Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AER391C63261330630.0
Sklu_1676.265060514240.0
Kwal_55.2000061761612551e-166
CAGL0M08668g65762111451e-149
KLLA0E16698g65658111031e-142
YDR266C63961910861e-140
Scas_615.1267458010241e-130
Scas_699.3861264910081e-129
AFR212W62656840.048
Kwal_47.1771963553810.11
AEL185C51563810.11
Scas_720.8946951790.16
CAGL0J03586g41177760.39
KLLA0C08756g42745750.45
YCR066W (RAD18)48726750.57
Scas_672.226350730.64
Kwal_23.628545845711.6
AGL289C24145691.9
YLR247C155651702.3
YOL054W40647692.6
AAR049C44345674.3
CAGL0B05049g147048674.9
YML104C (MDM1)112770675.8
KLLA0F17677g67554666.0
YPR186C (PZF1)42990666.1
Scas_601.666150666.4
Scas_573.9150248659.8
Kwal_26.752539255649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER391C
         (620 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...  1184   0.0  
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            553   0.0  
Kwal_55.20000                                                         488   e-166
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   445   e-149
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   429   e-142
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   422   e-140
Scas_615.12                                                           399   e-130
Scas_699.38                                                           392   e-129
AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C (...    37   0.048
Kwal_47.17719                                                          36   0.11 
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    36   0.11 
Scas_720.89                                                            35   0.16 
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    34   0.39 
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    33   0.45 
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    33   0.57 
Scas_672.2                                                             33   0.64 
Kwal_23.6285                                                           32   1.6  
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    31   1.9  
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    32   2.3  
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    31   2.6  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    30   4.3  
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    30   4.9  
YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediat...    30   5.8  
KLLA0F17677g complement(1622629..1624656) weakly similar to sp|P...    30   6.0  
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    30   6.1  
Scas_601.6                                                             30   6.4  
Scas_573.9                                                             30   9.8  
Kwal_26.7525                                                           29   9.9  

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/613 (93%), Positives = 571/613 (93%)

Query: 1   MSQTSRNFRRTQGRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEE 60
           MSQTSRNFRRTQGRKPQTAQTQADSADWNGSGRWRK                    DTEE
Sbjct: 1   MSQTSRNFRRTQGRKPQTAQTQADSADWNGSGRWRKSSGYASGGGSSAGPPHSPCGDTEE 60

Query: 61  DNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIK 120
           DNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIK
Sbjct: 61  DNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIK 120

Query: 121 AEHARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLK 180
           AEHARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLK
Sbjct: 121 AEHARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLK 180

Query: 181 NEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDD 240
           NEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDD
Sbjct: 181 NEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDD 240

Query: 241 ELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADD 300
           ELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADD
Sbjct: 241 ELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADD 300

Query: 301 LDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSV 360
           LDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSV
Sbjct: 301 LDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSV 360

Query: 361 SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFR 420
           SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFR
Sbjct: 361 SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFR 420

Query: 421 NPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVVXX 480
           NPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVV  
Sbjct: 421 NPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVVGA 480

Query: 481 XXXXXXXXXXXXXXXXXXXXALTDSYQNVTPQPKKPVPYRPTSPVASSSTQVQNTKRNSN 540
                               ALTDSYQNVTPQPKKPVPYRPTSPVASSSTQVQNTKRNSN
Sbjct: 481 AWGKNGGKSSSSRNFPSLSSALTDSYQNVTPQPKKPVPYRPTSPVASSSTQVQNTKRNSN 540

Query: 541 YTPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRAPPVNELPDPKQWGKSKREPSRSAE 600
           YTPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRAPPVNELPDPKQWGKSKREPSRSAE
Sbjct: 541 YTPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRAPPVNELPDPKQWGKSKREPSRSAE 600

Query: 601 ALDMSPIESALPT 613
           ALDMSPIESALPT
Sbjct: 601 ALDMSPIESALPT 613

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/605 (48%), Positives = 384/605 (63%), Gaps = 26/605 (4%)

