Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AFL069C58572944e-37
YPL189C-A68491765e-19
Scas_611.5d65461601e-16
AEL266W32848561.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFL069C
         (57 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140) ...   117   4e-37
YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512) Pr...    72   5e-19
Scas_611.5d                                                            66   1e-16
AEL266W [2239] [Homologous to ScYLR457C (NBP1) - SH; ScYPR174C -...    26   1.6  

>AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140)
          [177 bp, 58 aa]
          Length = 58

 Score =  117 bits (294), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 57/57 (100%), Positives = 57/57 (100%)

Query: 1  MHLKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNEGARAAQ 57
          MHLKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNEGARAAQ
Sbjct: 1  MHLKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNEGARAAQ 57

>YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512)
          Protein of unknown function [207 bp, 68 aa]
          Length = 68

 Score = 72.4 bits (176), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 43/49 (87%)

Query: 3  LKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNE 51
          ++A TRN++ N L+ +TFL+AF+SVA+GSVLPCPAHS+DSD+P  ++++
Sbjct: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHK 49

>Scas_611.5d
          Length = 65

 Score = 66.2 bits (160), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 39/46 (84%)

Query: 3  LKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRE 48
          ++A  RNR+ N L++TTF++ F+SVA+G+VLPCPAHS+DSDT + E
Sbjct: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDTHLNE 46

>AEL266W [2239] [Homologous to ScYLR457C (NBP1) - SH; ScYPR174C -
           SH] complement(139598..140584) [987 bp, 328 aa]
          Length = 328

 Score = 26.2 bits (56), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 7   TRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNEGAR 54
           +R R+TN    T    A  S++     P P + L + +P+R+ N+  R
Sbjct: 226 SRRRITNLRATTDNQPALRSLSPSPQRPYPVNPLFTSSPIRQVNDSPR 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,505,472
Number of extensions: 40015
Number of successful extensions: 76
Number of sequences better than 10.0: 4
Number of HSP's gapped: 76
Number of HSP's successfully gapped: 4
Length of query: 57
Length of database: 16,596,109
Length adjustment: 30
Effective length of query: 27
Effective length of database: 15,557,569
Effective search space: 420054363
Effective search space used: 420054363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)