Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AER387C65564333880.0
Kwal_55.1998164536312891e-170
CAGL0H08085g67457212461e-163
YOR033C (EXO1)70243612341e-161
KLLA0E16797g67146012271e-161
Sklu_1321.265636312171e-159
Scas_699.3570946212201e-159
YDR263C (DIN7)43037110491e-137
Scas_538.64123949831e-128
Kwal_26.76873802281824e-14
KLLA0F02992g3812561772e-13
Sklu_2149.23812281736e-13
CAGL0K11506g3812291692e-12
YKL113C (RAD27)3822401655e-12
Scas_717.643792301593e-11
AFR133C9701431453e-09
Scas_645.810001951382e-08
ABL052C3792891362e-08
Kwal_23.434310312031321e-07
YGR258C (RAD2)10311301321e-07
CAGL0F08327g9921951311e-07
KLLA0A09427g10111941302e-07
Sklu_2443.2510331451293e-07
Kwal_47.191686732471203e-06
YER041W (YEN1)7591441167e-06
KLLA0A01320g5841711132e-05
Scas_687.23745175970.001
AFR238W698247950.002
AER414W76951910.007
YNL085W (MKT1)83047760.49
Sklu_1834.280387730.98
CAGL0C02255g648118731.1
AGL197W84453711.7
Sklu_2195.238647702.0
Kwal_33.14738963119702.3
Kwal_33.1330870645683.7
KLLA0D09801g876151676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER387C
         (643 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C (...  1309   0.0  
Kwal_55.19981                                                         501   e-170
CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces c...   484   e-163
YOR033C (EXO1) [4845] chr15 complement(392415..394523) Double-st...   479   e-161
KLLA0E16797g 1487301..1489316 some similarities with sp|P39875 S...   477   e-161
Sklu_1321.2 YOR033C, Contig c1321 793-2763                            473   e-159
Scas_699.35                                                           474   e-159
YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondr...   408   e-137
Scas_538.6                                                            383   e-128
Kwal_26.7687                                                           75   4e-14
KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces c...    73   2e-13
Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement          71   6e-13
CAGL0K11506g 1114740..1115885 highly similar to sp|P26793 Saccha...    70   2e-12
YKL113C (RAD27) [3150] chr11 complement(224373..225521) Single-s...    68   5e-12
Scas_717.64                                                            66   3e-11
AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH] (675260..67...    60   3e-09
Scas_645.8                                                             58   2e-08
ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH] (300564..30...    57   2e-08
Kwal_23.4343                                                           55   1e-07
YGR258C (RAD2) [2205] chr7 complement(1007676..1010771) Structur...    55   1e-07
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    55   1e-07
KLLA0A09427g complement(821244..824279) similar to sp|P07276 Sac...    55   2e-07
Sklu_2443.25 YGR258C, Contig c2443 54418-57519                         54   3e-07
Kwal_47.19168                                                          51   3e-06
YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nucleas...    49   7e-06
KLLA0A01320g complement(118369..120123) weakly similar to sp|P40...    48   2e-05
Scas_687.23                                                            42   0.001
AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH] complement(...    41   0.002
AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH] complement(...    40   0.007
YNL085W (MKT1) [4505] chr14 (467131..469623) Protein containing ...    34   0.49 
Sklu_1834.2 YNL085W, Contig c1834 1199-3610                            33   0.98 
CAGL0C02255g complement(228009..229955) similar to sp|P40028 Sac...    33   1.1  
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    32   1.7  
Sklu_2195.2 YBR042C, Contig c2195 2283-3443                            32   2.0  
Kwal_33.14738                                                          32   2.3  
Kwal_33.13308                                                          31   3.7  
KLLA0D09801g 827563..830193 similar to sgd|S0003991 Saccharomyce...    30   6.1  

>AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C
           (DIN7) - SH] (1363438..1365405) [1968 bp, 655 aa]
          Length = 655

 Score = 1309 bits (3388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/643 (97%), Positives = 630/643 (97%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV
Sbjct: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF
Sbjct: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC
Sbjct: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT
Sbjct: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV
Sbjct: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300

Query: 301 PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE 360
           PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE
Sbjct: 301 PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE 360

Query: 361 RQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRIER 420
           RQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRIER
Sbjct: 361 RQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRIER 420

Query: 421 IVQKRKLADSHEGQLNESTFFVRRQSAGGSQQKPVNAAYRSSDDTRSTQKSLPSSQTLAL 480
           IVQKRKLADSHEGQLNESTFFVRRQSAGGSQQKPVNAAYRSSDDTRSTQKSLPSSQTLAL
Sbjct: 421 IVQKRKLADSHEGQLNESTFFVRRQSAGGSQQKPVNAAYRSSDDTRSTQKSLPSSQTLAL 480

Query: 481 PMTPADSVDAGVIMSCFAKTPEKENVSQILDGIGSTGQEHTEVDEITEVLDELDDSSNNL 540
           PMTPADSVDAGVIMSCFAKTPEKENVSQILDGIGSTGQEHTEVDEITEVLDELDDSSNNL
Sbjct: 481 PMTPADSVDAGVIMSCFAKTPEKENVSQILDGIGSTGQEHTEVDEITEVLDELDDSSNNL 540

Query: 541 QESSSPXXXXXXXXXXXXXFIYRSETSFEKRQRLPLTNCDANDRFIDTKKLVIGKLNKRM 600
           QESSSP             FIYRSETSFEKRQRLPLTNCDANDRFIDTKKLVIGKLNKRM
Sbjct: 541 QESSSPLQQLTLTKALAAKFIYRSETSFEKRQRLPLTNCDANDRFIDTKKLVIGKLNKRM 600

Query: 601 MVSSKDTASLCIAQEKPSLVSKQTTTNSRRQSSGSRHKVSSGT 643
           MVSSKDTASLCIAQEKPSLVSKQTTTNSRRQSSGSRHKVSSGT
Sbjct: 601 MVSSKDTASLCIAQEKPSLVSKQTTTNSRRQSSGSRHKVSSGT 643

>Kwal_55.19981
          Length = 645

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/363 (63%), Positives = 278/363 (76%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQQPVTL RY  Q LAIDGYAWLHR+AHSCA EL +G+PT KYL+FFV
Sbjct: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KRL +L+++Y+I PYLVFDG  I VK  TE KR  KR ESR +A+ LW  GE+R+++EYF
Sbjct: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTEVKRKSKRVESREKALALWRSGEKRQAYEYF 120

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCVD+TPEM K +I+YC      YVVAP+EAD Q+VYLEK GLV GIISEDSDLL+FGC
Sbjct: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRLITKLND+GEG EIC DDF +LP KFPL+ L    +R MVCL+GCDYT GIP+VGLLT
Sbjct: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+KLV KH+T+D I+  I+REGK+ VP +F+ EY+ A  AFQFQRV+CP  N +TTLN +
Sbjct: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300