Query: 6   RNFRRTQ-GRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEEDNGE 64
           RNFRRTQ  + P+ + T  +S+  NG G+W++                    + EED+GE
Sbjct: 11  RNFRRTQDSQAPRKSDT--NSSRSNG-GKWKRAFADENLSSLNQTSSPGD--NLEEDDGE 65

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHA 124
           + C+ICA+  +Y+ALS C+HTTCHKC FRQRALY KK CL+CRTE+E LIFTD+   + A
Sbjct: 66  I-CIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFA 124

Query: 125 RFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLKNEHK 184
            F PRD     + YGI FTS    + TL LLKYNCP+GDV + D +SFK YNEHLK  H 
Sbjct: 125 DFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLKTSHN 184

Query: 185 RSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDELYI 244
           ++IC ICA ++K FP+E+K  TPNQL+ H + GDS GF GHP+CGFC+G+RFYSDDELY+
Sbjct: 185 KTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSDDELYV 244

Query: 245 HMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDLQ 304
           HMR+RHE+CHICDQ+DST PQYFK+YDQLFEHF++SHY+C V++CL+SKFVVF DD+DLQ
Sbjct: 245 HMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDLQ 304

Query: 305 AHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALAL-----GPS 359
           AH+LKEH  I+ N       AGRR++SELS+ F+   +RAVHE  + +  AL       S
Sbjct: 305 AHILKEHRTILANDKGNIPVAGRRFQSELST-FSATPARAVHERDTFDTPALRSSSAARS 363

Query: 360 VSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLF 419
            +   +  SPE+KR R+EERARHYLNYSQ E + F  IN DY  N +SA  V   Y +LF
Sbjct: 364 ANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQKLF 423

Query: 420 RNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLS-TNPWYSAPVV 478
            +P AD  LL+ +F+  FP+ S K+K+L AIY+AEQ+K   Q  FPSL+  +   +A V+
Sbjct: 424 NSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFPSLAPPSSVAAANVI 483

Query: 479 XXXXXXXXXXXXXXXXXXXXXXALTDSYQNVTPQP---KKPVPYRPTSPVASSSTQVQNT 535
                                       + V  QP    K   ++  +    ++  V+  
Sbjct: 484 GGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLFTPKKASFKSLNTNVRTAPVVKKA 543

Query: 536 KRN--SNYTPTYLKSKTKGESRAQSNAAL-----FPPLSSPDTKKFRAPPVNE--LPDPK 586
             N  +NYTPTYL++K+       S++A      FPPL     KKFRAP VNE  +P+P+
Sbjct: 544 SANNGTNYTPTYLQNKSTSSGSLSSSSASISEEKFPPLPKAQKKKFRAPLVNEPNIPNPQ 603

Query: 587 QWGKS 591
           QWG S
Sbjct: 604 QWGVS 608

>Kwal_55.20000
          Length = 617

 Score =  488 bits (1255), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 267/616 (43%), Positives = 358/616 (58%), Gaps = 69/616 (11%)

Query: 6   RNFRRTQGRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEEDNGEM 65
           R+FRRTQG + +  +        N    W++                    + +ED+   
Sbjct: 9   RSFRRTQGTQSRPRKESGK----NTESSWKRTFNQGTEGEN----------ELDEDD--- 51

Query: 66  TCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHAR 125
            C+ICA+ L YV LSPCNH TC++C FRQRALY KK+CLVCRTE + +IF+    A    
Sbjct: 52  ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDD 111

Query: 126 FGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLKNEHKR 185
           F  +++V  +   G+ FTS +  S TL LL Y+CP+GD    + ++FK YN HLKNEH +
Sbjct: 112 FDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHNK 171

Query: 186 SICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDELYIH 245
           ++C ICA H+K FP+E++  TP+QL+IH + GDS+GF GHP+CGFCSG+RFYSDDEL +H
Sbjct: 172 TLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVH 231

Query: 246 MRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDLQA 305
           MR+RHEKCHICDQ +   PQYFKDYDQLFEHFK  HY+C V+SCLDSKFVVF DDLDLQA
Sbjct: 232 MRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQA 291

