLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMF 119
           +L++L+ VLADIA+Q+      D+  +L LLP+L  GL I+P FNG+F    EM++FR+F
Sbjct: 61  SLKELIEVLADIALQVTDKPSTDISELLSLLPRLHEGLNINPEFNGSFENTKEMSIFRLF 120

Query: 120 QVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHIL 179
            V +VH W+++         +LS  SYE AQR+L +A DI  G    E +D++L+DA  L
Sbjct: 121 NVDVVHGWVINSFINENIDEKLSHYSYESAQRILTQAADINCGISQDENSDEVLRDAMHL 180

Query: 180 RSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRH 239
             FL+ S TQ+T++GL  L+  L    +++LFRNDHF+T+ K E  L+ LVTD GY+   
Sbjct: 181 GLFLNESPTQLTAFGLLRLREKLLHNKFSILFRNDHFSTLFKYEDRLYTLVTDFGYKNCK 240

Query: 240 DIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDS 299
           DIVWQSL   DGS D F+ G+F    +            G+    D    F   +L  + 
Sbjct: 241 DIVWQSLDSVDGSCDAFFAGNFSAAEVN-----------GQQLSTDIERDFGTGNLLLEE 289

Query: 300 A--FLTDEELARHLQQEE 315
                 D+ELA+ LQ++E
Sbjct: 290 IQQIENDKELAKQLQEQE 307

>Scas_611.4*
          Length = 299

 Score =  230 bits (586), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 172/266 (64%), Gaps = 24/266 (9%)

Query: 2   SLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNL--AQAPTV 59
           SL F  K I + G P +ILLQNENGPCAL+A+ N+LL+SP +      L  L   +  TV
Sbjct: 4   SLQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTV 63

Query: 60  TLRDLVAVLADIAMQ----LGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMAL 115
           +L ++  VLA+IA+Q    + G +  DMD++LELLP L TGL I+P F+GTF + +EMAL
Sbjct: 64  SLDEVNQVLANIALQSNTEMKGSNGADMDQLLELLPHLHTGLNINPKFDGTFEDSNEMAL 123

Query: 116 FRMFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQD 175
           FRMF++ +VH W+++          LS+ SYE AQ++L++A         +E  ++ + +
Sbjct: 124 FRMFKIPIVHGWVIET---------LSKYSYESAQQVLLKA---------AEGDEEAVGE 165

Query: 176 AHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGY 235
           A +++ F   + TQ+T  GL +L  +L E  + VLFRNDHF+TI K+  +L+ LVTDLGY
Sbjct: 166 ATLIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGY 225

Query: 236 QYRHDIVWQSLSYPDGSEDTFYTGDF 261
           + R DIVW+++   DGSEDTF  G+ 
Sbjct: 226 RRRKDIVWENIKSIDGSEDTFCDGNL 251

>CAGL0G09251g complement(882028..883119) similar to sp|Q08930
           Saccharomyces cerevisiae YPL191c, hypothetical start
          Length = 363

 Score =  207 bits (528), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/270 (42%), Positives = 171/270 (63%), Gaps = 15/270 (5%)

Query: 3   LTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAPTVTLR 62
           + FATK I V+G    IL+QNENGPCAL+AL+NVLLLS ++    S+L  L Q   V L 
Sbjct: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHHEH--SELLELVQPKKVDLD 58

Query: 63  DLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQVG 122
            L+ VLADIA+        ++  +L LLP+L TGL I+P F+GTF +  E+++F++F + 
Sbjct: 59  QLLTVLADIAIATNPKD-EELSVLLSLLPQLHTGLNINPRFDGTFEDTKELSVFKLFDID 117

Query: 123 LVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQ----GSVASEKADQLLQDAHI 178
           ++H W+           ++ + +YEE+Q+LL +A DI+     GS  + + D +L +A++
Sbjct: 118 IIHGWI-------SSDDKVQKYTYEESQQLLTQAVDIRDRETPGS-GNPQDDNILAEANL 169

Query: 179 LRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYR 238
           +  FL+ S+TQ+T  GL ++   + EG YAVLFRNDHFATI K  G  + LVTDLG++  
Sbjct: 170 IEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSC 229

Query: 239 HDIVWQSLSYPDGSEDTFYTGDFVPTRLED 268
           ++IVW+ +   DGS D F+ G F  T L D
Sbjct: 230 NNIVWEYMGSIDGSNDIFFDGIFEETELND 259

>Sklu_1768.3 YGL018C, Contig c1768 3648-4205
          Length = 185

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 23/110 (20%)

Query: 127 WLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILRSFLSRS 186
           W +D+ Q  Q+Y +L   S+ +A           QGS  ++ +  L +  H LR  L+RS
Sbjct: 29  WTVDLRQLRQEYRKLQAISHPDA-----------QGSTTNDDSSTLNKAYHTLRQPLTRS 77

Query: 187 ATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQ 236
                       + +L   A+  L ++   + I +Q+ EL + V D+  Q
Sbjct: 78  ------------QYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQ 115

>KLLA0F20317g 1888803..1891163 similar to sgd|S0005691 Saccharomyces
           cerevisiae YOR165w, start by similarity
          Length = 786

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 10/85 (11%)

Query: 242 VWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLF------PDTAAGEDPFADKNATFSA--- 292
           +W  LS P+G EDT +   FVP        +F       D  +  D F D++A+F     
Sbjct: 203 MWSQLSKPEGCEDTSFHDFFVPNFFGLGHKVFQPEQFDNDVKSLGDLFVDQDASFFKDEY 262

Query: 293 -PSLPPDSAFLTDEELARHLQQEED 316
              LP D   L  E     ++  +D
Sbjct: 263 HTHLPLDGWSLYAENCWEQIENNKD 287

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,594,049
Number of extensions: 457861
Number of successful extensions: 1201
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1200
Number of HSP's successfully gapped: 15
Length of query: 345
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 243
Effective length of database: 13,065,073
Effective search space: 3174812739
Effective search space used: 3174812739
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)