Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AER389C75874433650.0
YOR035C (SHE4)7897099231e-113
CAGL0I01034g7837558391e-100
Scas_699.377687607864e-93
KLLA0E16742g6616016641e-76
Kwal_55.199912752774002e-43
KLLA0E19393g33641674.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER389C
         (744 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...  1300   0.0  
YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein r...   360   e-113
CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces cer...   327   e-100
Scas_699.37                                                           307   4e-93
KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534 Saccha...   260   1e-76
Kwal_55.19991                                                         158   2e-43
KLLA0E19393g 1720040..1721050 no similarity, hypothetical start        30   4.9  

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score = 1300 bits (3365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/744 (89%), Positives = 666/744 (89%)

Query: 1   MGRTSFTICEDKVQMDAQQLARIFHDNLKVDESPDVYIKALDELVSGSSVINVEDIEEVV 60
           MGRTSFTICEDKVQMDAQQLARIFHDNLKVDESPDVYIKALDELVSGSSVINVEDIEEVV
Sbjct: 1   MGRTSFTICEDKVQMDAQQLARIFHDNLKVDESPDVYIKALDELVSGSSVINVEDIEEVV 60

Query: 61  LHCIKDHTESRNHFLQLSRTRPGSXXXXXXYGSGKSIPAIVDAFSNAQDTNAVLREIQKL 120
           LHCIKDHTESRNHFLQLSRTRPGS      YGSGKSIPAIVDAFSNAQDTNAVLREIQKL
Sbjct: 61  LHCIKDHTESRNHFLQLSRTRPGSLLELLEYGSGKSIPAIVDAFSNAQDTNAVLREIQKL 120

Query: 121 LQDRNRTPAWYIQLIYQLLEKNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSY 180
           LQDRNRTPAWYIQLIYQLLEKNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSY
Sbjct: 121 LQDRNRTPAWYIQLIYQLLEKNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSY 180

Query: 181 PSDFEKEFTDTIDTLAIEADVGIEGSLDAVXXXXXXXXXXXXXXXXXXXXXXXXQQVLRD 240
           PSDFEKEFTDTIDTLAIEADVGIEGSLDAV                        QQVLRD
Sbjct: 181 PSDFEKEFTDTIDTLAIEADVGIEGSLDAVLLTLTELFPLLPLLCSQLLLKPELQQVLRD 240

Query: 241 ESTRNRKTXXXXXXXXSVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAF 300
           ESTRNRKT        SVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAF
Sbjct: 241 ESTRNRKTLLLALNLLSVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAF 300

Query: 301 KKLQSIDIEQLCATCVTELQSPVVKRRAIAVEGLAYLTLKSTVRISIRADGDSSLILVQL 360
           KKLQSIDIEQLCATCVTELQSPVVKRRAIAVEGLAYLTLKSTVRISIRADGDSSLILVQL
Sbjct: 301 KKLQSIDIEQLCATCVTELQSPVVKRRAIAVEGLAYLTLKSTVRISIRADGDSSLILVQL 360

Query: 361 LKKNPDSSTIYGILSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEPLXXXXXX 420
           LKKNPDSSTIYGILSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEPL      
Sbjct: 361 LKKNPDSSTIYGILSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEPLEDDDEI 420

Query: 421 XXXXXXXXLDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLE 480
                   LDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLE
Sbjct: 421 DAFIEDYILDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLE 480

Query: 481 YLNDAPVHNXXXXXXXXXXXXXXXNTDPKLLFHRHSPMNSVPALFGLIPILDGLDNEEAL 540
           YLNDAPVHN               NTDPKLLFHRHSPMNSVPALFGLIPILDGLDNEEAL
Sbjct: 481 YLNDAPVHNIIQILAARALARILINTDPKLLFHRHSPMNSVPALFGLIPILDGLDNEEAL 540

Query: 541 SYLTTRDSYEXXXXXXXXXXXDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELL 600
           SYLTTRDSYE           DSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELL
Sbjct: 541 SYLTTRDSYEALLALTNLAATDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELL 600

Query: 601 ANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAE 660
           ANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAE
Sbjct: 601 ANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAE 660

Query: 661 ELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDALLEVSPSKNDSHLLVDNKDLYKTLQ 720
           ELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDALLEVSPSKNDSHLLVDNKDLYKTLQ
Sbjct: 661 ELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDALLEVSPSKNDSHLLVDNKDLYKTLQ 720

Query: 721 KLVITKLPPESFEAQLLSSIRRRY 744
           KLVITKLPPESFEAQLLSSIRRRY
Sbjct: 721 KLVITKLPPESFEAQLLSSIRRRY 744

>YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein
           required for mother cell-specific expression of HO and
           receptor mediated as well as membrane lipid endocytosis
           [2370 bp, 789 aa]
          Length = 789