Query: 306 HMLKEHPNIMGN-KSTISLTAGRRYRSELSS----GFTPNVSRAVHETSSSNALALGPSV 360
           H+LKEH  I+ N  + +S+  GR+Y+S+LS+        + ++ V + ++ N        
Sbjct: 292 HILKEHGGILRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDVRDNTAKNN------- 344

Query: 361 SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFR 420
              ++  S E+KR R+EERARHYL YS ++ + F  IN+ Y N +I+A  V   Y+ LF+
Sbjct: 345 ---SSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFK 401

Query: 421 NPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLST-NPWYSAPVVX 479
           +PEA   LLL +F++ FP+ S  +++L  IY   Q+K  R   FPSLS  NP      V 
Sbjct: 402 SPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVA 461

Query: 480 XXXXXXXXXXXXXXXXXXXXXALTDSYQNVTPQPKKPV-PYRPTSPVASSSTQVQNTK-- 536
                                    + Q   P  KKP  P  P      SST+V N +  
Sbjct: 462 SGSWGRSTGSNKA------------ARQYNFPSLKKPASPQPPIITKKPSSTKVNNVQPK 509

Query: 537 ------------RNSNYTPTYLKSKTKGESRAQSNAAL----FPPLSSPDTKKFRAPPVN 580
                         S++ PTYL  K K    A S+ AL    FPPL     +KFRAP VN
Sbjct: 510 AKAVPVTRKPSSNESSFKPTYLDGKQKS---ASSSPALDREKFPPLPKSQARKFRAPLVN 566

Query: 581 E--LPDPKQWGKSKRE 594
           E  +P+P QWGKS  E
Sbjct: 567 EASIPNPSQWGKSSNE 582

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  445 bits (1145), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/621 (40%), Positives = 353/621 (56%), Gaps = 42/621 (6%)

Query: 5   SRNFRRTQ--GRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEEDN 62
           +RNFRRTQ  GR    +     +    G+  + +                      E+D+
Sbjct: 14  NRNFRRTQTGGRSNGESGNGRKAKKITGNPDFLQKEIKSGKKSNIEKKVEEFNAREEDDD 73

Query: 63  GEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAE 122
            E+ C+ICA  L Y +LSPCNHTTCH C+FRQRALYEKK+CL+CRTE++ L FTD I A+
Sbjct: 74  TEL-CIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTDNIDAQ 132

Query: 123 HARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYG-DVPEFDLDSFKNYNEHLKN 181
           ++     D    DD++GI FTS   ++ TL LLKY CP   D  +    ++K YNEHLK+
Sbjct: 133 YSEI--TDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNEHLKS 190

Query: 182 EHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDE 241
            H R IC ICA ++  FP EMK  T NQLK H++ GDS+GF GHP+C FC+GKRFYSDDE
Sbjct: 191 AHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRFYSDDE 250

Query: 242 LYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDL 301
           LYIHMR  HEKCHICD++D TQPQYFKDY+QLFEHF+ SHY+C V+SCLD KFVVF DD+
Sbjct: 251 LYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVFKDDM 310

Query: 302 DLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSVS 361
           +LQAH+LKEH +I+  K          ++SELS+ F    S+ + E  S N        S
Sbjct: 311 ELQAHILKEHGDILRGKPKF-------FQSELST-FISAPSQVIRERDSYNYDMGSVGSS 362

Query: 362 PVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFRN 421
            +  + +PE+ R R+ ERA+HYLN S    + FE +N +Y+++V++A+ + + Y +LF +
Sbjct: 363 NIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFTD 422

Query: 422 PEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVVXXX 481
             AD +LL+ N +  +P+ S K+K+L+ IYQ  ++  +R+   PSL  +   + P     
Sbjct: 423 THADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVPGGAWG 482

Query: 482 XXXXXXXXXXXXXXXXXXXALT------DSYQNVTPQP--------KKPV--------PY 519
                              +L       D ++N    P         KPV        P 
Sbjct: 483 SSTGRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQTPM 542