Query: 301 PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE 360
           P  L     L+E IG  + K T  + VI D   +DHE H RIA G+L P NH++ L+NRE
Sbjct: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360

Query: 361 RQL 363
           R+L
Sbjct: 361 RKL 363

>CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces
           cerevisiae YOR033c DHS1 or sp|Q12086 Saccharomyces
           cerevisiae YDR263c DIN7, start by similarity
          Length = 674

 Score =  484 bits (1246), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 253/572 (44%), Positives = 353/572 (61%), Gaps = 49/572 (8%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQ PV+L RY  Q L IDGYAWLHR++ SCA EL MG PTEKYL+FF+
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAYELAMGLPTEKYLKFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KR  +L+  + + PYLVFDG  I VK  T  KR EKR E+R  A+ LW+ G +R + +YF
Sbjct: 61  KRFNMLK-SFGVTPYLVFDGDSINVKQETNKKRREKRQENREIAMRLWQSGNKRNAMDYF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCVD+TPEM K +IDYC   G KY+VAP+EADPQ+VYLEK GL+QGII+EDSDLLVFGC
Sbjct: 120 QKCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEKKGLIQGIIAEDSDLLVFGC 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRL+TKLND+GE  EICRD F  L  KFP+  L    +R MVCL+GCDYT GIP++GL+ 
Sbjct: 180 RRLVTKLNDFGECIEICRDSFGQLTSKFPIGQLSNEEIRMMVCLSGCDYTNGIPRIGLIK 239

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+KLV+ H+ MD+IL++++ EGK+ VP  F DEYR+AD +FQFQRV+CPL  Q+ +L E+
Sbjct: 240 AIKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYADYSFQFQRVFCPLSKQIVSLTEI 299

Query: 301 PSTLREDPILYECIGHAVHKITG-ERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINR 359
           P  L+ D IL+ CIG A+ ++ G +R  ++D+  IDHEIH  +A G LNP +  + L+NR
Sbjct: 300 PMGLQSDKILHSCIGKAICRLDGTKRYCLNDE--IDHEIHGYLARGDLNPYDFTKRLVNR 357

Query: 360 ERQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVR---TSAGTSLGVMD 416
           E +L + +    ++++  P     +R V +      T     P ++   TS+       D
Sbjct: 358 EHKLQL-QSKSDMSITYDPSNEQKSRKVLSI----DTFFSSVPEIKGQGTSSNKQPVYED 412

Query: 417 RIER----IVQKRKLADSHE-GQLNESTFFVRRQSAGG---------------SQQKPVN 456
            +E+    ++  RKL    +      S FF   Q +                 + +K + 
Sbjct: 413 FVEKKYTQLISNRKLGRKSDCNNKVTSKFFTSNQESNSRTAGLNGCNLNSIEQATEKIII 472

Query: 457 AAYRSSDD-------TRSTQKSLPSSQTLALPMTPADSVDAGVIMSCFAKTPEKENVSQI 509
           +   S  D       T+   ++ P+  +L++  + + S   G   + F  T ++      
Sbjct: 473 SDNESETDLPESELPTQVEAQNTPTEFSLSIASSQSKSTSDG--FNSFEVTSQR------ 524

Query: 510 LDGIGSTGQEHTEVDEITEVLDELD-DSSNNL 540
            D IG+T +EH ++ E+ ++ D  D D+S NL
Sbjct: 525 -DEIGNTSEEHEDISELIDLSDNNDVDNSTNL 555

>YOR033C (EXO1) [4845] chr15 complement(392415..394523)
           Double-stranded DNA 5'->3' exonuclease, involved in
           mismatch repair and recombination [2109 bp, 702 aa]
          Length = 702

 Score =  479 bits (1234), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/436 (51%), Positives = 311/436 (71%), Gaps = 7/436 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQ PV+L RY  + LAIDGYAWLHR+A SCA EL MG+PT+KYLQFF+
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KR ++L+  + +EPYLVFDG  I VK  TE+KR +KR E++A A  LW  GE++ + +YF
Sbjct: 61  KRFSLLK-TFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCVDITPEM K II YC   G +Y+VAP+EAD Q+VYLE+  +VQGIISEDSDLLVFGC
Sbjct: 120 QKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRLITKLNDYGE  EICRD+F+ LP KFPL SL    + TMVCL+GCDYT GIP+VGL+T
Sbjct: 180 RRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+KLV +  T+++I+L+I+REGK  +P  +++EY  A LAFQFQRV+CP++ ++ +LNE+
Sbjct: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299

Query: 301 PSTLREDPI----LYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQAL 356
           P  L++       LY CIG  +H+ T ++ ++  D  IDH +H +IA G LNP +  Q L
Sbjct: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPL 359

Query: 357 INRERQLGV-DKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVM 415
            NRE +L +  K  +    ++   + A  +P+ + ++ K T ++  P V  +  +     
Sbjct: 360 ANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQ-KMTKLDHNPKVANNIHSLRQAE 418

Query: 416 DRIERIVQKRKLADSH 431
           D++   +++RKL++++
Sbjct: 419 DKLTMAIKRRKLSNAN 434

>KLLA0E16797g 1487301..1489316 some similarities with sp|P39875
           Saccharomyces cerevisiae YOR033c DHS1 exonuclease which
           interacts with MSH2P, hypothetical start
          Length = 671

 Score =  477 bits (1227), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 237/460 (51%), Positives = 316/460 (68%), Gaps = 11/460 (2%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG++GLLPQLK IQ PV+L RY+ + LAIDGYAWLHRSAHSCA EL M QPT+KYLQFF+
Sbjct: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KR+++LR  + I P+ VFDG  I+VK  TE KR EKR E+R +A  L+E G+RR +++YF
Sbjct: 61  KRISMLR-HFKITPFFVFDGDSIQVKKETELKRAEKRKENREKAHALFEAGDRRLAYDYF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCV ITP+M K +I+Y       YVVAPYEAD Q+VYLEK GLVQGIISEDSDLLVFGC
Sbjct: 120 QKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPD-KFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLL 239
            RLITKLND  E  EI R +F  L + KFPL+ L E  LR++VCL+GCDYT GIP+VGL+
Sbjct: 180 TRLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLV 239

Query: 240 TAVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNE 299
           TA+K VVK++TM+Q+++ IKREGK  VP  F +EY++A+ AFQFQRV+CPL  +L TLN 
Sbjct: 240 TAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNA 299

Query: 300 VPSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINR 359
           +P+ L  +  L+ CIGHA+HK    + VI D   +DH +H RI++G+LNP +  + L+NR
Sbjct: 300 IPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNR 359

Query: 360 ERQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRIE 419
           E +L +    V +T+    CT+  T   S + K     +        S     G+M ++E
Sbjct: 360 EHKLRLKSQSVVMTIDKF-CTAKTTAGSSANSKSMNAFIARK---SQSLNNGSGIMSKLE 415