 Score =  360 bits (923), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 234/709 (33%), Positives = 369/709 (52%), Gaps = 35/709 (4%)

Query: 43  ELVSGSSVINVEDIEEVVLHCIKDHTESRNHFLQLSRTRPGSXXXXXXYGSGKSIPAIVD 102
           +L +  ++ + + IEE++    +DH+ESR H  +L +             S  SI   V 
Sbjct: 58  DLTNSEALKDRQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVG 117

Query: 103 AFSNAQDTNAVLREIQKLLQDRNRTPAWYI-QLIYQLLEKNWYTFSDLAFLVRVLPRRMD 161
            FSN   T A+L E+Q  +     T   Y+  +I QLL K  Y F ++ FLV+ L  R+ 
Sbjct: 118 CFSNKDATIALLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRIS 177

Query: 162 SEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEADVGIEGS-LDAVXXXXXXXXXX 220
            ++V+ + L++FA L SS+  DF+K   D + +L +EA++ +    L  +          
Sbjct: 178 EDEVKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPS 237

Query: 221 XXXXXXXXXXXXXXQQVLRDE--STRNRKTXXXXXXXXSVACIDDTVRRYIADNLLKELE 278
                          ++ +      ++ +         S ACID+T+R YI +N L+ LE
Sbjct: 238 LTTLCSEIFLTKGLSKLFKKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLE 297

Query: 279 TAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATCVTELQSPV--------------- 323
            + +  D ++Y+++VL+KTW+F KL  I+++QL    +  +   +               
Sbjct: 298 RSLNVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVKLE 357

Query: 324 -VKRRAIAVEGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSSTIYGILSTLVNLTA 382
            V +  ++VE LAYL+LK++V+I IR++   + IL+ ++K    +  +YG+L  + NL+ 
Sbjct: 358 EVPKVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLYGLLVIMANLST 417

Query: 383 SPSEQSSEQKSLNALKAYADLHVPASGK-QEPLXXXXXXXXXXXXXXLDLQVIGTLRSSK 441
            P E +   +S+N LK YADL  P + K                   L  ++I  L+   
Sbjct: 418 LPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREM 477

Query: 442 NVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYL-NDAPVHNXXXXXXXXXXX 500
           + L  NCK+Q+ ++IY +T+S+ FI  C+ QG TT +LEYL N   +             
Sbjct: 478 HNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALT 537

Query: 501 XXXXNTDPKLLFHRHSPMNSVPALFGLIPILDGLD-----NEEALSYLTTRDSYEXXXXX 555
                T+P L+F ++S +N++P LF L+P    +D     N+E +      D+YE     
Sbjct: 538 RMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKL---TDNYEALLAL 594

Query: 556 XXXXXXDSS--EELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMARPINIAAK 613
                 ++S  EE+ K IVS   YW  + N +LDE V +QRS LEL++N+M+ P+ IAAK
Sbjct: 595 TNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAK 654

Query: 614 FFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAEELLKEDELIKAVI 673
           FFNL NP+S +NF+ LV LL+L D+ SQRA+AAIFANIA +IP IA+ELL + ELI+  I
Sbjct: 655 FFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAI 714

Query: 674 LTLKEQCEDEELMQRLLFFIDALLEVSPSKNDSH---LLVDNKDLYKTL 719
               +Q +D EL QRLL     L EV P    +    LL +N+ L   L
Sbjct: 715 QVFADQIDDIELRQRLLMLFFGLFEVIPDNGTNEVYPLLQENQKLKDAL 763

>CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces
           cerevisiae YOR035c SHE4, start by similarity
          Length = 783

 Score =  327 bits (839), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 241/755 (31%), Positives = 391/755 (51%), Gaps = 82/755 (10%)

Query: 37  YIKALDEL----VSGSSVINVE--DIEEVVLHCIKDHTESRNHFLQLSRTRPGSXXXXXX 90
           Y +ALDE+    V    V + +  +IE+V++   +DHTES+    ++ ++  G       
Sbjct: 28  YQEALDEIKDIIVRKKRVASAQLPEIEKVLIRSYQDHTESKKFLREIIKSNVGKALDLFE 87

Query: 91  YGSGKSIPAIVDAFSNAQDTNAVLREIQ-KLLQDRNRTPAWYIQLIYQLLEKNWYTFSDL 149
             S  SI  +V  F ++++T  +L E++ ++    +    + + ++ QLL K  Y F+D 
Sbjct: 88  MLSLPSIHVLVGIFFDSEETMVLLDELRTRIHYGEDPNIKYLLSIVLQLLSKFTYVFNDF 147

Query: 150 AFLVRVLPRRMDSEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEA--DVGIEGSL 207
           +FLVR L  R     V P+ L++F +L+  YP +F+ +F +T+D L +EA  D+G E  L
Sbjct: 148 SFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPDEFKVKFLETMDVLIMEAEEDIGDE-PL 206

Query: 208 DAVXXXXXXXXXXXXXXXXXXXXXXXXQQVLRDESTR---NRKTXXXXXXXXSVACIDDT 264
             +                         ++L++ +T    ++          S+ACID+T
Sbjct: 207 CLIVEILTELYPSLTGLCSEVLLTRGAGKMLKERATSEDSDKNFRSKLLKLLSIACIDET 266

Query: 265 VRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATCVTE-LQSPV 323
           VR +I++  ++ LET+   S+ K+ A++VLIKTW+F KL+ IDI +L +  V   L S V
Sbjct: 267 VRVHISEKYIETLETSMQFSEYKVLAALVLIKTWSFLKLKHIDINKLASILVDNFLDSAV 326

Query: 324 VKRR-----------AIAVEGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSSTIY- 371
           ++                +EGLAYLTLK  ++  +R        +++L KK   ++  Y 
Sbjct: 327 LESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLAKKESGTNPNYF 386

Query: 372 GILSTLVNLTASPSEQS-----SEQKSLNALKAYADL---------HVPASGKQEPLXXX 417
           GIL  + NLTA P++++     +   S+  L  YA++         +VP S ++      
Sbjct: 387 GILIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSEEE------ 440

Query: 418 XXXXXXXXXXXLDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTF 477
                      L   ++  +++  N +    K+Q  +++Y +T+ +  I SCV+QG TT 
Sbjct: 441 --VKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTN 498

Query: 478 LLEYL---NDAPVHNXXXXXXXXXXXXXXXNTDPKLLFHRHSPMNSVPALFGLI------ 528
           +LEYL    D  V                 +TDP L+F+++SP+N++P LF LI      
Sbjct: 499 ILEYLVSKQDKGV--AVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESG 556

Query: 529 ----------PILDGLDNEEALSYLTTRDSYEXXXXXXXXXXXDSS--EELAKVIVSNNR 576
                     P+L+  DN E L      D YE            +S  EE+ K I +  +
Sbjct: 557 EETQEKIELNPLLENDDNIEVL------DRYEALLALTNLAATPTSNGEEICKSISNTPK 610

Query: 577 YWLKLMNCVLDETVQIQRSALELLANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLE 636
           YW  ++N +L+E + IQRS LEL++NLM+ P+ +AAKFFN +NP+S +NF+TLV L+ L+
Sbjct: 611 YWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLIELD 670

Query: 637 DIRSQRAIAAIFANIAGSIPFIAEELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDAL 696
           DI SQRAIAA+FANI  S+PFI+EEL ++D LI   I  L +Q +D EL QRL+ F   L
Sbjct: 671 DIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELTQRLIIFFYGL 730

Query: 697 LEVSPSKNDSHL-----LVDNKDLYKTLQKLVITK 726
            E +P K +S       L  N +L K L+K ++ +
Sbjct: 731 FEYAPEKPESQKAKEKNLFKNANLRKALEKSLVNQ 765

>Scas_699.37
          Length = 768

 Score =  307 bits (786), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 228/760 (30%), Positives = 373/760 (49%), Gaps = 41/760 (5%)

Query: 11  DKVQMDAQQLARIFHDNLKVDESPDVYIKALDEL----VSGSSVINVEDIEEVVLHCIKD 66
           DKV  D   L   F   L+V   P+ Y +ALDE+    + G   I  + +E V+    + 
Sbjct: 3   DKVIAD---LCLEFEKKLRVPVEPEKYNEALDEIFMNDIEGIENIGSKQVETVLSRAYQA 59

Query: 67  HTESRNHFLQLSRTRPGSXXXXXXYGSGKSIPAIVDAFSNAQDTNAVLREIQ-KLLQDRN 125
           H+ SR +  +L               S +++  ++ +F  A DT  +++E++ ++    +
Sbjct: 60  HSSSRVYLHELILKDIPKSLNLFESLSIQTVHILIGSFETANDTIPLIKELKDRIHYGED 119