Query: 520 RPTS-PVASSSTQVQNTKRNSNYTPTYLKSKTKGESRAQSNAAL-FPPLSSPDTKKFRAP 577
           R ++ P AS+  +          TP++    +   S     A L  P L +P  K +  P
Sbjct: 543 RISARPTASNRVEFNGGSTTKAATPSWGSQPSSNSSSKNKLADLNLPTLPAPKPKVY-IP 601

Query: 578 PVNE--LPDPKQWGKSKREPS 596
           PV+E  +PDPK+WG+ K EP+
Sbjct: 602 PVHEPVIPDPKKWGQ-KGEPA 621

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  429 bits (1103), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 237/581 (40%), Positives = 341/581 (58%), Gaps = 43/581 (7%)

Query: 58  TEEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTD 117
           T++D+    CLICA+ L  +ALSPCNH TCHKC  RQRALYEKK CL CR+E E +IFTD
Sbjct: 80  TDDDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTD 139

Query: 118 QIKAEHARFGPRDIVAV-DDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYN 176
           +IK  +     +  +   +++ GI+FTS N  +  ++LLKY  P+GD  + D  SFK  N
Sbjct: 140 KIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANK-DFGSFKKLN 198

Query: 177 EHLKNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSK-GFTGHPLCGFCSGKR 235
           E L+ EH ++IC ICA H+K FP E+K +T  QLKIH + GD K GF GHP+CGFCSGKR
Sbjct: 199 EFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKR 258

Query: 236 FYSDDELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFV 295
           FYSDDELY HM+  HE+CHICDQ+D +QPQYFK+Y+ LFEHFK +HY+C V SCLD+KFV
Sbjct: 259 FYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFV 318

Query: 296 VFADDLDLQAHMLKEHPNIMGNK---STISLTAGRRYRSELSSGFTPN-VSRAVHETSSS 351
           VF+D+LDL+AH++KEHP++ G+     T+     +++RS++++   P  +  A +E S+S
Sbjct: 319 VFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTFSNPTRIIDAQNEESNS 378

Query: 352 NALALGPSVSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSV 411
                         A S ++KR+R+E+RARHYL  S+ + + F  IN+ +N N ISA  +
Sbjct: 379 --------------ANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQEL 424

Query: 412 QRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNP 471
           Q +Y+ LF+    D  LL+ + ++ +   S K+K L AIY+   +K+E   KF  L  + 
Sbjct: 425 QSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADS 484

Query: 472 WYSAPVVXXXXXXXXXXXXXXXXXX------------XXXXALTDSYQNVTPQPKKPVPY 519
             S  VV                                  + T+  +N +  P  PV  
Sbjct: 485 SSSVNVVYGKWGKKSSSGVGGSNVKFTSLPAVSEPIFSSKASYTNLRKNGSSSPSSPVIR 544

Query: 520 RPTSPVASSSTQVQNTKRNS---NYTPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRA 576
              +  +SSST +   K+N      +   + S+    +    N   FP L +   KKF A
Sbjct: 545 SGLTSNSSSSTSLNYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQAT-KKKFVA 603

Query: 577 PPVNE--LPDPKQWGKSKREPSRSAEALDMSPIESALPTSG 615
           PPV +  +P+P  WGK    P    +++++  +++ALP SG
Sbjct: 604 PPVKQTTIPNPSTWGK----PQNDNDSINLDSLDNALPASG 640

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 254/619 (41%), Positives = 346/619 (55%), Gaps = 62/619 (10%)

Query: 5   SRNFRRTQGRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEEDNGE 64
           +RNFRRTQG        Q ++   N    +R+                    DT+E+N  
Sbjct: 12  TRNFRRTQG-------PQNNTKPHNDRKNFRRKQKKNNLSAEPNLTTSSAD-DTDEENE- 62

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHA 124
             C+ICA  L YV+L+PC+H TCH C FRQRALY KK+CL+CRTE+E ++FTD+I  + +
Sbjct: 63  -LCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDGDIS 121