Query: 420 RIVQKRKL---ADSHEGQ--LNESTFFVRRQSAGGSQQKP 454
             +++RKL   A+ H  +  +N   F  +R+     + +P
Sbjct: 416 TALKRRKLSGPANEHSTKKVVNSQFFAAKREPKAVPKVEP 455

>Sklu_1321.2 YOR033C, Contig c1321 793-2763
          Length = 656

 Score =  473 bits (1217), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/363 (59%), Positives = 272/363 (74%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQQP TL RY  Q LAIDGYAWLHR+AHSCA EL   QPT KYLQFF+
Sbjct: 1   MGIQGLLPQLKPIQQPATLRRYSGQTLAIDGYAWLHRAAHSCAMELATDQPTTKYLQFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KRLT+LR  ++I PYLVFDG  I VK  T++KR EKR E++ R + LW  G++++S EYF
Sbjct: 61  KRLTMLRSTFNITPYLVFDGDSINVKKETDSKRREKRQENKERGLKLWHMGDKKRSLEYF 120

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCV ITPEM K +I+YC     +Y+VAP+EAD Q+VYLE  G   GIISEDSDLL+FGC
Sbjct: 121 QKCVAITPEMAKCVIEYCKVQKVQYIVAPFEADAQMVYLENHGFAHGIISEDSDLLIFGC 180

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRLITKLNDYGE  EIC DDF HLP KFPL  L    +R MVCL+GCDYT GIPQVGLLT
Sbjct: 181 RRLITKLNDYGECIEICSDDFNHLPSKFPLCQLNREEIRMMVCLSGCDYTSGIPQVGLLT 240

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+KLV K + MD+ILL+I+REGK K+P +F  EY+ A+ AFQFQRV+CP   ++ TLN +
Sbjct: 241 AMKLVKKFRNMDKILLSIQREGKLKIPQDFTQEYQLANFAFQFQRVFCPKSQRIVTLNVI 300

Query: 301 PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE 360
           P TL  + ++++C+G  + K    + V+ DD  IDH++H  +++G+LNP +  + L+NRE
Sbjct: 301 PETLYNNKLVFQCVGKVISKQHKIKTVVEDDDDIDHDLHRLVSLGELNPYDFHKPLVNRE 360

Query: 361 RQL 363
            +L
Sbjct: 361 HRL 363

>Scas_699.35
          Length = 709

 Score =  474 bits (1220), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/462 (51%), Positives = 317/462 (68%), Gaps = 28/462 (6%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQ PV LHRY  Q LAIDGYAWLHR+A SCA EL M +PT+KYLQFF+
Sbjct: 1   MGIQGLLPQLKPIQNPVGLHRYEGQTLAIDGYAWLHRAACSCAYELAMEKPTQKYLQFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           K+ ++LR +++IEPYLVFDG  I VK GTE KR E+R E+RA A  LW  GE++ + +YF
Sbjct: 61  KKFSMLR-KFNIEPYLVFDGDSIPVKKGTELKRRERRVENRAIAERLWTSGEKKNAMDYF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QKCVDITP+M K +IDYC      Y+VAP+EAD Q+VYLE++G+VQGIISEDSDLLVFGC
Sbjct: 120 QKCVDITPDMAKCVIDYCKVNQINYIVAPFEADSQMVYLEQTGIVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           RRLITKLNDYGE  EIC+DDF  LP KFPL  L     RT+VCL+GCDYT GIP+VGL+T
Sbjct: 180 RRLITKLNDYGECIEICKDDFNKLPRKFPLGQLNMECFRTLVCLSGCDYTDGIPKVGLVT 239

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+K+V K + MD+ILL+I+R+GK K+P  F DEY+ A+ AFQ+QRV+CP+  ++  LN++
Sbjct: 240 AMKMVYKLRNMDRILLSIQRDGKLKIPTTFKDEYKLANYAFQYQRVFCPISRRIVPLNKI 299

Query: 301 PS---TLREDPILYECIGHAVHKITG-ERCVISDDMMIDHEIHTRIAIGQLNPCNHKQAL 356
           P    T  +  IL +CIG+ +H+ +  ++CVI+D+  IDHE+H RIA G LNP +  + L
Sbjct: 300 PEEKFTADDLIILSQCIGNVIHRDSQVKQCVINDE-DIDHELHARIANGDLNPYDFHRPL 358

Query: 357 INRERQL-----------------GVDKGV-VHLTVSSVPCTSAPTRPVSTSWKIKQTTV 398
            NRE++L                 G  KG+      +++  T      V  + KI Q   
Sbjct: 359 TNREQKLQLVSKSEMGISIPSKNQGETKGIDSFFKKTALKVTEKKAVNVVQNKKIPQFLS 418

Query: 399 EPGPPVRTSAGTSLGVMDRIERIVQKRKLADSH-EGQLNEST 439
                +     T  G   R+E ++++RKL++ + + Q+ +ST
Sbjct: 419 TSSFNINNKNKTHEG---RLEAMLKRRKLSNQNTKSQIEDST 457

>YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondrial
           inner membrane nuclease with a role in stabilizing the
           mitochondrial genome, expression is induced by DNA
           damage [1293 bp, 430 aa]
          Length = 430

 Score =  408 bits (1049), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/371 (53%), Positives = 255/371 (68%), Gaps = 5/371 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MGI GLLPQLK IQ+ V+L +Y  Q LAIDGYAWLHR++ +CA EL M +PT KYLQFF+
Sbjct: 1   MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           KRL +L+ +  I+PY+VFDG  + VK  TE +R +KR E+   A  LW  G R  + EYF
Sbjct: 61  KRLQLLK-RLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QK VDITPEM K IIDYC      Y+VAP+EADPQ+VYLEK GL+QGIISEDSDLLVFGC
Sbjct: 120 QKSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           + LITKLND G+  EI +DDF  LP+ FPL  L E   R +VCLAGCDYT GI +VG++T
Sbjct: 180 KTLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVT 239

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+K+V ++  M  IL+ I+R  K      F  +  FA+ AFQ+QRV+CPL NQ+TTLN +
Sbjct: 240 AMKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNI 299

Query: 301 PSTL----REDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQAL 356
           P  +     E   + +CIG  V + +G R  + +   IDH++H  IA G+L+P +    L
Sbjct: 300 PKAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKL 359

Query: 357 INRERQLGVDK 367
           INRER+L   K
Sbjct: 360 INRERKLKARK 370

>Scas_538.6
          Length = 412

 Score =  383 bits (983), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/394 (47%), Positives = 266/394 (67%), Gaps = 8/394 (2%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+AGLLP LK IQ+ VTL +Y    L ID Y+WLH++A SCA EL M +PTEKYLQ+F+
Sbjct: 1   MGVAGLLPHLKTIQKHVTLKKYAGMTLGIDAYSWLHKAACSCAYELAMDKPTEKYLQYFI 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120
           ++  +++ + +I+PYL+FDG  I VK   E+ R  KR  ++     LW  GER+ + E+F
Sbjct: 61  RKFNLMK-KLNIKPYLIFDGDAILVKGEVESSRLNKRKTNKLMGEKLWRIGERKAATEFF 119