Query: 126 RTPAWYIQLIYQLLEKNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSYPSDFE 185
             P + +  I Q L K  Y +  + F+VR +  RM     + + L++F  L  S+   F 
Sbjct: 120 THPKYLLSCIVQSLNKYSYAWDQIEFIVRDVCLRMGEPDFKSIGLIIFTLLQESFEEQFY 179

Query: 186 KEFTDTIDTLAIEA--DVGIEGSLDAVXXXXXXXXXXXXXXXXXXXXXXXXQQVLRDEST 243
           K+FT+ ID+L +EA  DVG    L  +                         ++ ++++ 
Sbjct: 180 KKFTNIIDSLILEAEADVG-NDPLSLIVEIFTELYPALTNICSELFLGSELDKLFKEKAM 238

Query: 244 RNRKTX--XXXXXXXSVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAFK 301
            N +           SVACID+ VR +IA+N L  LE +      K Y+++VLIKTW+F 
Sbjct: 239 HNNEDEFIKKLLKLLSVACIDENVRNFIAENYLDMLERSLKLEQFKTYSAVVLIKTWSFT 298

Query: 302 KLQSIDIEQLCATCVTEL--------QSPVVKRRAIAVEGLAYLTLKSTVRISIRADGDS 353
           KL+ + I  L  T                +     + +EGLAYLTLK  +++++R   + 
Sbjct: 299 KLKGVTIGDLGTTLTDNFLMNLKIDDGQSLNDECVMCIEGLAYLTLKKQMKMTLRYHEEF 358

Query: 354 SLILVQLLKKNP---DSSTIYGILSTLVNLTASPSE----QSSEQKSLNALKAYADLHVP 406
           S  ++ LLKK     D S  YGIL  L N++  P +     + + ++L  LK Y++L  P
Sbjct: 359 STTIINLLKKQDTPVDDSVKYGILVILGNISTYPMDVTMDGAMDPQALQDLKTYSELKSP 418

Query: 407 AS-GKQEPLXXXXXXXXXXXXXXLDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPF 465
                 + +              L  +++  LR+    +    ++Q+ ++IY +T++R  
Sbjct: 419 KKRDANDVIENNEDVTRYIQKYILKTELLSYLRTKLAEVSPGSRQQIIRIIYNLTRAREN 478

Query: 466 IQSCVKQGATTFLLEYL-NDAPVHNXXXXXXXXXXXXXXXNTDPKLLFHRHSPMNSVPAL 524
           I + V+QG    ++EYL N                      +DPKL+F+++S + ++P L
Sbjct: 479 ISASVEQGCVVTVIEYLANKKDKKEPTRLLALRSLTKMLTLSDPKLIFNKYSRLTAIPFL 538

Query: 525 FGLIPILDGLDNEEALS---YLTTRDSYEXXXXXXXXXXXDSS--EELAKVIVSNNRYWL 579
           + L+     L  E  LS    +TT+DSYE           + S  +++ K +V++  YW 
Sbjct: 539 YELLQT-PSLSAENPLSTDELITTQDSYEALCALTNLASTEDSNADDVCKQVVTDVNYWS 597

Query: 580 KLMNCVLDETVQIQRSALELLANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLEDIR 639
            + N +LD+ + +QR+ LEL+ANLM  P++IAAK FN  NP+S +NF+ LV LL L D+ 
Sbjct: 598 IIENLILDDNILVQRATLELIANLMCYPLSIAAKIFNFENPQSLRNFNILVKLLELNDVA 657

Query: 640 SQRAIAAIFANIAGSIPFIAEELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDALLEV 699
           +QRA+AAIFANI+ S+P IA+ LL + ELI+       EQ +DE L QRL  F  +L E+
Sbjct: 658 AQRAVAAIFANISSSVPLIAQTLLDKKELIEKATGIFAEQIDDEALRQRLFVFFFSLFEL 717

Query: 700 SPSKNDSHLLVD----NKDLYKTLQKLVI-TKLPPESFEA 734
            PSK +     D    N +L  TL+ L+    + PE  EA
Sbjct: 718 LPSKEEDSRKFDSLTRNTNLKMTLESLMKRDDIEPEYLEA 757

>KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534
           Saccharomyces cerevisiae YOR035c SHE4 required for
           mother cell-specific gene expression singleton,
           hypothetical start
          Length = 661

 Score =  260 bits (664), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 198/601 (32%), Positives = 304/601 (50%), Gaps = 48/601 (7%)

Query: 141 KNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEA- 199
           K+W     L FL R +  R   +++RPL LV    L S++  + E++  + +  L IEA 
Sbjct: 65  KDW---GQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEAE 121

Query: 200 -DVGIEGSLDAVXXXXXXXXXXXXXXXXXXXXXXXXQQVLR---DESTRNRKTXXXXXXX 255
            D G   SL  +                        Q +L    + S  +          
Sbjct: 122 EDSG-NVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRL 180