Query: 125 RFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYG-DVPEFDLDSFKNYNEHLKNEH 183
                +    +++YGI FTS    + TL+LLK+ CP   D    D  SFK YNEHLK+EH
Sbjct: 122 --DKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEH 179

Query: 184 KRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDELY 243
            R IC ICA H+  FP E++  T NQL+ H T G+S+GF GHP+C FCSGKRFYSDDELY
Sbjct: 180 NRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELY 239

Query: 244 IHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDL 303
           IHMR +HEKCHICD+++   PQYFKDY+QLF+HFKHSHY+C V++CLD+KFVVF D+L+L
Sbjct: 240 IHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELEL 299

Query: 304 QAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSV--- 360
           QAH+L+EH NI+  K          ++SELS+ F    SR + E    +  ++       
Sbjct: 300 QAHILQEHGNILKGKPKF-------FQSELST-FISAPSRVIRERDDYDLPSISSLPGSS 351

Query: 361 ----SPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYD 416
               + V +A SPE  R RL ERA++YL  S+ +   F   N DY+   +SA  +   Y 
Sbjct: 352 SGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYK 411

Query: 417 QLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAP 476
            LF  P AD +LL+ N A+TFP+ S KY  LNAIY+  ++   RQ   PSLS++   S  
Sbjct: 412 LLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMS 471

Query: 477 VVXXXXXXXXXXXXXXXXXXXXXXALTDSYQNVTPQPKKPVPYRPTSPVASSSTQ----- 531
           +                       AL    +N+   P    P     P A++  +     
Sbjct: 472 I-------GRGHWGGTNDGGSAGAAL--GVRNIKNLPTLKSPSASYDPFATTVKKNTLRP 522

Query: 532 VQNTKRNS-------------NYTPTYLKSKTKGESRAQSNA-----ALFPPLSSPDTKK 573
           VQN KR +              ++PTYL+SK    S + +N+     +L  P   P   K
Sbjct: 523 VQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPK 582

Query: 574 FRAPPVN--ELPDPKQWGK 590
            + P +N  ++ DPKQWGK
Sbjct: 583 VQIPGLNRPQIADPKQWGK 601

>Scas_615.12
          Length = 674

 Score =  399 bits (1024), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/580 (39%), Positives = 330/580 (56%), Gaps = 81/580 (13%)

Query: 67  CLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEH--A 124
           CLICA  L Y +LSPCNHTTCHKC+F+QR+LY KKACL+CRTE++ LIFT+ I A +  +
Sbjct: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTDS 131

Query: 125 RFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPY-----GDVPEFDLDSFKNYNEHL 179
             G       +++YGI FTS    + TL+LLKY C         +   D  S+K YNEHL
Sbjct: 132 NLGHYQF---NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHL 188

Query: 180 KNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSD 239
           +++H + +CTICA++   FP+E+   T NQL+ H + G+S+GF GHPLC FCSG+RFY D
Sbjct: 189 RSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGD 248

Query: 240 DELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFAD 299
           DELY+HMR +HEKCHICD++D   PQYFKDYDQLF+HFK+ HYIC V++CLD+KF+VF D
Sbjct: 249 DELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKD 308

Query: 300 DLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSN------- 352
           +L+LQAH+LKEH +++  K  +       ++SELS+ F    SR V +  + N       
Sbjct: 309 ELELQAHILKEHGDLIRGKPKL-------FQSELST-FMSGPSRVVRDRDAMNYDMDSRP 360

Query: 353 ---ALALGPSVSPVATAES--------PEMKRKRLEERARHYLNYSQSEMKLFEQINNDY 401
              + +   S +P+ T  +        PE+++ RLEERA++YL  SQ     F + N++Y
Sbjct: 361 SLFSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420

Query: 402 NNNVISATSVQRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQ 461
           +   ++   +   Y ++F  P+++ +LL+ N A  +P+ S K+KELNAIY+A+++K   Q
Sbjct: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQ 480