Query: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           QK V+IT +M K II+YC     +YVVAP+EAD Q+VYLEK+  VQGIISEDSDL+VFG 
Sbjct: 120 QKSVNITTQMAKHIINYCRENSIQYVVAPFEADSQMVYLEKTVQVQGIISEDSDLIVFGS 179

Query: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
           +RLITKLN++GE  EI   DF  L  KFP   L    +R +VCL+GCDYT GI ++GL+T
Sbjct: 180 KRLITKLNEFGECIEIASCDFGDLTGKFPFGELSMDQIRMLVCLSGCDYTVGIWKIGLVT 239

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
           A+KLV +   MD I+  IK  GK+ +   FL EY++A+ +FQ+QRV+ P +N++ TLN +
Sbjct: 240 AIKLVRQFDNMDDIVNHIKESGKYSLNCNFLQEYKYANYSFQYQRVFDPKENRIVTLNRI 299

Query: 301 PSTLRED----PILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQAL 356
           P+ L+ D     I+ +CIG+ + K +G + ++ +D  IDH IHT IA G L+P N K+ L
Sbjct: 300 PTELKNDRKELGIVGQCIGNVISKKSGIKSIVVNDDDIDHNIHTMIANGDLDPHNWKETL 359

Query: 357 INRERQLGVDKGVV--HLTVSSVPCTS-APTRPV 387
           I+RE  L  ++ +   +LT    P ++  PT P+
Sbjct: 360 ISREEYLHSERSITLNNLTNPLSPISNFLPTNPI 393

>Kwal_26.7687
          Length = 380

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 105/228 (46%), Gaps = 16/228 (7%)

Query: 49  GQPTEKYLQFFVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLW 108
           G+ T   +  F + L ++ +   I+P  VFDG    +K+    KR  +RA +  +  +  
Sbjct: 59  GETTSHLMGIFYRTLRMIDN--GIKPCYVFDGKPPILKSHELDKRSARRATTEEKLKEAV 116

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
           E+ E+ K   + ++ V +TPE            G  YV AP EA+ Q   L K+G V   
Sbjct: 117 EEAEKLK---HERRLVRVTPEHNDEAKKLLRLMGLPYVEAPCEAEAQCAELAKAGKVYAA 173

Query: 169 ISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLA--- 225
            SED D L +    L+  L      F   + + +H  +   L    E  +   + L    
Sbjct: 174 ASEDMDTLCYRTPYLLRHLT-----FSEAKKEPIHEINVEVLLQGLELTIEQFIDLGIML 228

Query: 226 GCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIKR---EGKWKVPAEF 270
           GCDY   I  VG +TA+KL+ +HKT++ I+  I+      KWK+P  +
Sbjct: 229 GCDYCDSIRGVGPVTALKLIKEHKTLENIVQYIESGEANTKWKIPENW 276

>KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces
           cerevisiae YKL113c RAD27 ssDNA endonuclease and 5 -3
           exonuclease, start by similarity
          Length = 381

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 120/256 (46%), Gaps = 17/256 (6%)

Query: 22  YRSQALAIDGYAWLHRSAHSCATELGM------GQPTEKYLQFFVKRLTILRDQYDIEPY 75
           +  + +AID    L++   +   + G+      G+ T   +  F + L ++   + I+P 
Sbjct: 26  FHGRKVAIDASMSLYQFLIAVRQQDGVQLAGEDGETTSHLMGMFYRTLRMI--DHGIKPC 83

Query: 76  LVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYFQKCVDITPEMTKVII 135
            VFDG+  ++K     KR  +R ++ A+   L E  E+ +  ++ ++ V + P   +   
Sbjct: 84  YVFDGSPPELKKYELDKRKVRREDTEAK---LKEATEQAEIIKHERRLVKVLPWHNEEAQ 140

Query: 136 DYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITKLNDYGEGFE 195
                 G  YVVAP EA+ Q   L KSG V    SED D L +    L+  L  + E  +
Sbjct: 141 KLLSLMGIPYVVAPAEAEAQCAELAKSGKVFAAASEDMDTLCYQTPVLLRHLT-FSEARK 199

Query: 196 ICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLTAVKLVVKHKTMDQIL 255
           +   +F      +    L ++    +  + GCDY +GI  VG + A+KL+ +H +++ I+
Sbjct: 200 LPIQEF-DTDVIYNTLDLTQTQFIDLGIILGCDYCEGIKGVGPVNALKLIKEHGSLEAIV 258

Query: 256 LTIKR----EGKWKVP 267
              +      G+WK+P
Sbjct: 259 EKFENGDISSGRWKIP 274

>Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement
          Length = 381

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 105/228 (46%), Gaps = 16/228 (7%)

Query: 49  GQPTEKYLQFFVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLW 108
           G+ T   +  F + L ++ +   I+P  VFDG    +K+    KR +KR E++ +     
Sbjct: 59  GETTSHLMGMFYRTLRMVDN--GIKPCYVFDGKPPTLKSHELGKRSQKRDETQKKLEAAT 116

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
           ++ E+R       K   +  E  K +++     G  YV AP EA+ Q   L K+  V   
Sbjct: 117 DEAEKRMHERRLVKVTPLHNEEAKRLLEL---MGIPYVNAPGEAEAQCAALAKADKVYAA 173

Query: 169 ISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVHLPD-KFPLNSLGES--GLRTMVCLA 225
            SED D L +    L+  L      F   + + +H  D +  L  L  +      +  + 
Sbjct: 174 ASEDMDTLCYRTPFLLRHLT-----FSEAKKEPIHEIDTELVLKGLDLTLEQFIDLCIML 228

Query: 226 GCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIKR---EGKWKVPAEF 270
           GCDY   I  VG +TA+KL+ +H ++D+I+  I+      KWK+P  +
Sbjct: 229 GCDYCDNIRGVGPVTALKLIKEHGSLDKIVEFIESGEANNKWKIPEHW 276

>CAGL0K11506g 1114740..1115885 highly similar to sp|P26793
           Saccharomyces cerevisiae YKL113c RAD27 ssDNA
           endonuclease and 5 -3 exonuclease, start by similarity
          Length = 381

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 105/229 (45%), Gaps = 18/229 (7%)

Query: 49  GQPTEKYLQFFVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLW 108
           G+ T   +  F + L ++ +   I+P  VFDG    +K+    KR  +R E+  +  +  
Sbjct: 59  GETTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPVLKSHELDKRTSRREETEKKLAEAT 116

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
           E+ E+ K   + ++ V ++ E            G  YV AP EA+ Q   L K G V   
Sbjct: 117 EEAEKMK---HERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAEAQCAELAKKGKVYAA 173

Query: 169 ISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVH-LPDKFPLNSLGESGLRTMVCLA-- 225
            SED D L +    L+  L      F   R + +H +  +  L  L E  +   + L   
Sbjct: 174 ASEDMDTLCYRTPYLLRHLT-----FSEARKEPIHEINTEIVLQGL-ELTIDQFIDLGIM 227

Query: 226 -GCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIKR---EGKWKVPAEF 270
            GCDY   I  VG +TA+KL+ +H ++++I+  I+      KWKVP  +
Sbjct: 228 LGCDYCDSIKGVGPVTALKLMKEHGSLEKIVEYIESGEANNKWKVPENW 276

>YKL113C (RAD27) [3150] chr11 complement(224373..225521)
           Single-stranded DNA endonuclease and 5'-3' exonuclease
           that functions in the MSH2-MLH1-PMS1-dependent mismatch
           repair system [1149 bp, 382 aa]
          Length = 382

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 19/240 (7%)

Query: 49  GQPTEKYLQFFVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLW 108
           G+ T   +  F + L ++ +   I+P  VFDG    +K+    KR  +R E+  +  +  
Sbjct: 59  GETTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEAT 116

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
            + E+ K     ++ V ++ E  +         G  Y++AP EA+ Q   L K G V   
Sbjct: 117 TELEKMKQE---RRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAA 173

Query: 169 ISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVHLPD-KFPLNSLGES--GLRTMVCLA 225
            SED D L +    L+  L      F   + + +H  D +  L  L  +      +  + 
Sbjct: 174 ASEDMDTLCYRTPFLLRHLT-----FSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIML 228

Query: 226 GCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIK----REGKWKVPAEFLDEYRFADLAF 281
           GCDY + I  VG +TA+KL+  H ++++I+  I+       KWK+P ++   Y+ A + F
Sbjct: 229 GCDYCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDW--PYKQARMLF 286

>Scas_717.64
          Length = 379

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 106/230 (46%), Gaps = 20/230 (8%)

Query: 49  GQPTEKYLQFFVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLW 108
           G+ T   +  F + L ++ +   I+P  VFDG    +K+   +KR  +R E+  +  +  
Sbjct: 59  GETTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPTLKSHELSKRTSRREETEKKLAEAV 116

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
           ++ E+ K      K      +  K +++     G  YV AP EA+ Q   L K G V   
Sbjct: 117 DQAEKMKQERRLVKVSKEHNDEAKKLLELM---GIPYVNAPGEAESQCAELAKKGKVYAA 173

Query: 169 ISEDSDLLVFGCRRLITKLNDYGEGF-----EICRDDFVHLPDKFPLNSLGESGLRTMVC 223
            SED D L +    L+  L  + E       EI  +  +   D   L    + G+     
Sbjct: 174 ASEDMDTLCYRTPYLLRHLT-FSEAKKEPIQEINTEQVLQGLD-LTLEQFIDLGI----- 226

Query: 224 LAGCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIKR-EG--KWKVPAEF 270
           + GCDY   I  VG +TA+KL+ +H ++++I+  I+  EG  KWKVP  +
Sbjct: 227 MLGCDYCDNIRGVGPVTALKLIKEHGSLEKIVEFIESDEGNKKWKVPENW 276

>AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH]
           (675260..678172) [2913 bp, 970 aa]
          Length = 970

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 10/143 (6%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++TPEM + I       G  Y+ AP EA+ Q   L +  L+ GII++DSD+ +FG  ++ 
Sbjct: 704 EVTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLRLKLIDGIITDDSDVFLFGGSKVF 763

Query: 185 TKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLR--TMVCLAGCDYTKGIPQVGLLTAV 242
             +       E    + +          LG   L+   +  L G DYT GI  +G ++ +
Sbjct: 764 KNMFQEKNYVEYYNTETISA-------ELGLDRLKFIALAQLMGSDYTNGIKGIGPVSGI 816

Query: 243 KLVVKHKTMDQILLTIKREGKWK 265
           +++  + T+++   T   EG+++
Sbjct: 817 EILANYNTLEE-FRTWYNEGQFR 838

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+  L   L    +PV L    +  +A+D   W+++   +   + G        + FF 
Sbjct: 1   MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLKAARDKNGNRLKGAHIIGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +   +L   + I+P  VFDG    +K  T  +R E+R   R  A
Sbjct: 61  RICKLL--YFGIKPVFVFDGGVPPLKRETIRQRKERREGKRESA 102

>Scas_645.8
          Length = 1000

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 86/195 (44%), Gaps = 18/195 (9%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++TPEM + + +     G  Y+ AP EA+ Q   L +  LV G++++DSD+ +FG  ++ 
Sbjct: 735 EVTPEMIQDVQELLSRFGVPYITAPMEAEAQCAELLQLKLVDGVVTDDSDVFLFGGSKIY 794

Query: 185 TKLNDYGEGFEICRDDFVHLPDKFP-LNSLG--ESGLRTMVCLAGCDYTKGIPQVGLLTA 241
             +            ++V   D    L +LG     +  +  L G DYT GI  +G +++
Sbjct: 795 KNM--------FHEKNYVEFYDSESILRNLGLDRENMIELAELLGSDYTNGIKGMGPVSS 846

Query: 242 VKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEVP 301
           ++++ +   + +          W    +F  + +  +  FQ       + N++   +  P
Sbjct: 847 LEVLAEFGNLKEF-------RNWYNEGQFDKKKQEGETKFQKDLRKRLVNNKIVLDSNFP 899

Query: 302 STLREDPILYECIGH 316
           S L  D  +   + H
Sbjct: 900 SELVHDAYINPEVDH 914

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+      +    +PV L   + + +A+D   W+++   +   + G  + +  ++  F 
Sbjct: 1   MGVHSFWDVVGPTARPVRLKSLQDKKMAVDASIWIYQFMKAVRDQDG-NRVSNSHITGFF 59

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +R+  L   + I+P  VFDG    +K  T  +R E R   R  A
Sbjct: 60  RRICKLL-YFGIQPVFVFDGGVPALKRDTIKQRREIRQGKRDNA 102

>ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH]
           (300564..301703) [1140 bp, 379 aa]
          Length = 379

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 120/289 (41%), Gaps = 42/289 (14%)

Query: 1   MGIAGL----LPQLKCIQQPVTLHRYRSQALAIDGYAWLH------RSAHSCATELGMGQ 50
           MGI GL      Q+    +P  + ++  + +AID    L+      R A         G+
Sbjct: 1   MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLIAVRQADGVQLASADGE 60

Query: 51  PTEKYLQFFVKRLTILRDQYDIEPYLVFDG------AGIKVKAGTEAKRHEKR---AESR 101
            T   +  F + L ++   + ++P  VFDG      A  K+   T AK  E++   A+  
Sbjct: 61  TTSHLMGMFYRTLWMV--DHGLKPCYVFDGSRRCLKAPPKLTKRTNAKEPEQKLAEADLN 118