Query: 256 XSVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATC 315
            +V+CID+ VRR+IA++ LK L+ +F     K+  ++VLIK W+F K++    ++   +C
Sbjct: 181 LAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIE----KETLNSC 236

Query: 316 VTELQSPVVKRRAIAV--EGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSST-IYG 372
           +      +     I +  E LAYLTLK +VR+ +R +GD  L +++L+K    + T +YG
Sbjct: 237 INLFIDSLSNGENIEINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLYG 296

Query: 373 ILSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEP-LXXXXXXXXXXXXXXLDL 431
           +L  L N++  PS+    + +++ LKA   L        EP L              +DL
Sbjct: 297 LLIILANVSEHPSQN---EDTVDKLKA--SLKTNQEKNDEPTLENVKDIEEFNRDYIIDL 351

Query: 432 QVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYLNDAPVHNXX 491
            +IG+L+S K  L  +   Q  ++IY VT+ +  I  CVKQGA   LL +L  A   N  
Sbjct: 352 DLIGSLKSIK--LSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFL--AQKRNLS 407

Query: 492 XXXXXXXXXXXXXNT----DPKLLFHRHSPMNSVPALFGLIPILDGLDNEEALSYL--TT 545
                         T    +P+  F ++SP+++ P LF  +P    L N+ ALS L  T 
Sbjct: 408 KDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLP----LPNDNALSELQFTQ 463

Query: 546 RDSYEXXXXXXXXXXXDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMA 605
            D+YE           +   +L K+I+SN +YW  + N +LD +V+IQRS LEL++NLM+
Sbjct: 464 LDTYEALLALTNLATINQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMS 523

Query: 606 RPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAEELLKE 665
            P+ I+AKFF   NP+S +NF+ LV LL L DI+SQRA+AAIFANIA ++PFI +EL ++
Sbjct: 524 NPMAISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEK 583

Query: 666 DELIKAVILTLKEQCEDEELMQRLLFFIDALLE-----VSPSKNDSHLLVDNKDLYKTLQ 720
             LI+  I   K Q  D +L  RLL  + ++       V+  KND       ++  K LQ
Sbjct: 584 RNLIETAIRVFKTQNTDTDLRIRLLVLLSSIFNANAHAVACVKND-------EEFVKELQ 636

Query: 721 K 721
           K
Sbjct: 637 K 637

>Kwal_55.19991
          Length = 275

 Score =  158 bits (400), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 145/277 (52%), Gaps = 5/277 (1%)

Query: 376 TLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEPLXXXXXXXXXXXXXXLDLQVIG 435
            L NL++   E SS Q++L  L+AYADL  P + K                  LDL  +G
Sbjct: 3   VLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYILDLNTLG 62

Query: 436 TLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYLNDAPVHNXXXXXX 495
            L+S      +    QL ++I+ +++++ FI   V+QG+   LLE L    +        
Sbjct: 63  LLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKMPADFKLLA 122

Query: 496 XXXXXXXXXNTDPKLLFHRHSPMNSVPALFGLIPI-LDGLDNEEALSYLTTRDSYEXXXX 554
                      +P+L+F R S + +VP LF LIP+      N++    +  +D+YE    
Sbjct: 123 LRSLARILAMVNPELVFRRFSALTAVPYLFELIPVPTQPASNDQ----IDPKDTYEALLA 178

Query: 555 XXXXXXXDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMARPINIAAKF 614
                    S+ + + IV++  YW +L   +LD TV+IQRS LELL NLMA  +++A KF
Sbjct: 179 LTNLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLHLAVKF 238

Query: 615 FNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANI 651
           FN  NP+S +NF+ LV LL L+DIRSQ A+  IFANI
Sbjct: 239 FNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGIFANI 275

>KLLA0E19393g 1720040..1721050 no similarity, hypothetical start
          Length = 336

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 700 SPSKNDSHLLVDNKDLYKTLQKLVITKLPPESFEAQLLSSI 740
           S   ++S+L+ D+ DL+    KLV+ KLPP + E  L  +I
Sbjct: 35  SKHSSESNLIFDDDDLFVEHAKLVVKKLPPTNDEESLPMNI 75

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,273,198
Number of extensions: 793060
Number of successful extensions: 2384
Number of sequences better than 10.0: 8
Number of HSP's gapped: 2427
Number of HSP's successfully gapped: 12
Length of query: 744
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 635
Effective length of database: 12,822,747
Effective search space: 8142444345
Effective search space used: 8142444345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)