Query: 462 AKFP---------SLSTNPWYSAPVVXXXXXXXXXXXXXXXXXXXXXXALT--------- 503
              P         S +T  W ++  V                      A T         
Sbjct: 481 NGLPSLSGSSASISSATRSWNNSGSVAMNRNIRDLPTLEAKSKSFDPFATTVKKTPALRT 540

Query: 504 ---DSYQNVTPQPKKPVPYRPTSPVASS---------STQVQNTKRNSNYTPTYLKSKTK 551
                 + V+P    P+ Y P    + S         +T V NT R        + S T 
Sbjct: 541 MKKTVVKKVSPS---PIAYTPLGGSSLSSLSTVPRLPTTNVSNTVR--------MGSSTN 589

Query: 552 GESRAQSNAALFPPLSSPDTKKFRAPPVNE--LPDPKQWG 589
           G+++  ++  L P L +P  K +  PP+ +  +PDPKQWG
Sbjct: 590 GKNKKLADLNL-PQLPTPKPKVY-IPPLRKTTIPDPKQWG 627

>Scas_699.38
          Length = 612

 Score =  392 bits (1008), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 237/649 (36%), Positives = 353/649 (54%), Gaps = 88/649 (13%)

Query: 6   RNFRRTQGRKPQTAQTQADSADWNGSGRWRKXXXXXXXXXXXXXXXXXXXXDTEEDNGEM 65
           RNFRRTQG    +  T  D+     S R  +                        D+ E 
Sbjct: 8   RNFRRTQG---GSNTTTTDNKKKQHSHRHEEI----------------------NDDDEN 42

Query: 66  TCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHE--YLIFTDQIKAE- 122
            C+ICA+ +++ A SPCNH TCHKC+FRQ AL++KK+CL+CRT+ +   +IFT+++ ++ 
Sbjct: 43  VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQA 102

Query: 123 ----HARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPE-------FDLDS 171
               ++     D++  + +YGI+FTS +    TL+L K+ C    + +        D  S
Sbjct: 103 YEDFNSNMWQTDLI--NTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKS 160

Query: 172 FKNYNEHLKNEHK-RSICTICARHRKQFPAEMKTLTPNQLKIHNTIG-DSKGFTGHPLCG 229
           FK  NEHLK EH  ++IC ICA H   FP+E+K  T NQLK HN  G ++ GF GHP+C 
Sbjct: 161 FKKLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCK 220

Query: 230 FCSGKRFYSDDELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSC 289
           FCS KRFYS DEL  HMRE+HE+CHICD++D   PQ+FK+YDQLF HFK+SHYIC  ++C
Sbjct: 221 FCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTC 280

Query: 290 LDSKFVVFADDLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAV---- 345
           LD KF+VF DD++LQAH+L+EH +++  K        + ++SELS+ F    SR +    
Sbjct: 281 LDDKFIVFKDDMELQAHILQEHGDLIRGKP-------KFFQSELST-FISTPSRVITDDN 332

Query: 346 -----HETSSSNALALGPSVSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINND 400
                H  S S+  +L    S  A   S E+K+ RL+ERA+HYL+ S  + + F  +N  
Sbjct: 333 AFTSQHSFSDSSLPSLNSVNSTNANNSSQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQ 392

Query: 401 YNNNVISATSVQRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRER 460
           Y  N ++A  +   Y  LF+ P++D HLL+ N ++ +P  SLKYKEL++IY+A+++K  +
Sbjct: 393 YAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKKLSK 452

Query: 461 QAKFPSLSTNPWYSAPVVXXXXXXXXXXXXXXXXXXXXXXALTDSYQNVTPQPKKPVPYR 520
           + + PSL  +P  S+ +V                       L  +  ++T  P      R
Sbjct: 453 KPQLPSLYNDPSSSSSMVNAVWGNSNNNRNVSSLRTNTNRPL--NLPSLTSTPSNLNGTR 510

Query: 521 PTSPVASSSTQVQNTKRNSNYTPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRAPPVN 580
           P   V+ S++ + +  RN N             + + S  +  P L +P  K +  PPV 
Sbjct: 511 PLH-VSHSTSSLTSKSRNDN-------------ASSNSRISNLPSLPTPKPKVY-IPPVR 555