Query: 102 ARAIDLWEKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEK 161
           +R  +   +G  R S   ++      P+              +    P EA+ Q   L K
Sbjct: 119 SRDYEARTRGWSRWSNGMWRGQEIAGPD-----------GHTRMWTLPGEAEAQCAELAK 167

Query: 162 SGLVQGIISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVHLPD-KFPLNSLG--ESGL 218
            G V    SED D L +    L+  L      F   R + +H  D +  L  LG  +  L
Sbjct: 168 KGKVFAAASEDMDTLCYRTPYLLRHLT-----FSEARKEPIHEIDTELVLQGLGLSQEQL 222

Query: 219 RTMVCLAGCDYTKGIPQVGLLTAVKLVVKHKTMDQILLTIKREG--KWK 265
             +  + GCDY + I  VG +TA+KL+ +H +++ I+  I   G  KWK
Sbjct: 223 VDLGIMLGCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGGNAKWK 271

>Kwal_23.4343
          Length = 1031

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 90/203 (44%), Gaps = 22/203 (10%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++T  M   + +     G  Y+ AP EA+ Q   L    LV GII++DSD+ +FG  ++ 
Sbjct: 763 EVTAAMVSEVQELLTRFGIPYMTAPMEAEAQCAELLALKLVDGIITDDSDIFLFGGDKVY 822

Query: 185 TKL---NDYGEGF--EICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLL 239
             +    +Y E +  E+ + +            L       M  L G DYT G+  VG +
Sbjct: 823 KNMFHEKNYVEYYVTELIKREL----------GLDREKFIEMAQLLGSDYTSGVKSVGPV 872

Query: 240 TAVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNE 299
           +A++++ +        LT  R+  W    +F  + +  + +F+ +     + N++   ++
Sbjct: 873 SAMEILAEFGD-----LTAFRD--WYNAGQFSKKIQEQESSFEKKLRKKLVTNEVMLDSD 925

Query: 300 VPSTLREDPILYECIGHAVHKIT 322
            PS L ++  +   + H   K T
Sbjct: 926 FPSELVKEAYIRPEVDHDTTKFT 948

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+  L   +    +PV L    ++ LA+D   W+++   +   + G        + FF 
Sbjct: 1   MGVHALWDVIGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDKEGNAMRYSHVIGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +   +L   + I+P  VFDG    +K  T  +R E+R   R  A
Sbjct: 61  RICKLLY--FGIKPVFVFDGGAPALKRRTIQQRKERRQGRRENA 102

>YGR258C (RAD2) [2205] chr7 complement(1007676..1010771)
           Structure-specific single-stranded DNA endonuclease of
           the nucleotide excision repairosome [3096 bp, 1031 aa]
          Length = 1031

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++T +M K + +     G  Y+ AP EA+ Q   L +  LV GII++DSD+ +FG  ++ 
Sbjct: 766 EVTMDMIKEVQELLSRFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIY 825

Query: 185 TKLNDYGEGFEICRDDFVHLPDK---FPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLTA 241
             +            ++V   D      L  L    +  +  L G DYT G+  +G +++
Sbjct: 826 KNM--------FHEKNYVEFYDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSS 877

Query: 242 VKLVVKHKTM 251
           ++++ +   +
Sbjct: 878 IEVIAEFGNL 887

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+           +PV L     + +A+D   W+++   +   + G          FF 
Sbjct: 1   MGVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDQEGNAVKNSHITGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +   +L   + I P  VFDG    +K  T  +R E+R   R  A
Sbjct: 61  RICKLL--YFGIRPVFVFDGGVPVLKRETIRQRKERRQGKRESA 102

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 992

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 87/195 (44%), Gaps = 18/195 (9%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++T +M K + +     G  Y+ AP EA+ Q   L    LV GII++DSD+ +FG +++ 
Sbjct: 727 EVTMDMIKDVQELLARFGIPYITAPMEAEAQCAELVNLKLVDGIITDDSDVFLFGGKKVY 786

Query: 185 TKL---NDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLTA 241
             +    +Y E ++   D +  L        L    +  +  L G DYT GI  +G +++
Sbjct: 787 KNMFQEKNYVEYYD-SEDIYQGL-------GLTRETMIELAQLLGSDYTTGIKGMGPVSS 838

Query: 242 VKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEVP 301
           ++++ +   +       K   +W    +F  + +  +  F+       +KN +   ++ P
Sbjct: 839 MEILAEFGDL-------KNFKRWYNEGQFDKKKQEGEDKFRRDLRKKLVKNDIILDDDFP 891

Query: 302 STLREDPILYECIGH 316
           S    D  L   + H
Sbjct: 892 SVFVADSYLNPEVDH 906

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 2/110 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+      +    +PV L     + +A+D   W+++   +   + G    +     FF 
Sbjct: 1   MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQFLKAVRDKEGNAIKSAHITGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEK 110
           +   +L   + I+P  VFDG    +K  T  KR E+R   R  A +  +K
Sbjct: 61  RVCKLL--YFGIKPVFVFDGGVPVLKRKTIQKRKERREGKRDNATNTAKK 108

>KLLA0A09427g complement(821244..824279) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 1011

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 82/194 (42%), Gaps = 20/194 (10%)

Query: 125 DITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           ++T EM   I       G  Y+ AP EA+ Q   L +  LV G+I++DSD+ +FG   + 
Sbjct: 745 EVTIEMIHEIQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLFGGTHVY 804

Query: 185 TKL---NDYGEGFEICRDDFVHLPDKFPLN-SLGESGLRTMVCLAGCDYTKGIPQVGLLT 240
             +    +Y E + +         D F     L    L  +  L G DYT G+  +G + 
Sbjct: 805 KNMFQEKNYVEYYSL---------DLFDQKLGLDRDKLIQLAQLLGSDYTPGLRGIGPVM 855

Query: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300
            V+++ +  ++ +         KW    +F  +    + AFQ Q     + N++   +  
Sbjct: 856 GVEILAEFGSLKEF-------AKWYNEGQFDKQKLEGETAFQKQLRKRLVSNEIILDDNF 908

Query: 301 PSTLREDPILYECI 314
           PS    D  ++  +
Sbjct: 909 PSEAVYDAYIHPTV 922

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+  L   +  + +PV L     + +A+D   W+++   +   + G        + FF 
Sbjct: 1   MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRNKEGDALRNAHIIGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +   +L   Y I+P  VFDG    +K  T  +R E+R   R  A
Sbjct: 61  RICKLLY--YGIKPVFVFDGGVPVLKLNTIRERKERRQGKRDTA 102

>Sklu_2443.25 YGR258C, Contig c2443 54418-57519
          Length = 1033

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 24/145 (16%)