Query: 581 E--LPDPKQWGKSKREPSRS-------AEALDMSPIESALPTSGKSKGK 620
           +  +PDP  WG  +R P ++          L+M+   S+  T G  K K
Sbjct: 556 QTVIPDPNSWG--RRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGKRK 602

>AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C
           (ASI3) - NSH] complement(814346..816226) [1881 bp, 626
           aa]
          Length = 626

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 59  EEDNGEMTCLICADTLRYVALSPCN-HTTCHKCAFRQRALYEKKACLVCRTE-HEY 112
           ++++ +M+C++C   LR + L PC     C +C      L   KAC+ CR + H Y
Sbjct: 566 QDEDADMSCVVCKTNLRNIVLWPCRCFALCEECRV-SLGLRGFKACVCCRADVHGY 620

>Kwal_47.17719
          Length = 635

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 58  TEEDNGEMTCLICADTLRYVALSPCN-HTTCHKCAFRQRALYEKKACLVCRTE 109
           T++ + ++ C++C   +R + L PC     C  C     AL   K C+ CR+E
Sbjct: 574 TDKSDRDLACVVCKSNIRNIVLWPCKCFAVCEDCRV-SLALRGFKTCICCRSE 625

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 416 DQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSA 475
           D +FR   AD      N +D  P G +   ELN + +  Q++   +A    L  +PW+ A
Sbjct: 228 DGMFRAFVADGG----NLSDG-PWGKIGLVELNLLRKMLQQRPAARATLAQLRQHPWFKA 282

Query: 476 PVV 478
           PVV
Sbjct: 283 PVV 285

>Scas_720.89
          Length = 469

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 59  EEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTE 109
           +E +  + C IC D L+   L+PC+HT C  C   +  L +   C +C  E
Sbjct: 20  QEIDTLLRCHICKDFLKVPVLTPCSHTFCSLCI--REYLKDNSKCPLCLNE 68

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 59  EEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTE-------HE 111
           +E +  + C IC D L+   L+PC HT C  C   +  L  +  C +C  E        E
Sbjct: 19  QELDDLLRCHICKDFLKNPVLTPCGHTFCSLCI--RGYLSNEPKCPLCLHELRESMLRSE 76

Query: 112 YLI--FTDQIKAEHARF 126
           YL+   T+  KA   R 
Sbjct: 77  YLVNEITETYKAARQRL 93

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTE 109
           + C IC D L+   L+PC H+ C  C   ++ L ++  C +C ++
Sbjct: 30  LRCHICKDFLKASVLTPCGHSFCSICI--RKYLQKESKCPLCLSD 72

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
          repair protein, required for post-replication repair
          [1464 bp, 487 aa]
          Length = 487

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 65 MTCLICADTLRYVALSPCNHTTCHKC 90
          + C IC D L+   L+PC HT C  C
Sbjct: 26 LRCHICKDFLKVPVLTPCGHTFCSLC 51

>Scas_672.2
          Length = 263

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 4/50 (8%)

Query: 64  EMTCLICADTLRYVALSPCNHTTCHKCAFRQ----RALYEKKACLVCRTE 109
           E  C IC D      ++PC H  C  C F+     R   +   C +CR E
Sbjct: 194 EYRCPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKE 243

>Kwal_23.6285
          Length = 458

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTE 109
           + C IC D ++   L+PC HT C  C   +  L  +  C +C  E
Sbjct: 35  LRCHICKDFIKSPVLTPCAHTFCSLCI--REYLNRELRCPLCLAE 77

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 4/45 (8%)

Query: 67  CLICADTLRYVALSPCNHTTCHKCAFRQ----RALYEKKACLVCR 107
           C IC D      ++PC H  C  C F+     R       C +CR
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCR 217

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 2/51 (3%)

Query: 57   DTEEDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCR 107
            DT  DN  ++C IC   +   A+  C H  C  C       + K  C +C+
Sbjct: 1229 DTLNDNQILSCSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSK--CPICK 1277