Query: 109 EKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGI 168
           +K E+R S E       +T  M K I +     G  Y+ AP EA+ Q   L +  LV GI
Sbjct: 758 QKKEKRDSDE-------VTAVMIKEIQELLSRFGIPYITAPMEAEAQCAELIRLELVDGI 810

Query: 169 ISEDSDLLVFGCRRLITKL---NDYGEGFE---ICRDDFVHLPDKFPLNSLGESGLRTMV 222
           I++DSD+ +FG  R+   +    +Y E +E   I RD             L    +  + 
Sbjct: 811 ITDDSDVFLFGGDRVYKNMFHEKNYVEFYESGAILRD-----------LGLNRDRMIELA 859

Query: 223 CLAGCDYTKGIPQVGLLTAVKLVVK 247
            L G DYT+G+  +G +  ++++ +
Sbjct: 860 QLLGSDYTEGVKGIGPVYGMEVLAE 884

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 2/104 (1%)

Query: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60
           MG+      +    +PV L     + +A+D   W+++   +   + G        + FF 
Sbjct: 1   MGVYAFWDIVGPTARPVRLESLADKRMAVDASIWIYQFLKAVRDKEGNAMRHSHVVGFFR 60

Query: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARA 104
           +   +L   + I+P  +FDG    +K  T  +R E+R   R  A
Sbjct: 61  RVCKLL--YFGIKPVFIFDGGAPALKRQTINQRKERRQGKRDDA 102

>Kwal_47.19168
          Length = 673

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 95/247 (38%), Gaps = 36/247 (14%)

Query: 23  RSQALAIDGYAWLHRSAHSCATELGMGQPTEKY------LQFFVKRLTILRDQYDIEPYL 76
           RS  +AID + WL          +   QP + Y      +  F+ RL +     D+   L
Sbjct: 34  RSPRIAIDAFTWLFECGF-----ISEFQPEKAYKTDAHSVISFLNRLKLFL-SLDVTFIL 87

Query: 77  VFDGAGIKVKAGTEAKRHEKRAESRARAID---LWEKGERRKSFEYFQKCV-----DITP 128
           VFDG    +K   + K   K A      ++        E  +  E    C+       TP
Sbjct: 88  VFDGP---MKPSFKNKFKSKTAVQSPIEVEEDYFGVYNEHHRQHEQSGTCIGGPGIQSTP 144

Query: 129 EMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITKLN 188
            + K I+         Y+ +  E + +   L+K  LV  ++S DSD  VFG  +++  ++
Sbjct: 145 TIVKEILK---AMNISYIESCSEGEAECARLQKLNLVDYVLSNDSDAFVFGANKVLRNMS 201

Query: 189 DYGEGFEIC----------RDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGL 238
            + E               ++ FV + D   ++    + +     L G DY +G+  +G 
Sbjct: 202 KFWEDLPATSSSPVKKRDHKEMFVTIVDLQQISDWNRASIVFFCTLLGADYNQGVRGLGS 261

Query: 239 LTAVKLV 245
             A KL 
Sbjct: 262 KKAAKLA 268

>YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nuclease,
           has similarity to DNA repair nucleases Rad2p and Rad27p
           [2280 bp, 759 aa]
          Length = 759

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 14/144 (9%)

Query: 59  FVKRLTILRDQYDIEPYLVFDGAGIKVKAGTEAK-RHEKRA---ESRARAIDLWEKGERR 114
           F+ RL  L    ++E  LVFDG    +K   + K  HE+ A   +        WE  +  
Sbjct: 99  FISRLKELL-SLNVEFLLVFDGV---MKPSFKRKFNHEQNATTCDDEKEYYSSWE--QHV 152

Query: 115 KSFEYFQKCVDI----TPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIIS 170
           K+ E +  C  +     PE   ++          YV+A  E + Q V+L+ SG V  I+S
Sbjct: 153 KNHEVYGNCKGLLAPSDPEFISLVRKLLDLMNISYVIACGEGEAQCVWLQVSGAVDFILS 212

Query: 171 EDSDLLVFGCRRLITKLNDYGEGF 194
            DSD LVFG  +++   + + + F
Sbjct: 213 NDSDTLVFGGEKILKNYSKFYDDF 236

>KLLA0A01320g complement(118369..120123) weakly similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1 singleton, start
           by similarity
          Length = 584

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 22/171 (12%)

Query: 23  RSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFVKRLTILRDQYDIEPYLV--FDG 80
           R   +AIDGY WL    +         +P  K  +  +  L  L++   ++ ++V  FDG
Sbjct: 33  RFPRIAIDGYLWLFECGY-------FDEPQNKS-KTLLNWLRKLKEMLHLQCFIVIIFDG 84

Query: 81  AGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYFQKCVDITPEMTKVIIDYCIG 140
                    + KR +KR     +   LW+     +S   F    D    +   II+ C  
Sbjct: 85  T-----FKLDGKRRKKR-----KVATLWDSYWLMRSMNRFNH--DSVSYVDDYIIECCKL 132

Query: 141 AGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITKLNDYG 191
              + + AP E + Q  +L+  G V  ++S D+D+L FG  +++   + +G
Sbjct: 133 FNIQTINAPGEGEAQCAFLQLVGQVDFVLSNDADVLSFGASKVLKNYSKHG 183

>Scas_687.23
          Length = 745

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 72/175 (41%), Gaps = 17/175 (9%)

Query: 23  RSQALAIDGYAWLHR----SAHSCATELGMGQPTEKYLQFFVKRLTILRDQYDIEPYLVF 78
           RS  +AID Y WL       +H  + +        K +  F+ RL  L    D+   LVF
Sbjct: 34  RSPRIAIDAYNWLFECGFIKSHGNSIKYNSQGTLPKAILNFISRLKDLL-SLDVTFLLVF 92

Query: 79  DGAGIKVKAGTEAK-RHEKRAESRARAIDLWEKGERRKSFEYFQK-----CVDIT---PE 129
           DG    +K   +    +E  A      ID+ E  ++ +    + K     C+  T   PE
Sbjct: 93  DGP---MKPSFKNNFMNESDATLDFNQIDMIEYMKQWELHIQYHKDNATGCLTSTNHQPE 149

Query: 130 MTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
               I          ++ +  E + Q  +L+ +G V  I + DSD L+FG  +L+
Sbjct: 150 FMSCITTILRAMNISFLESCGEGEAQCAWLQINGYVDFIWTNDSDTLIFGGTKLL 204

>AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH]
           complement(869659..871755) [2097 bp, 698 aa]
          Length = 698

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 89/247 (36%), Gaps = 42/247 (17%)

Query: 23  RSQALAIDGYAWLHRSA-------HSCATELGMGQPTEKYLQFFVKRLTILRD--QYDIE 73
           RS  +A+D + WL              +T      P +  L F  K    LRD    D++
Sbjct: 34  RSPKIAVDAFQWLFECGFLFNVQQEERSTSAVWPAPRKAILNFVTK----LRDLISLDLD 89