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKK--ACLVCRTE 109
           + C IC D +    ++PC H  C+ C     A   +K  AC  CR++
Sbjct: 28  LVCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSD 74

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 65  MTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTE 109
           + C IC D L+   L+ C HT C  C   +  L ++  C +C  E
Sbjct: 30  LRCHICKDMLQTPVLTQCGHTFCSLCI--REYLNKESRCPLCLAE 72

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 60   EDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCR 107
            + N  M C IC   +   A+  C H  C  C F    L  +K C +C+
Sbjct: 1157 QKNTTMECSICLQPITNGAMVNCGHLFCTSCIFSW--LKNRKTCPLCK 1202

>YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediate
           filament protein involved in organelle inheritance and
           in the regulation of mitochondrial morphology [3384 bp,
           1127 aa]
          Length = 1127

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 13/70 (18%)

Query: 401 YNNNVISATSVQRRYDQLFRNPEADTHL------LLRNFADTFP---EGSLKYKELNA-I 450
           +NN  +S+  + RRY++ F   E +T+L      L+R   D FP   + SLKY      +
Sbjct: 811 FNNGQVSSWDMARRYNEFF---ELNTYLKKNFRDLMRQLQDLFPSKVKMSLKYHVTKTLL 867

Query: 451 YQAEQEKRER 460
           Y+  ++K E+
Sbjct: 868 YEERKQKLEK 877

>KLLA0F17677g complement(1622629..1624656) weakly similar to
           sp|P54074 Saccharomyces cerevisiae YMR119w, start by
           similarity
          Length = 675

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 57  DTEEDNGEMTCLICADTLRYVALSPCN-HTTCHKCAFRQRALYEKKACLVCRTE 109
           D++++  ++ C++C    R + L PC     C  C      L     C+ CR E
Sbjct: 613 DSDDEAVDLACVVCKTNTRNIILWPCKCFALCENCRM-SLGLRGFNTCICCRRE 665

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 12/90 (13%)

Query: 157 YNCPY-GDVPEFDLDSFKNYNEHLKNEHKRSICTICARHRKQFPAEMKTLTPNQLKIHNT 215
           Y C + G   EF +  +     H+KN+H +  C IC++           +  N L++H  
Sbjct: 194 YQCTFAGCCKEFRI--WSQLQSHIKNDHPKLKCPICSK---------PCVGENGLQMHMI 242

Query: 216 IGDSKGFTGHPLCGFCSGKRFYSDDELYIH 245
           I D    T +  C  C    F    +L  H
Sbjct: 243 IHDDSLVTKNWKCHICPDMSFSRKHDLLTH 272

>Scas_601.6
          Length = 661

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 513 PKKPVPYRPTSPVASSSTQVQNTKRNSNY----TPTYLKSKTKGESRAQS 558
           P +PV    T PV+S  T +QNT ++S +    T TY+ S+T+ E+  Q+
Sbjct: 393 PMQPVQKSQTLPVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQTETPKQT 442

>Scas_573.9
          Length = 1502

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 60   EDNGEMTCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCR 107
            E+N    C IC   +   ++  C H  C +C      L  KK C +C+
Sbjct: 1184 ENNKSFKCSICLQDISLGSMLKCGHFFCKRCI--TSWLKNKKNCPMCK 1229

>Kwal_26.7525
          Length = 392

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 516 PVPYRPTSPVASSSTQVQNTKRNSNYTPTYLKSKTKGESRAQSNAALFPPLSSPD 570
           P+P RPT+PV  ++T   +   N    P  LK+ +K     Q N+     L+SPD
Sbjct: 132 PLPRRPTNPVPVANTGTASESSNVVAFPDILKAASKHLPELQPNS-----LTSPD 181

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,110,137
Number of extensions: 870719
Number of successful extensions: 3763
Number of sequences better than 10.0: 81
Number of HSP's gapped: 3881
Number of HSP's successfully gapped: 91
Length of query: 620
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 512
Effective length of database: 12,857,365
Effective search space: 6582970880
Effective search space used: 6582970880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)