Query: 74  PYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYFQKCVDITPEMTKV 133
             LVFDG    +      K+     ++ AR      +G   +        VD+   + + 
Sbjct: 90  FVLVFDGDEKPIYKQHYWKKRGTGQQTEARYS---PRGRSPQLPHQLHSVVDLAGGICRA 146

Query: 134 I-IDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITKLNDYGE 192
             +DY   AG        E + +   L+ +G V  I++ DSD  +FG  R++   + + +
Sbjct: 147 FNVDYITAAG--------EGEAECAALQVAGSVDYILTNDSDAAIFGASRILRNFSKHAQ 198

Query: 193 GF---------EICRDDFVHLPD------KFPLNSLGESGLRTMVCLAGCDYTKGIPQVG 237
                      +   + FV + D      + P  +           L G DY  G+  +G
Sbjct: 199 DLPSSGVSPVKKHVSEYFVTVVDIRAATEEHP--TFSRKAFALFAILTGADYGTGLQHLG 256

Query: 238 LLTAVKL 244
              A  L
Sbjct: 257 YKRAWAL 263

>AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH]
           complement(1431488..1433797) [2310 bp, 769 aa]
          Length = 769

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 134 IIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLI 184
           +I Y I  G  Y+VAPY +  QL YL + G V GI      LLV    + I
Sbjct: 166 LIQYFISKGINYMVAPYSSWIQLAYLLEDGYVDGIYGPTDLLLVESVPKFI 216

>YNL085W (MKT1) [4505] chr14 (467131..469623) Protein containing a
           Xeroderma pigmentosum group G (XPG) N-terminal domain,
           has low similarity to uncharacterized C. albicans
           Orf6.1472p [2493 bp, 830 aa]
          Length = 830

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 134 IIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180
           +I Y I  G+ Y VAPY +  QL YL  S  +  I    +D L+  C
Sbjct: 174 LIAYFIEHGYMYQVAPYSSWFQLAYLLNSAYIDAIYGP-TDCLMLDC 219

>Sklu_1834.2 YNL085W, Contig c1834 1199-3610
          Length = 803

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 20/87 (22%)

Query: 134 IIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITK------- 186
           +I Y I  G  Y VAPY +  QL YL ++G +  I      L++    + I         
Sbjct: 177 LICYLISQGIAYQVAPYSSWLQLAYLLQNGYIDAIYGPTDCLMLPEVEKFILGMEFPNKE 236

Query: 187 ---------LNDYGEGFEICRDDFVHL 204
                    LND    F I +D+F+ +
Sbjct: 237 FRFIENSRVLND----FNISQDEFIDI 259

>CAGL0C02255g complement(228009..229955) similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1, start by
           similarity
          Length = 648

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 47/118 (39%), Gaps = 18/118 (15%)

Query: 145 YVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGCRRLITKLNDYGEG----------- 193
           Y  A  E +    +L+ S  V  ++S DSD L+FG  R++  L+   E            
Sbjct: 169 YTFAYGEGESHCAWLQISDHVDYVMSNDSDTLMFGATRVLRNLSKNLEDKSPSSRQGNNS 228

Query: 194 ------FEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLTAVKLV 245
                 + I   +   +  K+ L  L  + L     + G DY  G+  +G   A+ L+
Sbjct: 229 TSSEAEYYITEVNLQEINQKYGL-QLSSASLLFFSLIIGGDYNSGLSGLGKTKALTLM 285

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 478 LALPMTPADSVDAGVI--MSCFAKTPEKENVSQILDGIGSTGQEHTEVDEITE 528
           L +P+ PA    AG++   +C+ K PE+E+V      +  T  EH   D  TE
Sbjct: 79  LDIPVAPAPGGCAGLVEPPACYPKRPEEEDVGIFASALDWTALEHVGSDSRTE 131

>Sklu_2195.2 YBR042C, Contig c2195 2283-3443
          Length = 386

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 105 IDLWEKGERRKSFEYFQKCVDITPEMTKVIIDYCIGAGFKYVVAPYE 151
            ++WE+ +R     Y +K  D+ PE+   I D+C        ++PYE
Sbjct: 323 FNVWEEKDRLMDTYYEKKSFDLDPELNHTITDFC-------RISPYE 362

>Kwal_33.14738
          Length = 963

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 11/119 (9%)

Query: 167 GIISEDSDLLVFGCRRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGE-SGLRTMVCLA 225
            IIS D+   +    R++T      E FE  +++   L  +FP N + + + + T V L 
Sbjct: 173 NIISNDTSRFLRRVTRIVTPGTFIDEAFENLQENTFLLSLEFPENCMRKVADIDTKVGLC 232

Query: 226 GCDYTKG---IPQVGLLTAVKLVVK----HKTMDQILLTIKRE-GKWKVPAEFLDEYRF 276
            CD + G   + QV L   V  + +       +D+ +L  K E G+W    EF++  +F
Sbjct: 233 WCDISTGEIFVQQVLLKDVVSAITRIAPCEILLDEEILAFKIESGEWY--PEFVELKKF 289

>Kwal_33.13308
          Length = 706

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 347 LNPCNHKQALINRERQLGVDKG---VVHLTVSSVPCTSAPTRPVS 388
           LN  N +  +IN    L   K    V  LT+++VPC SA  +P+S
Sbjct: 8   LNKLNARPQIINLRSNLSYSKAFSSVRPLTLTTVPCKSAWVKPIS 52

>KLLA0D09801g 827563..830193 similar to sgd|S0003991 Saccharomyces
           cerevisiae YLR001c, start by similarity
          Length = 876

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 55/151 (36%), Gaps = 23/151 (15%)

Query: 364 GVDKGVVHL-----TVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRI 418
           G+DK V  L     + +S  C     RP+S +W  K+      P +  + GT LG M   
Sbjct: 724 GIDKEVRILKKGCTSNNSASCVFLIDRPISVNWLSKERYSITLPALSFALGTVLGTMFLF 783

Query: 419 ERIV--------------QKRKLADSHEGQLNESTFFVRRQSA---GGSQQKPVNAAYRS 461
             ++               K + A   E    E        SA     S Q  VNAA R+
Sbjct: 784 SLLLCVIVTCAHKKPSKGYKSRRASDAENNEEEPLIPSENSSAVVPNSSYQATVNAA-RN 842

Query: 462 SDDTRSTQKSLPSSQTLALPMTPADSVDAGV 492
            +    T +S  SS     PM    ++  G+
Sbjct: 843 HNQVSPTFESSYSSNAKTAPMKVGQNITEGL 873

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,269,076
Number of extensions: 858200
Number of successful extensions: 2675
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2721
Number of HSP's successfully gapped: 54
Length of query: 643
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 535
Effective length of database: 12,857,365
Effective search space: 6878690275
Effective search space used: 6878690275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)